Serine:threonine protein kinase rio2

Overview
NameSerine:threonine protein kinase rio2
Smed IDSMED30031378
Length (bp)1427
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine:threonine protein kinase rio2 (SMED30031378) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine:threonine protein kinase rio2 (SMED30031378) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine:threonine protein kinase rio2 (SMED30031378) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine:threonine protein kinase rio2 (SMED30031378) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Human
Match: RIOK2 (RIO kinase 2 [Source:HGNC Symbol;Acc:HGNC:18999])

HSP 1 Score: 178.333 bits (451), Expect = 6.791e-50
Identity = 102/242 (42.15%), Postives = 149/242 (61.57%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN----GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVE 797
            D++RVLTAVE GM+NHE V  +++   + ++  G    N +   L+ ++LIA+E      GYRLTN GYD+LAL       +V  + N      GKESD+Y+     + +EE +        LK HRLGRTSF+ +KNKR+Y K+ +N SWLY++R+S+ +E+  M+ALYE   PVP  I  NR AV ME +N   L +     +E+ A+  +Y++A  L+VK    GL+HGDFNEFNL+++
Sbjct:   15 DDFRVLTAVEMGMKNHEIVPGSLIASIASLKHGG---CNKVLRELVKHKLIAWERTKTVQGYRLTNAGYDYLALKTLSSRQVVESVGN--QMGVGKESDIYI-----VANEEGQ-----QFALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPIDYNRHAVVMELINGYPLCQIHH--VEDPAS--VYDEAMELIVKLANHGLIHGDFNEFNLILD 237          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Human
Match: RIOK2 (RIO kinase 2 [Source:HGNC Symbol;Acc:HGNC:18999])

HSP 1 Score: 179.104 bits (453), Expect = 1.450e-49
Identity = 102/242 (42.15%), Postives = 149/242 (61.57%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN----GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVE 797
            D++RVLTAVE GM+NHE V  +++   + ++  G    N +   L+ ++LIA+E      GYRLTN GYD+LAL       +V  + N      GKESD+Y+     + +EE +        LK HRLGRTSF+ +KNKR+Y K+ +N SWLY++R+S+ +E+  M+ALYE   PVP  I  NR AV ME +N   L +     +E+ A+  +Y++A  L+VK    GL+HGDFNEFNL+++
Sbjct:   15 DDFRVLTAVEMGMKNHEIVPGSLIASIASLKHGG---CNKVLRELVKHKLIAWERTKTVQGYRLTNAGYDYLALKTLSSRQVVESVGN--QMGVGKESDIYI-----VANEEGQ-----QFALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPIDYNRHAVVMELINGYPLCQIHH--VEDPAS--VYDEAMELIVKLANHGLIHGDFNEFNLILD 237          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Celegans
Match: riok-2 (Serine/threonine-protein kinase RIO2 [Source:UniProtKB/Swiss-Prot;Acc:Q95Q34])

HSP 1 Score: 162.155 bits (409), Expect = 7.618e-44
Identity = 95/241 (39.42%), Postives = 137/241 (56.85%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFEN----NGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLV 794
            D +RVL AVE GM+NHE V + +V   +GI   G   +    N L  + L+AFE     +GYRLT  GYD+LAL       +V  + N      GKESD+YV     +            + LKFHRLGRTSF+++K KR+Y K   + SWLY++R+++ +E+  ++AL E G PVP A+   R  V M+ V    L   +   +E+  A  LY++   L+VK  + G++HGDFNEFNL++
Sbjct:   15 DHFRVLIAVEMGMKNHEVVPLALVSAIAGIHRGG---VARTLNDLCKHSLVAFERSKKFDGYRLTIRGYDYLALRALCSREVVGSVGN--QIGIGKESDVYVGGDPEL----------NDLCLKFHRLGRTSFRKIKEKRDYHKKRKSASWLYLSRLAAAKEFAFLKALQERGFPVPKAVDVCRHLVVMQLVVGQTLCNVTH--VEDAGA--LYDRLMALIVKMARHGVIHGDFNEFNLIM 236          

