Pogo transposable element with ZNF domain

Overview
NamePogo transposable element with ZNF domain
Smed IDSMED30031380
Length (bp)2350
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pogo transposable element with ZNF domain (SMED30031380) t-SNE clustered cells

Violin plots show distribution of expression levels for Pogo transposable element with ZNF domain (SMED30031380) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pogo transposable element with ZNF domain (SMED30031380) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pogo transposable element with ZNF domain (SMED30031380) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031380

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031380SMESG000014324.1 SmedASXL_019067SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30031380SMESG000014324.1 SmedASXL_019067SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30031380 SmedASXL_024240SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30031380SMESG000014324.1 MF411143smed_ncbi_20200123PMID:29557542
Han et al., 2019
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30031380SMESG000014324.1 MF411143smed_ncbi_20200123PMID:29557542
Han et al., 2019
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30031380SMESG000014324.1 MF411143smed_ncbi_20200123PMID:29557542
Han et al., 2019
FACS sorted cell population asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30031380SMESG000014324.1 dd_Smed_v4_2118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031380SMESG000014324.1 dd_Smed_v4_2118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031380SMESG000014324.1 dd_Smed_v4_2118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30031380SMESG000014324.1 dd_Smed_v4_2118_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Human
Match: POGZ (pogo transposable element derived with ZNF domain [Source:HGNC Symbol;Acc:HGNC:18801])

HSP 1 Score: 124.79 bits (312), Expect = 1.859e-28
Identity = 86/313 (27.48%), Postives = 131/313 (41.85%), Query Frame = 2
Query:  899 TISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESY----PDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLM--------------CIECG-ESLSLDQH-KRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLV 1777
            T  C+ICE   +S      H++++H+  EMPY C +C + +SLY +V  HF+  H DT  L+CPYCL++F   +A                    F QH   H+     HC  C L F+   D ++  +L H     K +      P  K +  A  S  + R  P+  +  P     P   +  AP  S +  L   ++P    S+               C+EC  E      H   Y+ CS+CR+++CC+ A+  H++ NH   +     +   LF      N V      CT C      G+A+  HLV
Sbjct:  550 TTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNA--------------------FQQHYMRHQKRNVYHCNKCRLQFLFAKD-KIEHKLQHHKTFRKPKQLEGLKPGTKVTIRA--SRGQPRTVPVSSNDTP-----PSALQEAAPLTSSMDPLPVFLYPPVQRSIQKRAVRKMSVMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYSTCCSRAYANHMINNHVPRK---SPKYLALF-----KNSVSGIKLACTSCTFVTSVGDAMAKHLV 826          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Human
Match: POGZ (pogo transposable element derived with ZNF domain [Source:HGNC Symbol;Acc:HGNC:18801])

HSP 1 Score: 124.79 bits (312), Expect = 1.982e-28
Identity = 86/313 (27.48%), Postives = 131/313 (41.85%), Query Frame = 2
Query:  899 TISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESY----PDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLM--------------CIECG-ESLSLDQH-KRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLV 1777
            T  C+ICE   +S      H++++H+  EMPY C +C + +SLY +V  HF+  H DT  L+CPYCL++F   +A                    F QH   H+     HC  C L F+   D ++  +L H     K +      P  K +  A  S  + R  P+  +  P     P   +  AP  S +  L   ++P    S+               C+EC  E      H   Y+ CS+CR+++CC+ A+  H++ NH   +     +   LF      N V      CT C      G+A+  HLV
Sbjct:  559 TTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNA--------------------FQQHYMRHQKRNVYHCNKCRLQFLFAKD-KIEHKLQHHKTFRKPKQLEGLKPGTKVTIRA--SRGQPRTVPVSSNDTP-----PSALQEAAPLTSSMDPLPVFLYPPVQRSIQKRAVRKMSVMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYSTCCSRAYANHMINNHVPRK---SPKYLALF-----KNSVSGIKLACTSCTFVTSVGDAMAKHLV 835          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Human
Match: POGZ (pogo transposable element derived with ZNF domain [Source:HGNC Symbol;Acc:HGNC:18801])

HSP 1 Score: 124.405 bits (311), Expect = 2.179e-28
Identity = 86/313 (27.48%), Postives = 131/313 (41.85%), Query Frame = 2
Query:  899 TISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESY----PDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLM--------------CIECG-ESLSLDQH-KRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLV 1777
            T  C+ICE   +S      H++++H+  EMPY C +C + +SLY +V  HF+  H DT  L+CPYCL++F   +A                    F QH   H+     HC  C L F+   D ++  +L H     K +      P  K +  A  S  + R  P+  +  P     P   +  AP  S +  L   ++P    S+               C+EC  E      H   Y+ CS+CR+++CC+ A+  H++ NH   +     +   LF      N V      CT C      G+A+  HLV
Sbjct:  497 TTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNA--------------------FQQHYMRHQKRNVYHCNKCRLQFLFAKD-KIEHKLQHHKTFRKPKQLEGLKPGTKVTIRA--SRGQPRTVPVSSNDTP-----PSALQEAAPLTSSMDPLPVFLYPPVQRSIQKRAVRKMSVMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYSTCCSRAYANHMINNHVPRK---SPKYLALF-----KNSVSGIKLACTSCTFVTSVGDAMAKHLV 773          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Human
Match: POGZ (pogo transposable element derived with ZNF domain [Source:HGNC Symbol;Acc:HGNC:18801])

HSP 1 Score: 124.405 bits (311), Expect = 2.207e-28
Identity = 86/313 (27.48%), Postives = 131/313 (41.85%), Query Frame = 2
Query:  899 TISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESY----PDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLM--------------CIECG-ESLSLDQH-KRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLV 1777
            T  C+ICE   +S      H++++H+  EMPY C +C + +SLY +V  HF+  H DT  L+CPYCL++F   +A                    F QH   H+     HC  C L F+   D ++  +L H     K +      P  K +  A  S  + R  P+  +  P     P   +  AP  S +  L   ++P    S+               C+EC  E      H   Y+ CS+CR+++CC+ A+  H++ NH   +     +   LF      N V      CT C      G+A+  HLV
Sbjct:  506 TTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNA--------------------FQQHYMRHQKRNVYHCNKCRLQFLFAKD-KIEHKLQHHKTFRKPKQLEGLKPGTKVTIRA--SRGQPRTVPVSSNDTP-----PSALQEAAPLTSSMDPLPVFLYPPVQRSIQKRAVRKMSVMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYSTCCSRAYANHMINNHVPRK---SPKYLALF-----KNSVSGIKLACTSCTFVTSVGDAMAKHLV 782          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Human
Match: POGZ (pogo transposable element derived with ZNF domain [Source:HGNC Symbol;Acc:HGNC:18801])

HSP 1 Score: 124.02 bits (310), Expect = 3.337e-28
Identity = 84/313 (26.84%), Postives = 131/313 (41.85%), Query Frame = 2
Query:  899 TISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESY----PDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLM--------------CIECGESLS--LDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLV 1777
            T  C+ICE   +S      H++++H+  EMPY C +C + +SLY +V  HF+  H DT  L+CPYCL++F   +A                    F QH   H+     HC  C L F+   D ++  +L H     K +      P  K +  A  S  + R  P+  +  P     P   +  AP  S +  L   ++P    S+               C+EC   +    +    Y+ CS+CR+++CC+ A+  H++ NH   +     +   LF      N V      CT C      G+A+  HLV
Sbjct:  464 TTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNA--------------------FQQHYMRHQKRNVYHCNKCRLQFLFAKD-KIEHKLQHHKTFRKPKQLEGLKPGTKVTIRA--SRGQPRTVPVSSNDTP-----PSALQEAAPLTSSMDPLPVFLYPPVQRSIQKRAVRKMSVMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYSTCCSRAYANHMINNHVPRK---SPKYLALF-----KNSVSGIKLACTSCTFVTSVGDAMAKHLV 740          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Celegans
Match: row-1 (Relative of Woc homolog [Source:UniProtKB/TrEMBL;Acc:A5JYT9])

HSP 1 Score: 53.5286 bits (127), Expect = 4.468e-7
Identity = 40/131 (30.53%), Postives = 59/131 (45.04%), Query Frame = 2
Query:  905 SCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHC-DTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDH 1294
            +C ICE    ++ AL  H++  H   E PY C  C + TS+      HF + H  D+  L+CP CL   +      + PN   S    V +   F+ H+++H       C  C L F ++   E HR  DH
Sbjct:  274 TCNICELDFGNSIALNTHMK-KHISGEAPYNCQKCKYRTSVRAFFYQHFIEKHSNDSRTLLCPICLHHED------LRPNVRRSKHIFVRE---FVNHMRSHALGPQMRCHVCALTFTSRLLLEAHRTNDH 394          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Celegans
Match: row-1 (Relative of Woc homolog [Source:UniProtKB/TrEMBL;Acc:A5JYT9])

HSP 1 Score: 53.5286 bits (127), Expect = 4.468e-7
Identity = 40/131 (30.53%), Postives = 59/131 (45.04%), Query Frame = 2
Query:  905 SCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHC-DTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDH 1294
            +C ICE    ++ AL  H++  H   E PY C  C + TS+      HF + H  D+  L+CP CL   +      + PN   S    V +   F+ H+++H       C  C L F ++   E HR  DH
Sbjct:  274 TCNICELDFGNSIALNTHMK-KHISGEAPYNCQKCKYRTSVRAFFYQHFIEKHSNDSRTLLCPICLHHED------LRPNVRRSKHIFVRE---FVNHMRSHALGPQMRCHVCALTFTSRLLLEAHRTNDH 394          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Celegans
Match: row-1 (Relative of Woc homolog [Source:UniProtKB/TrEMBL;Acc:A5JYT9])

HSP 1 Score: 51.2174 bits (121), Expect = 2.303e-6
Identity = 39/130 (30.00%), Postives = 58/130 (44.62%), Query Frame = 2
Query:  905 SCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDH 1294
            +C ICE    ++ AL  H++  H   E PY C  C + TS+      HF + H +   L+CP CL   +      + PN   S    V +   F+ H+++H       C  C L F ++   E HR  DH
Sbjct:  274 TCNICELDFGNSIALNTHMK-KHISGEAPYNCQKCKYRTSVRAFFYQHFIEKHSNET-LLCPICLHHED------LRPNVRRSKHIFVRE---FVNHMRSHALGPQMRCHVCALTFTSRLLLEAHRTNDH 392          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Celegans
Match: row-1 (Relative of Woc homolog [Source:UniProtKB/TrEMBL;Acc:A5JYT9])

HSP 1 Score: 51.2174 bits (121), Expect = 2.303e-6
Identity = 39/130 (30.00%), Postives = 58/130 (44.62%), Query Frame = 2
Query:  905 SCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDH 1294
            +C ICE    ++ AL  H++  H   E PY C  C + TS+      HF + H +   L+CP CL   +      + PN   S    V +   F+ H+++H       C  C L F ++   E HR  DH
Sbjct:  274 TCNICELDFGNSIALNTHMK-KHISGEAPYNCQKCKYRTSVRAFFYQHFIEKHSNET-LLCPICLHHED------LRPNVRRSKHIFVRE---FVNHMRSHALGPQMRCHVCALTFTSRLLLEAHRTNDH 392          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Celegans
Match: row-1 (Relative of Woc homolog [Source:UniProtKB/TrEMBL;Acc:A5JYT9])

HSP 1 Score: 51.2174 bits (121), Expect = 2.422e-6
Identity = 39/130 (30.00%), Postives = 58/130 (44.62%), Query Frame = 2
Query:  905 SCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDH 1294
            +C ICE    ++ AL  H++  H   E PY C  C + TS+      HF + H +   L+CP CL   +      + PN   S    V +   F+ H+++H       C  C L F ++   E HR  DH
Sbjct:  273 TCNICELDFGNSIALNTHMK-KHISGEAPYNCQKCKYRTSVRAFFYQHFIEKHSNET-LLCPICLHHED------LRPNVRRSKHIFVRE---FVNHMRSHALGPQMRCHVCALTFTSRLLLEAHRTNDH 391          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Fly
Match: row (gene:FBgn0033998 transcript:FBtr0329939)

HSP 1 Score: 85.8853 bits (211), Expect = 8.870e-17
Identity = 89/347 (25.65%), Postives = 136/347 (39.19%), Query Frame = 2
Query:  908 CRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSL--FLQHLKTH---KDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQ--HKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVEECGVCMVTLRPDPQLLAAREQAEKEHET-MIGIEDTELESDGNKNMIME 1924
            C IC++  +S   L  HLQ  H   E+PY C  C + +S ++D++ HF   H   N L CPYCL IF              S +  V Q  +  +  HL  H   +D   + C  C+L+F+ K D + H  + H   + KT                    N P+      ++   P   R +  E          VF   L+   C EC    + ++  +  +L C  C + +CC  A  RH +  + N   VD   V +             ++ +C  C     +GN +  HL   CG+        P L AA E A K +   M+G+   + E+ G    I E
Sbjct:  812 CLICQQRHNSLHLLTAHLQKVHSTLELPYWCHSCGYRSSSHRDLVRHFYDDHKHQNFLQCPYCLDIFYF------------SKLGVVNQLRIEHYFMHLDEHINKRDPSLR-CQKCSLSFLEKGDLKQH-AVQHHVSMTKT--------------------NRPVRLLLNNSMLIPPPKIRTHHREQPPFSTYKRPVFFAFLEGKTCAECNTDFASEETHYTGWLHCVKCNYQTCCERAQFRHGVECNGNF--VDAMEVNM------------PQEMHCI-CGFATGNGNKMAQHLA-NCGLSTCY----PSLEAASENAVKRNMLDMLGLVRRDGETSGEGADISE 1104          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Fly
Match: row (gene:FBgn0033998 transcript:FBtr0087402)

HSP 1 Score: 85.8853 bits (211), Expect = 9.204e-17
Identity = 89/347 (25.65%), Postives = 136/347 (39.19%), Query Frame = 2
Query:  908 CRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSL--FLQHLKTH---KDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQ--HKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVEECGVCMVTLRPDPQLLAAREQAEKEHET-MIGIEDTELESDGNKNMIME 1924
            C IC++  +S   L  HLQ  H   E+PY C  C + +S ++D++ HF   H   N L CPYCL IF              S +  V Q  +  +  HL  H   +D   + C  C+L+F+ K D + H  + H   + KT                    N P+      ++   P   R +  E          VF   L+   C EC    + ++  +  +L C  C + +CC  A  RH +  + N   VD   V +             ++ +C  C     +GN +  HL   CG+        P L AA E A K +   M+G+   + E+ G    I E
Sbjct:  812 CLICQQRHNSLHLLTAHLQKVHSTLELPYWCHSCGYRSSSHRDLVRHFYDDHKHQNFLQCPYCLDIFYF------------SKLGVVNQLRIEHYFMHLDEHINKRDPSLR-CQKCSLSFLEKGDLKQH-AVQHHVSMTKT--------------------NRPVRLLLNNSMLIPPPKIRTHHREQPPFSTYKRPVFFAFLEGKTCAECNTDFASEETHYTGWLHCVKCNYQTCCERAQFRHGVECNGNF--VDAMEVNM------------PQEMHCI-CGFATGNGNKMAQHLA-NCGLSTCY----PSLEAASENAVKRNMLDMLGLVRRDGETSGEGADISE 1104          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Zebrafish
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 108.612 bits (270), Expect = 1.565e-23
Identity = 77/325 (23.69%), Postives = 132/325 (40.62%), Query Frame = 2
Query:  866 YIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTD-----------FELHRRLD--HKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLV--FPEELDSL---MCIECGESLS--LDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVE 1780
            ++++ + +I  +  C+ICE + ++      H++NSH+  EMPY C +C + +S Y DV  HF+  H DT  L+C YCL++F                      ++ + QH   H+     HC  C L F+   D           F   R LD       V   +Y   K+   +   AS    +    S      S  Q          +V  +   +  F E+   L    C+EC   +   ++ +  Y+ CS+C +++CC+ A+  H++ NH        S+       K   + V+     C  C  +   GN +  HL++
Sbjct:  477 HLESVHTSIESSTKCKICEWSFENEPVFLQHMKNSHKPGEMPYVCQVCEYRSSFYSDVFNHFRTWHEDTRHLLCQYCLKVFK--------------------HSTSYQQHYVRHQKSTVYHCNKCRLQFLFTKDKVEHKINHHRTFRKPRELDGLQPGTKVTIRAYVGKKTPGQSASKASTNIQKNSISSSQSTTLSGDQQSEQQQSGKKQVSKMFQFLSKFQEQRAQLGRHKCVECTFDIPDFVNHYPTYVHCSLCFYSTCCSRAYANHMINNHVPGRAPKPSK-------KGPPSVVK---LTCAGCEYSTPHGNLMAKHLIK 771          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Zebrafish
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 108.227 bits (269), Expect = 1.765e-23
Identity = 77/325 (23.69%), Postives = 132/325 (40.62%), Query Frame = 2
Query:  866 YIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTD-----------FELHRRLD--HKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLV--FPEELDSL---MCIECGESLS--LDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVE 1780
            ++++ + +I  +  C+ICE + ++      H++NSH+  EMPY C +C + +S Y DV  HF+  H DT  L+C YCL++F                      ++ + QH   H+     HC  C L F+   D           F   R LD       V   +Y   K+   +   AS    +    S      S  Q          +V  +   +  F E+   L    C+EC   +   ++ +  Y+ CS+C +++CC+ A+  H++ NH        S+       K   + V+     C  C  +   GN +  HL++
Sbjct:  477 HLESVHTSIESSTKCKICEWSFENEPVFLQHMKNSHKPGEMPYVCQVCEYRSSFYSDVFNHFRTWHEDTRHLLCQYCLKVFK--------------------HSTSYQQHYVRHQKSTVYHCNKCRLQFLFTKDKVEHKINHHRTFRKPRELDGLQPGTKVTIRAYVGKKTPGQSASKASTNIQKNSISSSQSTTLSGDQQSEQQQSGKKQVSKMFQFLSKFQEQRAQLGRHKCVECTFDIPDFVNHYPTYVHCSLCFYSTCCSRAYANHMINNHVPGRAPKPSK-------KGPPSVVK---LTCAGCEYSTPHGNLMAKHLIK 771          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Zebrafish
Match: znf280d (zinc finger protein 280D [Source:ZFIN;Acc:ZDB-GENE-030131-2260])

HSP 1 Score: 106.301 bits (264), Expect = 4.148e-23
Identity = 87/348 (25.00%), Postives = 152/348 (43.68%), Query Frame = 2
Query:  866 YIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFIN---KTDFELH--------RRLDHKSQVVKTESYPDYKSSFLAIESAS---------ETRNEPIEDSP---LPNVFSAPQIKRMNAPEPSRV---KDLSNLVFPEELDSLMCIECGESLSLDQHKRY---LPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCA-ITNLDG-NALTSHLVEECG-VCMVTLRP 1813
            +I++ +     + +C+ICE   ++   L  H++++H+  EMPY C +CN+ +S + DV  HF+  H +T +L+CP+CL++                         +++QH   H+    + C  C LNF+    K + ++H        R L+      K         + ++ ES+S         E+  +P   SP    PNV    + K  N    +R     +L  L  P+  +   C+EC   + +D +  Y   L C+ C++ S C  AF +H++R H N  +V   +V      K     VR+    C KC  + +  G + +T HL+      C V + P
Sbjct:  367 HIESAHSPFESSTNCKICELAFETEQVLLEHMRDNHKPGEMPYGCQVCNYRSSFFCDVDNHFRTVHENTKDLLCPFCLKVLR--------------------SGHMYMQHYMRHQKKGIQRCGKCRLNFLTYKEKVEHKIHFHRTYRKPRNLEGLPPGTKVTIRASISGAPMSTESSSKSYIIPTSPESTKQPFRTSPNSTKPNVNGG-KAKTANQFNWNRCLYNTELKRLKLPKGDNK--CMECLHDV-VDPYIHYPLSLKCNKCKYRSSCQKAFRQHMIRFHQNSTKVRVGKV------KNPPRGVRSLTLVCLKCDFLADASGADKMTEHLLSRSNHSCQVIMEP 684          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Zebrafish
Match: znf280d (zinc finger protein 280D [Source:ZFIN;Acc:ZDB-GENE-030131-2260])

HSP 1 Score: 106.301 bits (264), Expect = 4.263e-23
Identity = 87/348 (25.00%), Postives = 152/348 (43.68%), Query Frame = 2
Query:  866 YIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFIN---KTDFELH--------RRLDHKSQVVKTESYPDYKSSFLAIESAS---------ETRNEPIEDSP---LPNVFSAPQIKRMNAPEPSRV---KDLSNLVFPEELDSLMCIECGESLSLDQHKRY---LPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCA-ITNLDG-NALTSHLVEECG-VCMVTLRP 1813
            +I++ +     + +C+ICE   ++   L  H++++H+  EMPY C +CN+ +S + DV  HF+  H +T +L+CP+CL++                         +++QH   H+    + C  C LNF+    K + ++H        R L+      K         + ++ ES+S         E+  +P   SP    PNV    + K  N    +R     +L  L  P+  +   C+EC   + +D +  Y   L C+ C++ S C  AF +H++R H N  +V   +V      K     VR+    C KC  + +  G + +T HL+      C V + P
Sbjct:  368 HIESAHSPFESSTNCKICELAFETEQVLLEHMRDNHKPGEMPYGCQVCNYRSSFFCDVDNHFRTVHENTKDLLCPFCLKVLR--------------------SGHMYMQHYMRHQKKGIQRCGKCRLNFLTYKEKVEHKIHFHRTYRKPRNLEGLPPGTKVTIRASISGAPMSTESSSKSYIIPTSPESTKQPFRTSPNSTKPNVNGG-KAKTANQFNWNRCLYNTELKRLKLPKGDNK--CMECLHDV-VDPYIHYPLSLKCNKCKYRSSCQKAFRQHMIRFHQNSTKVRVGKV------KNPPRGVRSLTLVCLKCDFLADASGADKMTEHLLSRSNHSCQVIMEP 685          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Zebrafish
Match: znf280d (zinc finger protein 280D [Source:ZFIN;Acc:ZDB-GENE-030131-2260])