HSP 2 Score: 48.9062 bits (115), Expect = 6.642e-6
Identity = 26/86 (30.23%), Postives = 50/86 (58.14%), Query Frame = 3
Query:  966 DYNTF--------KLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFTEISESNFPPERLEEIERVEYLDVKLKAPGFPRNLHL 1199
            D+N F        ++ MIDFPQ++S ++  A+  ++RD   + +FF++  +    ++P  + +E+ER   +DV L+A GF + + L
Sbjct:  228 DFNEFNLIMLEDERIVMIDFPQMVSIDHPNAEYYFDRDVTCVRTFFKRKFDYESEDWP--KFDEVERKGNMDVLLEASGFTKKMAL 311          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Fly
Match: RIOK2 (gene:FBgn0039306 transcript:FBtr0084816)

HSP 1 Score: 165.622 bits (418), Expect = 5.068e-45
Identity = 100/246 (40.65%), Postives = 139/246 (56.50%), Query Frame = 3
Query:   72 FSVKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFEN----NGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREYKNG-NNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLV 794
            +  KED +RVLTA+E GM+NHE V   +    + ++  G   ++ L   L  ++L+A+E     +GYRLTN GYD+LAL      G V    N      GKES++YV     +  EE       PI LK HRLGRT F+ VK KR+Y    +  SWLY++RIS+TRE+  M ALY+ G PVP  I  NR  V M+ V    + +  +L+     A  +Y+    L+V+    G++HGDFNEFNL+V
Sbjct:   11 YLTKED-FRVLTAIEMGMKNHELVPGPLAAAIANLKSGG---VHKLLKELCKHKLLAYERGKKYDGYRLTNTGYDYLALKSLTLRGSVSSFGN--QIGIGKESNIYV-----VADEE-----GTPICLKLHRLGRTCFRNVKAKRDYHGRRHKASWLYLSRISATREFAYMSALYDRGFPVPKPIDFNRHCVLMDLVKGWPMTQVHELL----DAPQVYDDLMNLIVRLGNSGVIHGDFNEFNLMV 236          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Zebrafish
Match: riok2 (RIO kinase 2 (yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2913])

HSP 1 Score: 177.563 bits (449), Expect = 1.695e-49
Identity = 97/242 (40.08%), Postives = 147/242 (60.74%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN----GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVE 797
            D++RVLTAVE GM+NHE V V+++   + ++  G    N +   L+ ++L+A+E +    GYRL   GYD+LAL       ++  + N      GKESD+Y+  +            +    LK HRLGRTSF+ +KNKR+Y K+ NN SWLY++R+S+ +E+  M+ALY+ G PVP  +  NR AV ME +N   L +  +  +++ AA  LY++   L+VK    GL+HGDFNEFNL+++
Sbjct:   15 DDFRVLTAVEMGMKNHEIVPVSLIASIASLKHGG---CNKVLRELVKHKLLAYERSKTVQGYRLNYGGYDYLALKTLSSRDVILSVGN--QMGVGKESDIYIVANA----------EEQQFALKLHRLGRTSFRNLKNKRDYHKHRNNMSWLYLSRLSAMKEFAYMKALYDRGFPVPKPVDYNRHAVVMELINGYPLCQVRE--IQDPAA--LYSEIMELIVKLANHGLIHGDFNEFNLMLD 237          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Zebrafish
Match: riok2 (RIO kinase 2 (yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2913])

HSP 1 Score: 177.563 bits (449), Expect = 1.730e-49
Identity = 97/242 (40.08%), Postives = 147/242 (60.74%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN----GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVE 797
            D++RVLTAVE GM+NHE V V+++   + ++  G    N +   L+ ++L+A+E +    GYRL   GYD+LAL       ++  + N      GKESD+Y+  +            +    LK HRLGRTSF+ +KNKR+Y K+ NN SWLY++R+S+ +E+  M+ALY+ G PVP  +  NR AV ME +N   L +  +  +++ AA  LY++   L+VK    GL+HGDFNEFNL+++
Sbjct:   15 DDFRVLTAVEMGMKNHEIVPVSLIASIASLKHGG---CNKVLRELVKHKLLAYERSKTVQGYRLNYGGYDYLALKTLSSRDVILSVGN--QMGVGKESDIYIVANA----------EEQQFALKLHRLGRTSFRNLKNKRDYHKHRNNMSWLYLSRLSAMKEFAYMKALYDRGFPVPKPVDYNRHAVVMELINGYPLCQVRE--IQDPAA--LYSEIMELIVKLANHGLIHGDFNEFNLMLD 237          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Xenopus
Match: riok2 (RIO kinase 2 [Source:NCBI gene;Acc:549436])