HSP 1 Score: 106.301 bits (264), Expect = 4.304e-23
Identity = 87/348 (25.00%), Postives = 152/348 (43.68%), Query Frame = 2
Query:  866 YIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFIN---KTDFELH--------RRLDHKSQVVKTESYPDYKSSFLAIESAS---------ETRNEPIEDSP---LPNVFSAPQIKRMNAPEPSRV---KDLSNLVFPEELDSLMCIECGESLSLDQHKRY---LPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCA-ITNLDG-NALTSHLVEECG-VCMVTLRP 1813
            +I++ +     + +C+ICE   ++   L  H++++H+  EMPY C +CN+ +S + DV  HF+  H +T +L+CP+CL++                         +++QH   H+    + C  C LNF+    K + ++H        R L+      K         + ++ ES+S         E+  +P   SP    PNV    + K  N    +R     +L  L  P+  +   C+EC   + +D +  Y   L C+ C++ S C  AF +H++R H N  +V   +V      K     VR+    C KC  + +  G + +T HL+      C V + P
Sbjct:  404 HIESAHSPFESSTNCKICELAFETEQVLLEHMRDNHKPGEMPYGCQVCNYRSSFFCDVDNHFRTVHENTKDLLCPFCLKVLR--------------------SGHMYMQHYMRHQKKGIQRCGKCRLNFLTYKEKVEHKIHFHRTYRKPRNLEGLPPGTKVTIRASISGAPMSTESSSKSYIIPTSPESTKQPFRTSPNSTKPNVNGG-KAKTANQFNWNRCLYNTELKRLKLPKGDNK--CMECLHDV-VDPYIHYPLSLKCNKCKYRSSCQKAFRQHMIRFHQNSTKVRVGKV------KNPPRGVRSLTLVCLKCDFLADASGADKMTEHLLSRSNHSCQVIMEP 721          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Xenopus
Match: ENSXETT00000010804.1 (zinc finger protein 280D [Source:NCBI gene;Acc:100144635])

HSP 1 Score: 79.7221 bits (195), Expect = 1.150e-14
Identity = 72/289 (24.91%), Postives = 119/289 (41.18%), Query Frame = 2
Query:  908 CRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDY----------------------------------KSSFLAIESASETRNEPIEDSPL--PNV------FSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLM----CIECG-ESLSLDQH-KRYLPCSVCRFASCCADAFHRHVLRNH 1630
            C+ICE + +S   L  H++++H+  EMPY C +C + +S Y +V  HF+ AH +T  L+CP+CL++  I    P                  ++QH   H++     C  C L F+         ++DHK+Q  +T   P                                     S+ L   S S+  N  I   PL   NV         P+ K ++     R+K ++  +    L S+     CIEC  E    + H   ++ C+ C+F++ C  A+  H++R H
Sbjct:  290 CKICELSFESEQILLQHMKDNHKPGEMPYVCQVCGYRSSAYAEVDSHFRFAHENTKSLLCPFCLKV--IKSGTP------------------YMQHYMKHQNKGVYRCANCRLQFLT-----CKEKMDHKTQHHRTFRKPKQLEGLPPGTKVTIRASVGSIVNSVHSPTNTACTSPPSTALQASSISKITNAKITQGPLVKSNVQNTKPKIPPPKKKPVSTTSKKRIKMINTAL--RNLRSVAGYHKCIECQLEVKDFEGHFHTHVHCTKCKFSTSCNKAYTNHMIRFH 551          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Xenopus
Match: ENSXETT00000010751.1 (zinc finger protein 280D [Source:NCBI gene;Acc:100144635])

HSP 1 Score: 78.5666 bits (192), Expect = 2.627e-14
Identity = 42/140 (30.00%), Postives = 70/140 (50.00%), Query Frame = 2
Query:  908 CRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYP 1327
            C+ICE + +S   L  H++++H+  EMPY C +C + +S Y +V  HF+ AH +T  L+CP+CL++  I    P                  ++QH   H++     C  C L F+   +     ++DHK+Q  +T   P
Sbjct:  337 CKICELSFESEQILLQHMKDNHKPGEMPYVCQVCGYRSSAYAEVDSHFRFAHENTKSLLCPFCLKV--IKSGTP------------------YMQHYMKHQNKGVYRCANCRLQFLTCKE-----KMDHKTQHHRTFRKP 451          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Xenopus
Match: celf3 (CUGBP, Elav-like family member 3 [Source:Xenbase;Acc:XB-GENE-5796618])

HSP 1 Score: 65.855 bits (159), Expect = 2.613e-10
Identity = 85/378 (22.49%), Postives = 134/378 (35.45%), Query Frame = 2
Query:  863 VYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESY----PDYKSSFLAIE--------SASETRNEPIED---SPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLP----CSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLV-----EECGVCMVTLRPDPQLLAAREQAEKEHETMIGIEDTELESDGNKNMIME 1924
            V +D  NG +    +C+ C +   + F L  HL+N H   E   +C IC +        + H K  H                        P E P +       SL        K +   HC  C L F+   D ++  +L H     K        P  K +  A          S+++T + P+ D     L +   + Q KR        + ++     P    S  C+EC  SL +   + + P    CS+CR+++CC+ A+  H++ NH  V       + L    K +S         C+ C      G+A+  HLV       C V    + P   LL     A K  E  +    T + + G    + E
Sbjct:  513 VELDQQNGEVDGHTTCQHCYRQFSTPFQLQCHLENVHSSYESTTKCKICEWAFDSEPLFLQHMKDTH-----------------------KPGEMPYVCQVRAVVSLLCPFPFPSKSVY--HCNKCRLQFLFAKD-KIEHKLQHHKTFRKPRQLEGLKPGTKVTIRASRAPSRSLPVSSADTTSMPLVDMDTDSLADSLYSMQYKRTVKKTSENLSNIHTKRPPYGRQS--CLEC--SLDITDFQNHFPTYVHCSLCRYSTCCSRAYANHMINNH--VPRKSPKYLALFKSCKPSS----VVALTCSSCPFVTRIGDAMAKHLVFNPAHSYCNV----IYPGWLLLCYYRMASKTQEDDVRSYRTAVATVGTSEKVSE 850          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Xenopus
Match: celf3 (CUGBP, Elav-like family member 3 [Source:Xenbase;Acc:XB-GENE-5796618])

HSP 1 Score: 62.7734 bits (151), Expect = 2.225e-9
Identity = 81/338 (23.96%), Postives = 132/338 (39.05%), Query Frame = 2
Query:  863 VYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRI-FNINDAIPMNPNEPPSIVTGVGQ-----TSLFLQH--LKTHKDL-LFK-----HCTGCTLNFINKTDFELHRRLDHKSQVVKTESY----PDYKSSFLAIE--------SASETRNEPIED---SPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLP----CSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLV 1777
            V +D  NG +    +C+ C +   + F L  HL+N H   E   +C IC +        + H K  H    E+  PY  ++  + N      P    +I+ G        T  FL    L+  +D  L +     HC  C L F+   D ++  +L H     K        P  K +  A          S+++T + P+ D     L +   + Q KR        + ++     P    S  C+EC  SL +   + + P    CS+CR+++CC+ A+  H++ NH  V       + L    K +S         C+ C      G+A+  HLV
Sbjct:  513 VELDQQNGEVDGHTTCQHCYRQFSTPFQLQCHLENVHSSYESTTKCKICEWAFDSEPLFLQHMKDTH-KPGEM--PYVCQVRVSSNHIFFFLPTH--TIIGGDKDKLQACTCAFLSRGTLRALQDFNLLRQKSVYHCNKCRLQFLFAKD-KIEHKLQHHKTFRKPRQLEGLKPGTKVTIRASRAPSRSLPVSSADTTSMPLVDMDTDSLADSLYSMQYKRTVKKTSENLSNIHTKRPPYGRQS--CLEC--SLDITDFQNHFPTYVHCSLCRYSTCCSRAYANHMINNH--VPRKSPKYLALFKSCKPSS----VVALTCSSCPFVTRIGDAMAKHLV 834          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Mouse
Match: Pogz (pogo transposable element with ZNF domain [Source:MGI Symbol;Acc:MGI:2442117])

HSP 1 Score: 121.324 bits (303), Expect = 1.356e-27
Identity = 87/316 (27.53%), Postives = 133/316 (42.09%), Query Frame = 2
Query:  899 TISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESY----PDYKSSFLAIESASETRNEPIEDS-----------------PLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECG-ESLSLDQH-KRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLV 1777
            T  C+ICE   +S      H++++H+  EMPY C +C + +SLY +V  HF+  H DT  L+CPYCL++F   +A                    F QH   H+     HC  C L F+   D ++  +L H     K +      P  K +  A  S  + R  P+  +                 PLP VF  P ++R    +   V+ +S       +    C+EC  E      H   Y+ CS+CR+++CC+ A+  H++ NH   +     +   LF      N V      CT C      G+A+  HLV
Sbjct:  556 TTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNA--------------------FQQHYMRHQKRNVYHCNKCRLQFLFAKD-KIEHKLQHHKTFRKPKQLEGLKPGTKVTIRA--SRGQPRTVPVSSNDAPSGTLQEAAALTSTDPLP-VFLYPPVQRNI--QKRAVRKMS------VMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYSTCCSRAYANHMINNHVPRK---SPKYLALF-----KNSVSGIKLACTSCTFATSVGDAMAKHLV 831          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Mouse
Match: Pogz (pogo transposable element with ZNF domain [Source:MGI Symbol;Acc:MGI:2442117])

HSP 1 Score: 121.324 bits (303), Expect = 1.538e-27
Identity = 87/316 (27.53%), Postives = 133/316 (42.09%), Query Frame = 2
Query:  899 TISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESY----PDYKSSFLAIESASETRNEPIEDS-----------------PLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECG-ESLSLDQH-KRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLV 1777
            T  C+ICE   +S      H++++H+  EMPY C +C + +SLY +V  HF+  H DT  L+CPYCL++F   +A                    F QH   H+     HC  C L F+   D ++  +L H     K +      P  K +  A  S  + R  P+  +                 PLP VF  P ++R    +   V+ +S       +    C+EC  E      H   Y+ CS+CR+++CC+ A+  H++ NH   +     +   LF      N V      CT C      G+A+  HLV
Sbjct:  547 TTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNA--------------------FQQHYMRHQKRNVYHCNKCRLQFLFAKD-KIEHKLQHHKTFRKPKQLEGLKPGTKVTIRA--SRGQPRTVPVSSNDAPSGTLQEAAALTSTDPLP-VFLYPPVQRNI--QKRAVRKMS------VMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYSTCCSRAYANHMINNHVPRK---SPKYLALF-----KNSVSGIKLACTSCTFATSVGDAMAKHLV 822          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Mouse
Match: Pogz (pogo transposable element with ZNF domain [Source:MGI Symbol;Acc:MGI:2442117])

HSP 1 Score: 120.939 bits (302), Expect = 1.690e-27
Identity = 87/316 (27.53%), Postives = 133/316 (42.09%), Query Frame = 2
Query:  899 TISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESY----PDYKSSFLAIESASETRNEPIEDS-----------------PLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECG-ESLSLDQH-KRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLV 1777
            T  C+ICE   +S      H++++H+  EMPY C +C + +SLY +V  HF+  H DT  L+CPYCL++F   +A                    F QH   H+     HC  C L F+   D ++  +L H     K +      P  K +  A  S  + R  P+  +                 PLP VF  P ++R    +   V+ +S       +    C+EC  E      H   Y+ CS+CR+++CC+ A+  H++ NH   +     +   LF      N V      CT C      G+A+  HLV
Sbjct:  503 TTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNA--------------------FQQHYMRHQKRNVYHCNKCRLQFLFAKD-KIEHKLQHHKTFRKPKQLEGLKPGTKVTIRA--SRGQPRTVPVSSNDAPSGTLQEAAALTSTDPLP-VFLYPPVQRNI--QKRAVRKMS------VMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYSTCCSRAYANHMINNHVPRK---SPKYLALF-----KNSVSGIKLACTSCTFATSVGDAMAKHLV 778          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Mouse
Match: Pogz (pogo transposable element with ZNF domain [Source:MGI Symbol;Acc:MGI:2442117])

HSP 1 Score: 120.553 bits (301), Expect = 2.284e-27
Identity = 87/316 (27.53%), Postives = 133/316 (42.09%), Query Frame = 2
Query:  899 TISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESY----PDYKSSFLAIESASETRNEPIEDS-----------------PLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECG-ESLSLDQH-KRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLV 1777
            T  C+ICE   +S      H++++H+  EMPY C +C + +SLY +V  HF+  H DT  L+CPYCL++F   +A                    F QH   H+     HC  C L F+   D ++  +L H     K +      P  K +  A  S  + R  P+  +                 PLP VF  P ++R    +   V+ +S       +    C+EC  E      H   Y+ CS+CR+++CC+ A+  H++ NH   +     +   LF      N V      CT C      G+A+  HLV
Sbjct:  461 TTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNA--------------------FQQHYMRHQKRNVYHCNKCRLQFLFAKD-KIEHKLQHHKTFRKPKQLEGLKPGTKVTIRA--SRGQPRTVPVSSNDAPSGTLQEAAALTSTDPLP-VFLYPPVQRNI--QKRAVRKMS------VMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYSTCCSRAYANHMINNHVPRK---SPKYLALF-----KNSVSGIKLACTSCTFATSVGDAMAKHLV 736          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Mouse
Match: Zfp280d (zinc finger protein 280D [Source:MGI Symbol;Acc:MGI:2384583])

HSP 1 Score: 83.5741 bits (205), Expect = 6.032e-16
Identity = 42/140 (30.00%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  908 CRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYP 1327
            C+ICE + ++   L  H++++H+  EMPY C +CN+ +SL+ +V  HF+ +H +T  L+CP+CL++  I  A P                  ++ H   H+      CT C L F+         ++DHK+Q  +T   P
Sbjct:  377 CKICELSFETEQILLQHMKDNHKPGEMPYICQVCNYRSSLFSEVESHFRTSHENTKNLLCPFCLKVIKI--ATP------------------YMHHYMKHQKKGIHRCTKCRLQFLT-----CKEKMDHKTQHHRTFVKP 491          
BLAST of Pogo transposable element with ZNF domain vs. UniProt/SwissProt
Match: sp|Q7Z3K3|POGZ_HUMAN (Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ PE=1 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 9.518e-28
Identity = 86/313 (27.48%), Postives = 131/313 (41.85%), Query Frame = 2
Query:  899 TISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESY----PDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLM--------------CIECG-ESLSLDQH-KRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLV 1777
            T  C+ICE   +S      H++++H+  EMPY C +C + +SLY +V  HF+  H DT  L+CPYCL++F   +A                    F QH   H+     HC  C L F+   D ++  +L H     K +      P  K +  A  S  + R  P+  +  P     P   +  AP  S +  L   ++P    S+               C+EC  E      H   Y+ CS+CR+++CC+ A+  H++ NH   +     +   LF      N V      CT C      G+A+  HLV
Sbjct:  559 TTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNA--------------------FQQHYMRHQKRNVYHCNKCRLQFLFAKD-KIEHKLQHHKTFRKPKQLEGLKPGTKVTIRA--SRGQPRTVPVSSNDTP-----PSALQEAAPLTSSMDPLPVFLYPPVQRSIQKRAVRKMSVMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYSTCCSRAYANHMINNHVPRK---SPKYLALF-----KNSVSGIKLACTSCTFVTSVGDAMAKHLV 835          
BLAST of Pogo transposable element with ZNF domain vs. UniProt/SwissProt
Match: sp|Q8BZH4|POGZ_MOUSE (Pogo transposable element with ZNF domain OS=Mus musculus OX=10090 GN=Pogz PE=1 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 9.486e-27
Identity = 87/316 (27.53%), Postives = 133/316 (42.09%), Query Frame = 2
Query:  899 TISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESY----PDYKSSFLAIESASETRNEPIEDS-----------------PLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECG-ESLSLDQH-KRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLV 1777
            T  C+ICE   +S      H++++H+  EMPY C +C + +SLY +V  HF+  H DT  L+CPYCL++F   +A                    F QH   H+     HC  C L F+   D ++  +L H     K +      P  K +  A  S  + R  P+  +                 PLP VF  P ++R    +   V+ +S       +    C+EC  E      H   Y+ CS+CR+++CC+ A+  H++ NH   +     +   LF      N V      CT C      G+A+  HLV
Sbjct:  556 TTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSSLYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNA--------------------FQQHYMRHQKRNVYHCNKCRLQFLFAKD-KIEHKLQHHKTFRKPKQLEGLKPGTKVTIRA--SRGQPRTVPVSSNDAPSGTLQEAAALTSTDPLP-VFLYPPVQRNI--QKRAVRKMS------VMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYSTCCSRAYANHMINNHVPRK---SPKYLALF-----KNSVSGIKLACTSCTFATSVGDAMAKHLV 831          
BLAST of Pogo transposable element with ZNF domain vs. UniProt/SwissProt
Match: sp|Q68FE8|Z280D_MOUSE (Zinc finger protein 280D OS=Mus musculus OX=10090 GN=Znf280d PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 4.468e-15
Identity = 42/140 (30.00%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  908 CRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYP 1327
            C+ICE + ++   L  H++++H+  EMPY C +CN+ +SL+ +V  HF+ +H +T  L+CP+CL++  I  A P                  ++ H   H+      CT C L F+         ++DHK+Q  +T   P
Sbjct:  402 CKICELSFETEQILLQHMKDNHKPGEMPYICQVCNYRSSLFSEVESHFRTSHENTKNLLCPFCLKVIKI--ATP------------------YMHHYMKHQKKGIHRCTKCRLQFLT-----CKEKMDHKTQHHRTFVKP 516          
BLAST of Pogo transposable element with ZNF domain vs. UniProt/SwissProt
Match: sp|Q6N043|Z280D_HUMAN (Zinc finger protein 280D OS=Homo sapiens OX=9606 GN=ZNF280D PE=1 SV=3)

HSP 1 Score: 82.0333 bits (201), Expect = 1.221e-14
Identity = 40/132 (30.30%), Postives = 67/132 (50.76%), Query Frame = 2
Query:  908 CRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQ 1303
            C+ICE + ++   L  H++++H+  EMPY C +CN+ +S + DV  HF+ +H +T  L+CP+CL++  I  A P                  ++ H   H+      CT C L F+         ++DHK+Q
Sbjct:  390 CKICELSFETEHVLLQHMKDNHKPGEMPYVCQVCNYRSSSFSDVETHFRTSHENTKNLLCPFCLKVIKI--ATP------------------YMHHYMKHQKKGIHRCTKCRLQFLT-----CKEKMDHKTQ 496          
BLAST of Pogo transposable element with ZNF domain vs. UniProt/SwissProt
Match: sp|Q6P3Y5|Z280C_MOUSE (Zinc finger protein 280C OS=Mus musculus OX=10090 GN=Znf280c PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.875e-13
Identity = 38/137 (27.74%), Postives = 69/137 (50.36%), Query Frame = 2
Query:  908 CRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTE 1318
            C+ICE + ++   L  H++++H+  EMPY C +C F +S++ DV  HF+ +H +T  L+CP+CL++  +  A P                  ++ H   H+      C  C L F+   +   H +L+H++ +   E
Sbjct:  392 CKICELSFETEHMLLQHMKDTHKPGEMPYICQVCQFRSSIFSDVETHFRSSHENTKNLLCPFCLKVSRM--ATP------------------YMNHYMRHQKKGIYRCPKCRLQFLTSKEKTEH-KLEHRTFIKPKE 507          
BLAST of Pogo transposable element with ZNF domain vs. TrEMBL
Match: A0A2Z3D3W2 (Factor for initiating regeneration 1 OS=Schmidtea mediterranea OX=79327 GN=Fir1 PE=2 SV=1)