HSP 1 Score: 166.777 bits (421), Expect = 3.295e-45
Identity = 94/242 (38.84%), Postives = 144/242 (59.50%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN----GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVE 797
            +++RVLTAVE GM+NHE V  +++   + ++  G    N +   L+ ++LIA+E      GYRL   GYD+LAL       +V  + N      GKESD+Y+  +          + +  + LK HRLGRTSF+ +KNKR+Y K+ +  SWLY++R+++ +E+  M+ALY+ G PVP     NR AV ME +N   L +     +E+ A+  LY++   L+VK    GL+HGDFNEFNL+++
Sbjct:   15 EDFRVLTAVEMGMKNHEIVPASLIASIASLKHGG---CNKILRELVKHKLIAYERTKTVQGYRLIYGGYDYLALKTLSSREVVTSVGN--QMGVGKESDIYIVAN----------EDENQLALKLHRLGRTSFRNLKNKRDYHKHRHKMSWLYLSRLAAMKEFAYMKALYDRGFPVPKPHDYNRHAVVMELINGYPLCQVRH--IEDPAS--LYSELMDLIVKLANHGLIHGDFNEFNLMLD 237          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Xenopus
Match: riok2 (RIO kinase 2 [Source:NCBI gene;Acc:549436])

HSP 1 Score: 166.777 bits (421), Expect = 4.979e-45
Identity = 94/242 (38.84%), Postives = 144/242 (59.50%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN----GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVE 797
            +++RVLTAVE GM+NHE V  +++   + ++  G    N +   L+ ++LIA+E      GYRL   GYD+LAL       +V  + N      GKESD+Y+  +          + +  + LK HRLGRTSF+ +KNKR+Y K+ +  SWLY++R+++ +E+  M+ALY+ G PVP     NR AV ME +N   L +     +E+ A+  LY++   L+VK    GL+HGDFNEFNL+++
Sbjct:   15 EDFRVLTAVEMGMKNHEIVPASLIASIASLKHGG---CNKILRELVKHKLIAYERTKTVQGYRLIYGGYDYLALKTLSSREVVTSVGN--QMGVGKESDIYIVAN----------EDENQLALKLHRLGRTSFRNLKNKRDYHKHRHKMSWLYLSRLAAMKEFAYMKALYDRGFPVPKPHDYNRHAVVMELINGYPLCQVRH--IEDPAS--LYSELMDLIVKLANHGLIHGDFNEFNLMLD 237          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Mouse
Match: Riok2 (RIO kinase 2 [Source:MGI Symbol;Acc:MGI:1914295])

HSP 1 Score: 178.718 bits (452), Expect = 4.699e-50
Identity = 100/242 (41.32%), Postives = 148/242 (61.16%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN----GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVE 797
            D++RVLTAVE GM+NHE V  +++   + ++  G    N +   L+ ++LIA+E      GYRLTN GYD+LAL       +V  + N      GKESD+Y+  +          ++   + LK HRLGRTSF+ +KNKR+Y K+ +N SWLY++R+S+ +E+  M+ALYE   PVP  I  NR AV ME +N   L +     +E+ A+  +Y++A  L+VK    GL+HGDFNEFNL+++
Sbjct:   15 DDFRVLTAVEMGMKNHEIVPCSLIASIASLKHGG---CNKILRELVKHKLIAWERTKTVQGYRLTNAGYDYLALKTLSSRQVVESVGN--QMGVGKESDIYIVAN----------EAGQQLALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPIDYNRHAVIMELINGYPLCQIHH--VEDPAS--VYDEAMELIVKLGNHGLIHGDFNEFNLMLD 237          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Mouse
Match: Riok2 (RIO kinase 2 [Source:MGI Symbol;Acc:MGI:1914295])

HSP 1 Score: 179.874 bits (455), Expect = 4.820e-50
Identity = 100/242 (41.32%), Postives = 148/242 (61.16%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN----GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVE 797
            D++RVLTAVE GM+NHE V  +++   + ++  G    N +   L+ ++LIA+E      GYRLTN GYD+LAL       +V  + N      GKESD+Y+  +          ++   + LK HRLGRTSF+ +KNKR+Y K+ +N SWLY++R+S+ +E+  M+ALYE   PVP  I  NR AV ME +N   L +     +E+ A+  +Y++A  L+VK    GL+HGDFNEFNL+++
Sbjct:   15 DDFRVLTAVEMGMKNHEIVPCSLIASIASLKHGG---CNKILRELVKHKLIAWERTKTVQGYRLTNAGYDYLALKTLSSRQVVESVGN--QMGVGKESDIYIVAN----------EAGQQLALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPIDYNRHAVIMELINGYPLCQIHH--VEDPAS--VYDEAMELIVKLGNHGLIHGDFNEFNLMLD 237          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Mouse
Match: Riok2 (RIO kinase 2 [Source:MGI Symbol;Acc:MGI:1914295])