HSP 1 Score: 1038.1 bits (2683), Expect = 0.000e+0
Identity = 499/500 (99.80%), Postives = 500/500 (100.00%), Query Frame = 2
Query:  824 EHMSVIGPDGEQRVYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVEECGVCMVTLRPDPQLLAAREQAEKEHETMIGIEDTELESDGNKNMIMELENVTNIMDVIGGRPAQAIEEQFQESELAAAAGGISSSNDDGNQGQMMIVDESESMDQQLIDDPNTHTISIPEGINLKPGESLVLLICENNTEEFIIINTADINTPEMQEFFTNRRSQNVYVVQSNDEMPESV 2323
            EHMSVIGPDGEQRVYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSI+TGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVEECGVCMVTLRPDPQLLAAREQAEKEHETMIGIEDTELESDGNKNMIMELENVTNIMDVIGGRPAQAIEEQFQESELAAAAGGISSSNDDGNQGQMMIVDESESMDQQLIDDPNTHTISIPEGINLKPGESLVLLICENNTEEFIIINTADINTPEMQEFFTNRRSQNVYVVQSNDEMPESV
Sbjct:  306 EHMSVIGPDGEQRVYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIMTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVEECGVCMVTLRPDPQLLAAREQAEKEHETMIGIEDTELESDGNKNMIMELENVTNIMDVIGGRPAQAIEEQFQESELAAAAGGISSSNDDGNQGQMMIVDESESMDQQLIDDPNTHTISIPEGINLKPGESLVLLICENNTEEFIIINTADINTPEMQEFFTNRRSQNVYVVQSNDEMPESV 805          
BLAST of Pogo transposable element with ZNF domain vs. TrEMBL
Match: A0A4Z2DHL6 (Pogo transposable element with ZNF domain OS=Schistosoma japonicum OX=6182 GN=EWB00_000890 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 1.582e-63
Identity = 168/581 (28.92%), Postives = 268/581 (46.13%), Query Frame = 2
Query:  773 DKMNILISNFQN*LLYQEHMSVIGPDGEQRVYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIP------MNPNEPPSIVT-GVGQTSLFLQHLKTHK-DLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLA--------IESASETRNEPIEDSPLPNVF--SAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCRFASCCADAFHRHVLRNHT-----------------------------NVE---EVDDSRVTLLFGLKTN----------------------SNEVRAEDFYCTKCAITNLDGNALTSHLVEECGVCMVTLRPDPQLLAAREQA---------------EKEHETMIGIEDTEL----ESDGNKNMIMELENVTNIMDVIGGRPAQAIE---EQFQESELAAAAGGISSSNDDGNQGQMMIVDESESMDQQLIDDPNTHTISIPEGINLKPGESLVLLICENNTEEFIIINTADI 2233
            D  + LISN        +HM ++ P          N   +  T SCRIC K   SN  LA+HLQ++HR+ EMPY C +C F +S+Y+D++ HFKK H ++N L+C YCLRIF  +DA P      ++ +   S V  GVGQT ++LQHL+ H+     + C  C LNF NK+D+++HRRLDHK+        P  + S+ +        I +A +     ++ +   + F  + PQ+  MNAPE    K+L+  +FPE +++L C+ECG+ +   +H +YLPCSVCRFA+CC   F RH  + H                              NV+    +D+S  +     + N                       +++ +    C+ C  +NLDGN+L  HLVEECG    TL PDP LL ++                  +  +    G  D ++    ES  +   +  + +   IM  +      +++   E  ++         I++         + + D    + QQ I         +P+ + L+ G++LV++  EN   +  I+N AD+
Sbjct:  339 DSHDDLISNV-------DHMDILAP----------NLNGVSNTPSCRICGKVAASNLLLAHHLQSTHRQREMPYVCRLCLFRSSMYEDILDHFKKVHDNSNHLLCTYCLRIFTPSDARPNVQSVCLSASGGMSTVGLGVGQTQVYLQHLRMHQIKHQLRRCPTCRLNFTNKSDYQVHRRLDHKATRDVGTEQPGRQDSYESESYHTKKHIGNADQATEHSVDYNQSVDSFCINRPQVTSMNAPEAGCAKNLAIHLFPENIENLDCLECGKCMGDSEHAQYLPCSVCRFATCCRVGFQRHFQKAHLYSNASQSTDLDTGMPMVRQVFFDWCNNEDNVDCQNNIDESESSTFLNSQNNLIMNEFTDLTPINPNYSIVKYMESQIDSRHLCCSHCGASNLDGNSLARHLVEECGTLTATLNPDPLLLYSQTTTEQTQETEKHKQSHLNQNSNNIPFGSTDQKVVMISESSLSPTTVTSVPDSDVIMMNVDNDQLPSVQLDNESIEDQTNILNCSQITTQTSTNGTTTIDVTDAGGEVVQQFI---------LPDDLQLEEGQTLVMIQGENGQPQLAIVNQADL 893          
BLAST of Pogo transposable element with ZNF domain vs. TrEMBL
Match: A0A3P8I2T0 (C2H2-type domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS12946 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 1.139e-61
Identity = 111/250 (44.40%), Postives = 155/250 (62.00%), Query Frame = 2
Query:  902 ISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIP---MNPNEPPSIVTGVGQTSLFLQHLKTHK-DLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNV 1639
            +SCRIC K  +S  ALA+HLQ+SHR+ EMPY C +C F +SL++D++ HFKK H ++N L+C YCLRIF  +DA      +P    ++V GVGQT ++LQHL+ H+     + C  C LNF NK+D+++HRRLDHK+    T   P+ ++     E+  +T     E        + P I  MNAPE   V DL  L FP  +  + C+ECGE +  D H+RYLPCS+CRFA+CC+  ++RHV   H  V
Sbjct:   28 LSCRICGKETNSELALAHHLQSSHRQREMPYVCRLCLFRSSLFEDILDHFKKFHDNSNHLLCTYCLRIFTPSDARSPHYASPTGAATLVPGVGQTQVYLQHLRMHQVRHQLRRCPTCRLNFTNKSDYQVHRRLDHKAVRDGTSDRPE-EAGLDGYEATDQTVRRLKE--------TQPHITLMNAPEAGGVMDLVLLHFPPNIGEMRCLECGEPMDSDAHRRYLPCSLCRFATCCSAGYNRHVTHVHVYV 268          
BLAST of Pogo transposable element with ZNF domain vs. TrEMBL
Match: A0A183B161 (C2H2-type domain-containing protein OS=Echinostoma caproni OX=27848 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 1.174e-61
Identity = 111/250 (44.40%), Postives = 155/250 (62.00%), Query Frame = 2
Query:  902 ISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIP---MNPNEPPSIVTGVGQTSLFLQHLKTHK-DLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNV 1639
            +SCRIC K  +S  ALA+HLQ+SHR+ EMPY C +C F +SL++D++ HFKK H ++N L+C YCLRIF  +DA      +P    ++V GVGQT ++LQHL+ H+     + C  C LNF NK+D+++HRRLDHK+    T   P+ ++     E+  +T     E        + P I  MNAPE   V DL  L FP  +  + C+ECGE +  D H+RYLPCS+CRFA+CC+  ++RHV   H  V
Sbjct:   28 LSCRICGKETNSELALAHHLQSSHRQREMPYVCRLCLFRSSLFEDILDHFKKFHDNSNHLLCTYCLRIFTPSDARSPHYASPTGAATLVPGVGQTQVYLQHLRMHQVRHQLRRCPTCRLNFTNKSDYQVHRRLDHKAVRDGTSDRPE-EAGLDGYEATDQTVRRLKE--------TQPHITLMNAPEAGGVMDLVLLHFPPNIGEMRCLECGEPMDSDAHRRYLPCSLCRFATCCSAGYNRHVTHVHVYV 268          
BLAST of Pogo transposable element with ZNF domain vs. TrEMBL
Match: A0A5K3FF07 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 6.315e-60
Identity = 177/577 (30.68%), Postives = 260/577 (45.06%), Query Frame = 2
Query:  893 ICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDA----IP-MNPNEPPSIVT------GVGQTSLFLQHLKTHK-DLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSS--------------------FLA--IESASETRNEPIEDSPL----------------PNVFSAP--------------QIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEE--VDDS-------RVTLLFGLKTNSNEVRAEDFYCTKCA-ITNLDGNA-------LTSHLVEECGVCMVTLRPDPQLLAAREQAEKEHETMIGIEDTELES---------------DGN---KNMIMELENVTNIM----DVIGGRPAQAIEEQFQESELAAAAGGISSSNDDGN---------------------QGQMMIVDESESMDQQL-IDDPNTHTIS---IPEGINLKPGESLVLLICENNTEEFIIINTADINT 2239
            +   SCRIC K   S+ ALA+HLQ++HR+ EMPY C IC F +SLY+D++ HFKKAH  +N L+C YCLRIF  +DA    IP M+P      V+      GVGQT ++LQHL+ H+     + C  C LNF NK+D+++HRRLDHK+    + S                           F+   IE+A E   +P   SPL                P+   AP               +  +NAPEPSR KDLS    P E   L C+ECGESLS   HK+YLPCS C FA+CCA  F RHV R H       + DS       R      +  ++  V   +   ++ A I  +D +            L  E     VT  PD Q   AR++A++E    +  + + L                 DGN   +++I + E     +    +++  R     + + Q+ + AA   G+   +D G                      + Q+  + E+  +   + I DP    +    IPE ++L+PG++L+L+  E+   +  +IN AD + 
Sbjct:  266 VVGFSCRICGKEAASDLALAHHLQSTHRQREMPYVCRICLFRSSLYEDILDHFKKAHNGSNHLLCTYCLRIFTPSDARVPGIPLMSPGGGGGAVSTAGLGAGVGQTQVYLQHLRMHQVQHQLRRCPTCRLNFTNKSDYQVHRRLDHKACTSSSGSSAAAAEQQMKQQQEETAQEQPSQGVEEFMTNTIETAQEAEKQP---SPLVFQPQAEAKTTDQPQEPDATEAPATTAEDEEEEEEENHVILLNAPEPSRTKDLSETKLPPETAQLSCLECGESLSSVDHKQYLPCSACVFATCCAAGFARHVHRAHIYAPGSVLTDSHTGSPMIRPVAFEWMYNHATSVAPAEAQPSQAACIEPMDQSGPDGEQPVQAEALAVESTAAEVT--PDEQ--PARDEAKQEQTPTVPADTSGLGGVDGLFACPRCALSGVDGNTLARHLIEDCEADCATLQPDPEIVAARRQAEEQMRLQQEQEAAYGAGVVQGDDAGQVVYQLQPGPDEAASDVLHAPEEQQVAALGEAGGLPATIDITDPAGEVVQRLVIPEDLHLEPGQTLILIQGEDGQPQLAVINQADWDA 835          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Cavefish
Match: pogza (pogo transposable element with ZNF domain [Source:NCBI gene;Acc:103028128])

HSP 1 Score: 107.457 bits (267), Expect = 2.636e-23
Identity = 79/323 (24.46%), Postives = 145/323 (44.89%), Query Frame = 2
Query:  866 YIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIK--------RMNAPEPSRVKDLSNLV-----FPEELDSL---MCIECG-ESLSLDQH-KRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVE 1780
            +++T +  + CT  C+ICE + ++      H++  H+  EMPY C +CNF +S Y DV+ HF++ H DTN L C YCL++F  +++                    +  H   H+    +HC  C L+F+   +   H+ L H++ +   +       + + I + S  + +  +DS L    S+P +K           A  P++ K + +++     F  +  S+    C+EC  E      H   ++ CS+C + +CC+ A+  H++ NH         R T    L       +     C+ C+ T   G+++  HL +
Sbjct:  511 HVETVHSQVECTALCKICELSFENEPVFLNHMKQMHKPGEMPYICQVCNFRSSFYSDVVIHFRELHKDTNFLQCSYCLKVFKSSNS--------------------YQLHYSKHQRKTIQHCDKCRLHFLYTKEKSDHKALYHRTHLKPVQLMGLKPGTRVTIRAYSTNKGD--DDSSLKAHNSSPPLKVPPSSSASASVAVPPAKRKPVESMLELMTKFQSQCKSVKKQFCMECNYEIPDFSVHFPTFVCCSLCHYCTCCSRAYANHMISNHI-------PRKTQNKYLNLYKPCPKLGQLSCSLCSYTTKVGDSMAKHLAD 804          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Cavefish
Match: znf280d (zinc finger protein 280C-like [Source:NCBI gene;Acc:103039265])

HSP 1 Score: 101.679 bits (252), Expect = 1.304e-21
Identity = 97/411 (23.60%), Postives = 167/411 (40.63%), Query Frame = 2
Query:  866 YIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRM-NAPEPSRVKDLSNLVFPE-------------ELDSLM-------CIECGESLSLDQHKRY---LPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNA--LTSHLVEECG-VCMVTLRPDP----QLLAAREQAEKEHETMIGIEDTELESDGNKNMIMELENVTNIMDVIGGRPAQAIEEQFQESE 2005
            +I++ +     T +C+ICE   ++   L  H++++H+  EMPY C +CN+ +S + DV  HF+  H +T +L+CP+CL++                         +++QH   H+    + C  C LNF+   +   H+ L H++   K  S             AS T   P+     P+      + R    P P   K  SN    +             EL  L        C EC +S   D +  Y   L CSVC++ + C  +F +H+LR H++      S+  L  G +T    V++    C  C       NA  +  HL+      C + L  D     +++A  +  + E +  +    +     G K ++ E+    +I  +I      + E  FQ +E
Sbjct:  417 HIESAHSPYESTTNCKICELAFETEQVLLEHMKDNHKPGEMPYGCQVCNYRSSFFSDVETHFRTVHENTKDLLCPFCLKVLRSGH--------------------MYMQHYMKHQKKGIQRCGKCRLNFLTYKEKVEHKTLYHRT-FKKPRSLEGLPPGTKVTIRASLTGGSPMSPGSTPSKSFVNLVPRSPERPRPVTHKSSSNAGRVKINQAGKNRNPHNNELKGLRLTPGVHKCTEC-QSEVTDAYVHYPLTLRCSVCKYRTSCQKSFGQHMLRFHSS-----SSKQRLGRGKRTLRG-VKSLTLVCLNCEFLANASNADRMCEHLLYRPNHTCQIILETDEESAVEMMAITDSDQVEAQGPVEEVSSTCSLFGTKGIVSEVSETEDIEPLIAE--VWSEEPSFQAAE 797          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Cavefish
Match: znf280d (zinc finger protein 280C-like [Source:NCBI gene;Acc:103039265])

HSP 1 Score: 99.7525 bits (247), Expect = 4.730e-21
Identity = 71/281 (25.27%), Postives = 120/281 (42.70%), Query Frame = 2
Query:  866 YIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRM-NAPEPSRVKDLSNLVFPE-------------ELDSLM-------CIECGESLSLDQHKRY---LPCSVCRFASCCADAFHRHVLRNHTN 1636
            +I++ +     T +C+ICE   ++   L  H++++H+  EMPY C +CN+ +S + DV  HF+  H +T +L+CP+CL++                         +++QH   H+    + C  C LNF+   +   H+ L H++   K  S             AS T   P+     P+      + R    P P   K  SN    +             EL  L        C EC   ++ D +  Y   L CSVC++ + C  +F +H+LR H++
Sbjct:  377 HIESAHSPYESTTNCKICELAFETEQVLLEHMKDNHKPGEMPYGCQVCNYRSSFFSDVETHFRTVHENTKDLLCPFCLKVLRSGH--------------------MYMQHYMKHQKKGIQRCGKCRLNFLTYKEKVEHKTLYHRT-FKKPRSLEGLPPGTKVTIRASLTGGSPMSPGSTPSKSFVNLVPRSPERPRPVTHKSSSNAGRVKINQAGKNRNPHNNELKGLRLTPGVHKCTECQSEVT-DAYVHYPLTLRCSVCKYRTSCQKSFGQHMLRFHSS 635          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Cavefish
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 98.5969 bits (244), Expect = 1.424e-20
Identity = 84/328 (25.61%), Postives = 141/328 (42.99%), Query Frame = 2
Query:  866 YIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHK-----SQV--------VKTESYPDYKSSF-LAIESASETRNEPI--EDSPLPNV-FSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLM----CIECGESLS--LDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVE 1780
            ++++ +   + +  C+ICE   +S      H++N+H+  EMPY C +C + +SLY DV  HF+  H DT  L+C YCL++F                      +S + QH   H++    HC  C L F+   +   H+   HK     SQ+        V   +Y   K++  L+ +   ET N     + S   N+   +PQ       + S++ D   LV  +E   L     C+EC   +    + +  Y+ CS+C +++CC+ A+  H++  H     +  SR        T    V      C  C  T   G+ +  HLV+
Sbjct:  448 HVESVHNTRVSSSKCKICEWAFESEPVFLQHMKNTHKPGEMPYVCQVCEYRSSLYSDVHDHFRTWHEDTRFLLCIYCLKVFK--------------------HSSTYQQHFSRHQNSSVYHCNKCRLQFLATKEKIEHKVNHHKTFRRPSQLEGLQAGTKVTIRAYAAKKTAGPLSSKIGKETTNTSQFGQASAGNNLKLLSPQNTAAGRKQVSKMYDY--LVKFQEQRVLFGRQKCVECTFDIPDFANHYPTYVHCSLCLYSTCCSRAYANHMINYHVP-GRIHKSR--------TKKVTVSWLKLTCACCNYTTTQGDLMAKHLVQ 744          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Cavefish
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 98.5969 bits (244), Expect = 1.494e-20
Identity = 84/328 (25.61%), Postives = 142/328 (43.29%), Query Frame = 2
Query:  866 YIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHK-----SQV--------VKTESYPDYKSSF-LAIESASETRN--EPIEDSPLPNV-FSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLM----CIECGESLS--LDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVE 1780
            ++++ +   + +  C+ICE   +S      H++N+H+  EMPY C +C + +SLY DV  HF+  H DT  L+C YCL++F                      +S + QH   H++    HC  C L F+   +   H+   HK     SQ+        V   +Y   K++  L+ +   ET N  +  + S   N+   +PQ       + S++ D   LV  +E   L     C+EC   +    + +  Y+ CS+C +++CC+ A+  H++  H     +  SR        T    V      C  C  T   G+ +  HLV+
Sbjct:  469 HVESVHNTRVSSSKCKICEWAFESEPVFLQHMKNTHKPGEMPYVCQVCEYRSSLYSDVHDHFRTWHEDTRFLLCIYCLKVFK--------------------HSSTYQQHFSRHQNSSVYHCNKCRLQFLATKEKIEHKVNHHKTFRRPSQLEGLQAGTKVTIRAYAAKKTAGPLSSKIGKETTNTSQFGQASAGNNLKLLSPQNTAAGRKQVSKMYDY--LVKFQEQRVLFGRQKCVECTFDIPDFANHYPTYVHCSLCLYSTCCSRAYANHMINYHVP-GRIHKSR--------TKKVTVSWLKLTCACCNYTTTQGDLMAKHLVQ 765          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008681.1 (pep scaffold:Pmarinus_7.0:GL478491:5106:8348:-1 gene:ENSPMAG00000007860.1 transcript:ENSPMAT00000008681.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 3.651e-19
Identity = 44/140 (31.43%), Postives = 70/140 (50.00%), Query Frame = 2
Query:  908 CRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYP 1327
            C+ICE   D    L  H++ +H+  EMPY C +CNF +S+Y +V  HF+  H +T  L+CP+CL++                    +   + +LQH   H++     C+ C L F++K D     ++DHK+   KT   P
Sbjct:    9 CKICELNFDHEQMLLQHMKENHKPGEMPYVCQVCNFRSSVYAEVDSHFRAEHENTKSLLCPFCLKV--------------------IKSANGYLQHFMRHQNKGVFRCSKCRLQFLSKKD-----KMDHKTNHHKTHRKP 123          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Medaka
Match: pogza (pogo transposable element derived with ZNF domain [Source:NCBI gene;Acc:101162766])

HSP 1 Score: 120.939 bits (302), Expect = 1.574e-27
Identity = 87/311 (27.97%), Postives = 143/311 (45.98%), Query Frame = 2
Query:  893 ICTIS---CRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTE---SYPDYKSS--FLAIESASETRN---EPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLP----CSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVE 1780
            IC+ S   CRICE   +   A   H++ +H+  EMPY C +C+F +S Y DV  HF+  H +T  L+C +CLR+   N                +     F +H + HK      C  C L+F+   +   H  L HK+ +   +     P  K +    A+    +++N   + I    + NV S P I+   AP+ + V+ L       +  S  CIEC    S+   +R+ P    CS+CRF +CC+ ++  H++ NHT       SR    F +    +   +E+  C  C++++  G+ + +HL E
Sbjct:  454 ICSKSVALCRICELAFEDEPAFMRHMKTTHKPGEMPYICQVCDFRSSFYSDVWSHFQDTHANTKHLLCQFCLRVLRSN----------------ICYQQHFARHQRKHK----LSCDKCRLHFLYVKERVEHNALCHKTHIKPPQLCGLKPGTKVTVRMYAMVGGPKSQNGVLKSITPCKVVNVSSPPPIQ--EAPKKNAVEGLRLSGLKTDRASQSCIEC--LASVPDFQRHFPSVVRCSLCRFVTCCSASYANHMINNHTT------SRRARQFPVIFQPDPRLSEEVICVACSLSSFRGDVIANHLNE 734          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Medaka
Match: znf280d (zinc finger protein 280D [Source:NCBI gene;Acc:101156072])

HSP 1 Score: 94.3597 bits (233), Expect = 2.034e-19
Identity = 87/364 (23.90%), Postives = 153/364 (42.03%), Query Frame = 2
Query:  866 YIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPD------------YKSSFLAIES-----ASETR--------NEPIEDSPLPNVF------SAPQIKRMNA----PEPSRVKDLSNLVFPEELDSL-------MCIECGESLSLDQHKRYLP----CSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVEECG-VCMVTLRPD 1816
            +I++ +  I  + +C+ICE   +S   L  H++ +H+  EMPY C +CN+ +S + D+  HF+  H +T +L+CP+CL++                       + +F+QH   H+      C  C LNF+   +     ++DH++ V KT   P              ++S    ES     AS  R        + P    P  ++       SA Q  +MN      E ++ ++  +     EL  L       +CIEC     +D    + P    C  C++ + C  +   H+++ H+   +    R  L    KTN + ++     C  C +  +D + +T HLV++   VC V    D
Sbjct:  380 HIESAHSPIESSTNCKICELAFESEQVLLEHMKANHKPGEMPYVCQVCNYRSSFFSDLEAHFRSVHENTKDLLCPFCLKVLRT--------------------SHIFMQHYMKHQRKGIYRCGKCRLNFLTYKE-----KVDHRTHVHKTFRKPKALEGLPPGTKVTIRASLTGKESTPVIPASPKRSVTPECRSSSPFTCEPSNSLTKFRLNDSAAQKAKMNQNKKRQEQNKKQERRSFRHNLELKHLSVKTGRYICIECNS--VVDDFFVHFPLLSNCGACKYRTSCKSSIENHMIKYHSTFRK----RRVLKRNQKTNVSSLKL-PLVCLTCDLL-VDSDLMTKHLVKQPNHVCKVIKEKD 710          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Medaka
Match: znf280d (zinc finger protein 280D [Source:NCBI gene;Acc:101156072])