HSP 1 Score: 65.4698 bits (158), Expect = 1.471e-12
Identity = 36/82 (43.90%), Postives = 52/82 (63.41%), Query Frame = 3
Query:  552 REYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVE 797
            +E+  M+ALYE   PVP  I  NR AV ME +N   L +   +  E+ A+  +Y++A  L+VK    GL+HGDFNEFNL+++
Sbjct:    2 KEFAYMKALYERKFPVPKPIDYNRHAVIMELINGYPLCQIHHV--EDPAS--VYDEAMELIVKLGNHGLIHGDFNEFNLMLD 79          
BLAST of Serine:threonine protein kinase rio2 vs. UniProt/SwissProt
Match: sp|Q9CQS5|RIOK2_MOUSE (Serine/threonine-protein kinase RIO2 OS=Mus musculus OX=10090 GN=Riok2 PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 3.372e-49
Identity = 100/242 (41.32%), Postives = 148/242 (61.16%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN----GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVE 797
            D++RVLTAVE GM+NHE V  +++   + ++  G    N +   L+ ++LIA+E      GYRLTN GYD+LAL       +V  + N      GKESD+Y+  +          ++   + LK HRLGRTSF+ +KNKR+Y K+ +N SWLY++R+S+ +E+  M+ALYE   PVP  I  NR AV ME +N   L +     +E+ A+  +Y++A  L+VK    GL+HGDFNEFNL+++
Sbjct:   15 DDFRVLTAVEMGMKNHEIVPCSLIASIASLKHGG---CNKILRELVKHKLIAWERTKTVQGYRLTNAGYDYLALKTLSSRQVVESVGN--QMGVGKESDIYIVAN----------EAGQQLALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPIDYNRHAVIMELINGYPLCQIHH--VEDPAS--VYDEAMELIVKLGNHGLIHGDFNEFNLMLD 237          
BLAST of Serine:threonine protein kinase rio2 vs. UniProt/SwissProt
Match: sp|Q9BVS4|RIOK2_HUMAN (Serine/threonine-protein kinase RIO2 OS=Homo sapiens OX=9606 GN=RIOK2 PE=1 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 6.965e-49
Identity = 102/242 (42.15%), Postives = 149/242 (61.57%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN----GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVE 797
            D++RVLTAVE GM+NHE V  +++   + ++  G    N +   L+ ++LIA+E      GYRLTN GYD+LAL       +V  + N      GKESD+Y+     + +EE +        LK HRLGRTSF+ +KNKR+Y K+ +N SWLY++R+S+ +E+  M+ALYE   PVP  I  NR AV ME +N   L +     +E+ A+  +Y++A  L+VK    GL+HGDFNEFNL+++
Sbjct:   15 DDFRVLTAVEMGMKNHEIVPGSLIASIASLKHGG---CNKVLRELVKHKLIAWERTKTVQGYRLTNAGYDYLALKTLSSRQVVESVGN--QMGVGKESDIYI-----VANEEGQ-----QFALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRLSAMKEFAYMKALYERKFPVPKPIDYNRHAVVMELINGYPLCQIHH--VEDPAS--VYDEAMELIVKLANHGLIHGDFNEFNLILD 237          
BLAST of Serine:threonine protein kinase rio2 vs. UniProt/SwissProt
Match: sp|Q95Q34|RIOK2_CAEEL (Serine/threonine-protein kinase RIO2 OS=Caenorhabditis elegans OX=6239 GN=riok-2 PE=2 SV=2)