HSP 1 Score: 93.9745 bits (232), Expect = 2.494e-19
Identity = 87/364 (23.90%), Postives = 153/364 (42.03%), Query Frame = 2
Query:  866 YIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPD------------YKSSFLAIES-----ASETR--------NEPIEDSPLPNVF------SAPQIKRMNA----PEPSRVKDLSNLVFPEELDSL-------MCIECGESLSLDQHKRYLP----CSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVEECG-VCMVTLRPD 1816
            +I++ +  I  + +C+ICE   +S   L  H++ +H+  EMPY C +CN+ +S + D+  HF+  H +T +L+CP+CL++                       + +F+QH   H+      C  C LNF+   +     ++DH++ V KT   P              ++S    ES     AS  R        + P    P  ++       SA Q  +MN      E ++ ++  +     EL  L       +CIEC     +D    + P    C  C++ + C  +   H+++ H+   +    R  L    KTN + ++     C  C +  +D + +T HLV++   VC V    D
Sbjct:  377 HIESAHSPIESSTNCKICELAFESEQVLLEHMKANHKPGEMPYVCQVCNYRSSFFSDLEAHFRSVHENTKDLLCPFCLKVLRT--------------------SHIFMQHYMKHQRKGIYRCGKCRLNFLTYKE-----KVDHRTHVHKTFRKPKALEGLPPGTKVTIRASLTGKESTPVIPASPKRSVTPECRSSSPFTCEPSNSLTKFRLNDSAAQKAKMNQNKKRQEQNKKQERRSFRHNLELKHLSVKTGRYICIECNS--VVDDFFVHFPLLSNCGACKYRTSCKSSIENHMIKYHSTFRK----RRVLKRNQKTNVSSLKL-PLVCLTCDLL-VDSDLMTKHLVKQPNHVCKVIKEKD 707          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Medaka
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 87.4261 bits (215), Expect = 3.977e-17
Identity = 75/322 (23.29%), Postives = 132/322 (40.99%), Query Frame = 2
Query:  908 CRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKS-------------QVVKTESYPDYKSSFL---------------AIESASETRNEPIEDSP-LPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLS--LDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVE 1780
            CRICE   ++  A   H+++SH+  EMPY C +C+F +S Y DV+ HF   H ++  L+C +CL++         NP               + QHL  H+     HC  C L F+   D   H+  +H+S               V   +Y   +   +                I   +E +  P+  +P +PN       +R+      R       V        +C+ECG ++      +  ++ C +C ++SCC+ A+  H++++H     +  SR  +L   +     V      C+ C  + L G+ +  HL++
Sbjct:  174 CRICEWAFENEPAFLNHMKSSHKPGEMPYACQVCSFRSSFYSDVLQHFASFHRESCFLLCVFCLKVTR-------NPVS-------------YQQHLLRHQVSQAFHCNRCRLQFVLLKDKMQHKLENHRSFRRPKQLEGLPPGSKVTIRTYGKVRPQVMPTRGRLLQSPASLIQPIRIKTEPQKSPLSKNPSIPNKCPKSPSRRVRRDHSGRTSSADGPV--------VCLECGANVWDFSAHYPTHVHCLLCPYSSCCSRAYASHMIQHH-----LPRSRDKVLPLHRRPPPCVFV--LRCSHCDFSPLTGDQMAEHLLK 460          
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Medaka
Match: ENSORLT00000020334.2 (zinc finger protein 436-like [Source:NCBI gene;Acc:101169324])

HSP 1 Score: 50.447 bits (119), Expect = 4.126e-6
Identity = 62/212 (29.25%), Postives = 91/212 (42.92%), Query Frame = 2
Query:  845 PDGEQ---RVYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICN--FHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDL-----LFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTE--SYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNA 1444
            P+G++   R+ +D +        SC +C KT  S+  LA HL +  +E +  ++CGICN  FH S +  ++ H KK H       CP C + F                    G+ S    HLKTH+ L      FK CT C  +F  K     H RL  + +V K +      +  S L    A E   E  + +P P + S PQ  + +A
Sbjct:   68 PNGQRPHRRIRLDPH--------SCSLCSKTFVSSAHLALHLASHSKERK--FQCGICNKYFHQSSH--LVAH-KKIHSGDRPFKCPDCGKTF--------------------GRAS----HLKTHRRLHTGEKPFK-CTFCGKSFTQKAGLLAHVRLHTEEKVYKCKKCGLAFHSLSLLLSHKAEEASGE-AKAAPAP-LLSQPQEAQSSA 239          
BLAST of Pogo transposable element with ZNF domain vs. Planmine SMEST
Match: SMESG000014324.1 (SMESG000014324.1)

HSP 1 Score: 1037.33 bits (2681), Expect = 0.000e+0
Identity = 499/500 (99.80%), Postives = 500/500 (100.00%), Query Frame = 2
Query:  824 EHMSVIGPDGEQRVYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVEECGVCMVTLRPDPQLLAAREQAEKEHETMIGIEDTELESDGNKNMIMELENVTNIMDVIGGRPAQAIEEQFQESELAAAAGGISSSNDDGNQGQMMIVDESESMDQQLIDDPNTHTISIPEGINLKPGESLVLLICENNTEEFIIINTADINTPEMQEFFTNRRSQNVYVVQSNDEMPESV 2323
            EHMSVIGPDGEQRVYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSI+TGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVEECGVCMVTLRPDPQLLAAREQAEKEHETMIGIEDTELESDGNKNMIMELENVTNIMDVIGGRPAQAIEEQFQESELAAAAGGISSSNDDGNQGQMMIVDESESMDQQLIDDPNTHTISIPEGINLKPGESLVLLICENNTEEFIIINTADINTPEMQEFFTNRRSQNVYVVQSNDEMPESV
Sbjct:  300 EHMSVIGPDGEQRVYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIMTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVEECGVCMVTLRPDPQLLAAREQAEKEHETMIGIEDTELESDGNKNMIMELENVTNIMDVIGGRPAQAIEEQFQESELAAAAGGISSSNDDGNQGQMMIVDESESMDQQLIDDPNTHTISIPEGINLKPGESLVLLICENNTEEFIIINTADINTPEMQEFFTNRRSQNVYVVQSNDEMPESV 799          
BLAST of Pogo transposable element with ZNF domain vs. Planmine SMEST
Match: SMESG000014324.1 (SMESG000014324.1)

HSP 1 Score: 1037.33 bits (2681), Expect = 0.000e+0
Identity = 499/500 (99.80%), Postives = 500/500 (100.00%), Query Frame = 2
Query:  824 EHMSVIGPDGEQRVYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVEECGVCMVTLRPDPQLLAAREQAEKEHETMIGIEDTELESDGNKNMIMELENVTNIMDVIGGRPAQAIEEQFQESELAAAAGGISSSNDDGNQGQMMIVDESESMDQQLIDDPNTHTISIPEGINLKPGESLVLLICENNTEEFIIINTADINTPEMQEFFTNRRSQNVYVVQSNDEMPESV 2323
            EHMSVIGPDGEQRVYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSI+TGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVEECGVCMVTLRPDPQLLAAREQAEKEHETMIGIEDTELESDGNKNMIMELENVTNIMDVIGGRPAQAIEEQFQESELAAAAGGISSSNDDGNQGQMMIVDESESMDQQLIDDPNTHTISIPEGINLKPGESLVLLICENNTEEFIIINTADINTPEMQEFFTNRRSQNVYVVQSNDEMPESV
Sbjct:  282 EHMSVIGPDGEQRVYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIMTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVEECGVCMVTLRPDPQLLAAREQAEKEHETMIGIEDTELESDGNKNMIMELENVTNIMDVIGGRPAQAIEEQFQESELAAAAGGISSSNDDGNQGQMMIVDESESMDQQLIDDPNTHTISIPEGINLKPGESLVLLICENNTEEFIIINTADINTPEMQEFFTNRRSQNVYVVQSNDEMPESV 781          
BLAST of Pogo transposable element with ZNF domain vs. Planmine SMEST
Match: SMESG000017945.1 (SMESG000017945.1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.858e-17
Identity = 83/296 (28.04%), Postives = 127/296 (42.91%), Query Frame = 2
Query:  908 CRICEKTCDSNFALAYHLQNSHRENEMPYRCGICNFH-TSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIPMNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKH--CTGCTLNFINKTDFELHRRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQIKRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLS-LDQH-KRYLPCSVCRFASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTKCAITNLDGNALTSHLVE 1780
            C IC     S   L  HL+  H   +MPY C ICNF+ TS    +  HF   H  T  +ICP+C+  F     +P+  +E   I+      + F+ H++ H  LL K   C  C L FI K     H+ + H+ + +  ++          +   S   N+ I+ S   NV   P              D S L       S+ C EC ES+S L QH + +  C++C F S C ++F +H+ +NH+   E          G   NS ++        +C   ++ G+ + SHL E
Sbjct:  125 CEICCLDFLSAIGLGQHLETKHTYQDMPYVCFICNFYRTSFLSQLKQHFYDHHKSTEFIICPFCILPF----ELPI-LSEKDYILDA----NQFVVHMEKH--LLKKQFSCDKCVLKFITKLSLIYHKTVYHEGRALLNDT--------ADLSDKSGNNNKIIKKS--LNVIDQP-------------IDTSKLSINSYKLSMACAECRESISNLSQHFQSFNLCTLCGFRSYCLNSFRKHI-KNHSGQVE----------GTHFNSIDIYQRGVLICECGFHSMHGDKMASHLCE 375          
The following BLAST results are available for this feature:
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POGZ1.859e-2827.48pogo transposable element derived with ZNF domain ... [more]
POGZ1.982e-2827.48pogo transposable element derived with ZNF domain ... [more]
POGZ2.179e-2827.48pogo transposable element derived with ZNF domain ... [more]
POGZ2.207e-2827.48pogo transposable element derived with ZNF domain ... [more]
POGZ3.337e-2826.84pogo transposable element derived with ZNF domain ... [more]
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
row-14.468e-730.53Relative of Woc homolog [Source:UniProtKB/TrEMBL;... [more]
row-14.468e-730.53Relative of Woc homolog [Source:UniProtKB/TrEMBL;... [more]
row-12.303e-630.00Relative of Woc homolog [Source:UniProtKB/TrEMBL;... [more]
row-12.303e-630.00Relative of Woc homolog [Source:UniProtKB/TrEMBL;... [more]
row-12.422e-630.00Relative of Woc homolog [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
row8.870e-1725.65gene:FBgn0033998 transcript:FBtr0329939[more]
row9.204e-1725.65gene:FBgn0033998 transcript:FBtr0087402[more]
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pogzb1.565e-2323.69pogo transposable element derived with ZNF domain ... [more]
pogzb1.765e-2323.69pogo transposable element derived with ZNF domain ... [more]
znf280d4.148e-2325.00zinc finger protein 280D [Source:ZFIN;Acc:ZDB-GENE... [more]
znf280d4.263e-2325.00zinc finger protein 280D [Source:ZFIN;Acc:ZDB-GENE... [more]
znf280d4.304e-2325.00zinc finger protein 280D [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000010804.11.150e-1424.91zinc finger protein 280D [Source:NCBI gene;Acc:100... [more]
ENSXETT00000010751.12.627e-1430.00zinc finger protein 280D [Source:NCBI gene;Acc:100... [more]
celf32.613e-1022.49CUGBP, Elav-like family member 3 [Source:Xenbase;A... [more]
celf32.225e-923.96CUGBP, Elav-like family member 3 [Source:Xenbase;A... [more]
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pogz1.356e-2727.53pogo transposable element with ZNF domain [Source:... [more]
Pogz1.538e-2727.53pogo transposable element with ZNF domain [Source:... [more]
Pogz1.690e-2727.53pogo transposable element with ZNF domain [Source:... [more]
Pogz2.284e-2727.53pogo transposable element with ZNF domain [Source:... [more]
Zfp280d6.032e-1630.00zinc finger protein 280D [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Pogo transposable element with ZNF domain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7Z3K3|POGZ_HUMAN9.518e-2827.48Pogo transposable element with ZNF domain OS=Homo ... [more]
sp|Q8BZH4|POGZ_MOUSE9.486e-2727.53Pogo transposable element with ZNF domain OS=Mus m... [more]
sp|Q68FE8|Z280D_MOUSE4.468e-1530.00Zinc finger protein 280D OS=Mus musculus OX=10090 ... [more]
sp|Q6N043|Z280D_HUMAN1.221e-1430.30Zinc finger protein 280D OS=Homo sapiens OX=9606 G... [more]
sp|Q6P3Y5|Z280C_MOUSE3.875e-1327.74Zinc finger protein 280C OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Pogo transposable element with ZNF domain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Z3D3W20.000e+099.80Factor for initiating regeneration 1 OS=Schmidtea ... [more]
A0A4Z2DHL61.582e-6328.92Pogo transposable element with ZNF domain OS=Schis... [more]
A0A3P8I2T01.139e-6144.40C2H2-type domain-containing protein OS=Echinostoma... [more]
A0A183B1611.174e-6144.40C2H2-type domain-containing protein OS=Echinostoma... [more]
A0A5K3FF076.315e-6030.68Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pogza2.636e-2324.46pogo transposable element with ZNF domain [Source:... [more]
znf280d1.304e-2123.60zinc finger protein 280C-like [Source:NCBI gene;Ac... [more]
znf280d4.730e-2125.27zinc finger protein 280C-like [Source:NCBI gene;Ac... [more]
pogzb1.424e-2025.61pogo transposable element derived with ZNF domain ... [more]
pogzb1.494e-2025.61pogo transposable element derived with ZNF domain ... [more]
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008681.13.651e-1931.43pep scaffold:Pmarinus_7.0:GL478491:5106:8348:-1 ge... [more]
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with ZNF domain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pogza1.574e-2727.97pogo transposable element derived with ZNF domain ... [more]
znf280d2.034e-1923.90zinc finger protein 280D [Source:NCBI gene;Acc:101... [more]
znf280d2.494e-1923.90zinc finger protein 280D [Source:NCBI gene;Acc:101... [more]
pogzb3.977e-1723.29pogo transposable element derived with ZNF domain ... [more]
ENSORLT00000020334.24.126e-629.25zinc finger protein 436-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Pogo transposable element with ZNF domain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000014324.10.000e+099.80SMESG000014324.1[more]
SMESG000014324.10.000e+099.80SMESG000014324.1[more]
SMESG000017945.14.858e-1728.04SMESG000017945.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031380 ID=SMED30031380|Name=Pogo transposable element with ZNF domain|organism=Schmidtea mediterranea sexual|type=transcript|length=2350bp
TGCCCTATAGACATTTCTGGAGTAAAAAAAATAACATAAAATTTATATTG
CTTACAAATTGTAAGTAGCATTAAGTTATACTTATTTTTTAGCTTCTCTT
GGCATTTAATATTAATTTTTTAAATAAATTATATTCCCTTTTTATAGATA
AAAAAATTTGTTCCAATTAAAAAAAAGATGTATTTTTTCGAATAGAAAGA
CTTAAAAAGTAATTCAATACAGTAAATACAAAATTATGATTTTATGCTGT
CATACATTTGGTATTGTATAGATATTTACTAATTAGAATCAATAATGATG
GATCATCGTACTCACACATCAGCAGAGAGTCATTCATTCAGTTCCCGTTG
TTCCCATATAGACTGTCGTATAATGTTTTATGCGTAACTTAAGGGCAACA
CTATTCCTAGCTAATTTTTTATCATCATGTCAATTGTAGTTATTGAACTA
AATCAATAGCACAATAGCTAATCACCGCTTCACATGATTGATATTTACAC
AATAGATAGTTATTAACAATCCAAATGAGATCATGTGGACATATTCTAAA
TTCTAACCAATCATTATTTGAATCGAGATTCCTTTGTTAGTATTATCGAT
TTTTCGATGAACAACAAAACTAGACAGCTAGTGCTTCAGTTCCGGAAATT
ACTCTACAAATAATTCAATTTAAAATTACTATAAAAACAATGAATAATGA
AATACGAAAAGTACACATTTCGGAACTTCTCACGAGAAATACCACAATTT
AAATCAAAACAACATTTCAAATGATAAAATGAATATTTTAATATCAAATT
TTCAAAATTGATTATTATATCAGGAACACATGTCAGTTATTGGTCCAGAT
GGTGAACAAAGAGTTTACATAGATACTAATAATGGGAATATAATATGCAC
GATTTCTTGTCGAATTTGCGAAAAAACATGCGACAGTAACTTTGCATTAG
CTTATCACTTGCAAAATTCCCACCGAGAAAATGAAATGCCTTATCGATGT
GGCATTTGTAATTTCCATACATCATTATACCAAGACGTTATTGGGCATTT
TAAAAAAGCGCATTGTGACACCAACGAACTAATCTGTCCGTATTGCTTGA
GAATATTTAATATAAACGATGCCATCCCAATGAATCCCAACGAACCTCCA
AGCATCGTGACCGGCGTCGGTCAAACTAGCTTGTTCTTGCAGCACTTAAA
GACCCACAAGGATTTATTATTCAAACATTGCACAGGATGTACATTGAATT
TCATTAATAAAACCGATTTCGAACTTCATCGTCGTCTCGATCATAAAAGT
CAAGTTGTCAAAACGGAATCATATCCTGATTACAAGTCATCATTTTTGGC
AATTGAGTCTGCATCTGAAACTAGAAACGAACCAATTGAAGATAGTCCTC
TGCCGAATGTGTTCAGTGCTCCACAGATTAAACGCATGAACGCTCCAGAA
CCGTCTCGTGTTAAAGATCTGTCAAATTTAGTTTTCCCCGAGGAATTAGA
TTCATTGATGTGTATCGAATGCGGAGAAAGCTTAAGCTTGGATCAGCACA
AACGTTATCTGCCATGTTCTGTCTGTCGATTTGCGAGCTGCTGTGCCGAT
GCATTTCATCGGCATGTGTTACGAAACCACACTAACGTTGAAGAAGTTGA
CGATTCTAGAGTCACTCTACTTTTTGGATTGAAAACTAATTCAAATGAAG
TGAGAGCGGAAGATTTCTATTGTACAAAATGTGCAATTACAAATCTTGAT
GGGAATGCCCTGACAAGTCATCTGGTGGAAGAGTGTGGAGTATGCATGGT
CACACTGAGACCGGATCCCCAGTTATTGGCCGCTCGAGAACAAGCAGAAA
AGGAACACGAAACAATGATTGGCATAGAAGATACAGAGCTGGAAAGTGAC
GGGAACAAAAACATGATAATGGAGCTAGAAAACGTAACGAACATTATGGA
TGTTATTGGAGGAAGGCCAGCCCAAGCTATTGAAGAGCAATTCCAAGAAT
CGGAACTGGCTGCTGCTGCCGGCGGTATCAGCAGCAGCAATGACGATGGG
AATCAAGGCCAAATGATGATTGTTGATGAATCCGAGTCCATGGATCAACA
GTTGATCGACGATCCAAACACTCATACAATTTCCATCCCAGAGGGAATCA
ATTTGAAACCCGGAGAATCTCTGGTTTTATTGATTTGCGAGAACAATACC
GAGGAATTCATCATTATAAATACCGCAGATATCAATACTCCGGAAATGCA
GGAATTTTTCACCAATCGTCGGAGTCAAAATGTTTACGTGGTGCAGAGCA
ATGATGAAATGCCGGAATCAGTTTAGTTATTTGAGTGTGAATAAATGTCT
back to top

protein sequence of SMED30031380-orf-1

>SMED30031380-orf-1 ID=SMED30031380-orf-1|Name=SMED30031380-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=499bp
MSVIGPDGEQRVYIDTNNGNIICTISCRICEKTCDSNFALAYHLQNSHRE
NEMPYRCGICNFHTSLYQDVIGHFKKAHCDTNELICPYCLRIFNINDAIP
MNPNEPPSIVTGVGQTSLFLQHLKTHKDLLFKHCTGCTLNFINKTDFELH
RRLDHKSQVVKTESYPDYKSSFLAIESASETRNEPIEDSPLPNVFSAPQI
KRMNAPEPSRVKDLSNLVFPEELDSLMCIECGESLSLDQHKRYLPCSVCR
FASCCADAFHRHVLRNHTNVEEVDDSRVTLLFGLKTNSNEVRAEDFYCTK
CAITNLDGNALTSHLVEECGVCMVTLRPDPQLLAAREQAEKEHETMIGIE
DTELESDGNKNMIMELENVTNIMDVIGGRPAQAIEEQFQESELAAAAGGI
SSSNDDGNQGQMMIVDESESMDQQLIDDPNTHTISIPEGINLKPGESLVL
LICENNTEEFIIINTADINTPEMQEFFTNRRSQNVYVVQSNDEMPESV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR015880Znf_C2H2-like
IPR007087Znf_C2H2
IPR014760Serum_albumin_N
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 55..78
e-value: 5.0
score: 16.0
coord: 244..267
e-value: 13.0
score: 12.2
coord: 25..48
e-value: 0.11
score: 21.6
coord: 132..155
e-value: 16.0
score: 11.4
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 134..155
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 27..48
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 25..96
e-value: 2.8E-6
score: 29.3
NoneNo IPR availablePANTHERPTHR24403zinc finger proteincoord: 24..316
NoneNo IPR availablePANTHERPTHR24403:SF59POGO TRANSPOSABLE ELEMENT WITH ZNF DOMAINcoord: 24..316