HSP 1 Score: 162.155 bits (409), Expect = 7.765e-43
Identity = 95/241 (39.42%), Postives = 137/241 (56.85%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFEN----NGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLV 794
            D +RVL AVE GM+NHE V + +V   +GI   G   +    N L  + L+AFE     +GYRLT  GYD+LAL       +V  + N      GKESD+YV     +            + LKFHRLGRTSF+++K KR+Y K   + SWLY++R+++ +E+  ++AL E G PVP A+   R  V M+ V    L   +   +E+  A  LY++   L+VK  + G++HGDFNEFNL++
Sbjct:   15 DHFRVLIAVEMGMKNHEVVPLALVSAIAGIHRGG---VARTLNDLCKHSLVAFERSKKFDGYRLTIRGYDYLALRALCSREVVGSVGN--QIGIGKESDVYVGGDPEL----------NDLCLKFHRLGRTSFRKIKEKRDYHKKRKSASWLYLSRLAAAKEFAFLKALQERGFPVPKAVDVCRHLVVMQLVVGQTLCNVTH--VEDAGA--LYDRLMALIVKMARHGVIHGDFNEFNLIM 236          
BLAST of Serine:threonine protein kinase rio2 vs. UniProt/SwissProt
Match: sp|Q9P7W5|RIO2_SCHPO (Serine/threonine-protein kinase rio2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rio2 PE=3 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 1.527e-42
Identity = 98/248 (39.52%), Postives = 140/248 (56.45%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSG--KSFINLLRNSLI---PYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLV-EVGTA 809
            +++R LTAVE G RNHE V  NM+ + + I+     KS   L  + LI   P+  I++E  GYRLT  GYD+LAL    K   VY + N      GKESD+YV             +     +LK HRLGR SF+ VKN R+Y +N    SW Y++R+++T+E+  M+ L+E G PVP  I  +R  + ME +++  L    + V +      LY     ++V+F + GL+HGDFNEFN++V E GTA
Sbjct:   15 EDFRTLTAVEMGSRNHEVVPTNMINQIAKIRGGSCTKSLSVLFMHKLIAKVPH--ISYE--GYRLTYAGYDYLALKALSKRASVYSVGN--QIGVGKESDVYVVGD----------QKGKQYILKIHRLGRISFRSVKNNRDYLRNRKTGSWQYLSRLAATKEFAFMKILHEHGFPVPAPIDHSRHCIIMEMIDAFPL----RAVTDIRDPPALYQTLMDIIVRFARNGLIHGDFNEFNIIVREDGTA 242          
BLAST of Serine:threonine protein kinase rio2 vs. UniProt/SwissProt
Match: sp|Q54T05|RIO2_DICDI (Serine/threonine-protein kinase rio2 OS=Dictyostelium discoideum OX=44689 GN=rio2 PE=3 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 3.716e-42
Identity = 90/242 (37.19%), Postives = 137/242 (56.61%), Query Frame = 3
Query:   78 VKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSG--KSFINLLRNSLIPYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLV 794
            + +D++R L AVE GM+NHE V V+++   + +++ G  KS   L +  L+ +    ++  GY+LT LGYDFLAL   +  G+   + N      GKESD+Y+  +            +  +VLK HRLGR SFK +KN R+Y K+  + SWLY++R+++ +E+  M+ALYE G PVP  I  NR  + M       L +  +L         +Y+    L+VK    GL+HGDFNEFN+L+
Sbjct:   11 LSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQTLHKFKLLFHDGRNYD--GYKLTYLGYDFLALKTLVSRGVCSYVGN--QIGVGKESDIYIVAND----------DNQEMVLKLHRLGRVSFKTIKNNRDYLKHRKSASWLYLSRLAALKEFAYMKALYENGFPVPTPIDYNRHCIVMSRARGYPLTQIVQL----RHPSKVYSDLMNLIVKLASYGLIHGDFNEFNILI 234          
BLAST of Serine:threonine protein kinase rio2 vs. TrEMBL
Match: A0A0R3SR76 (RIO domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7643 PE=4 SV=2)

HSP 1 Score: 306.605 bits (784), Expect = 4.784e-95
Identity = 175/412 (42.48%), Postives = 234/412 (56.80%), Query Frame = 3
Query:   42 MPKVIQTRNFFSVKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN------GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPIC-------HEEFEIKSDYP--------IVLKFHRLGRTSFKQVKNKREYKNG-NNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYV-NSVALVKF--SKLVLENGA-AELLYNQAKCLLVKFVQLGLVHGDFNEFNLLV-----EVGTADDINDWFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFTEISESNFPPERLEEIERVEYLDVKLKAPGFP 1184
            MPK I+   F  +  + WRVL AVE GM+NHE+V +++V K S     G SF+ LLR+ L+P+ L+A+E +      GYRLTNLGYD+LALH  IK G + DL +  +   GKESD+Y+  +G  C        +E E    Y         IV+KFHRLGRTSF++V+ KREY  G N CSWLY++R+++ REY+ M+ LY+ G+PVP  +  NR AV M  V ++V L K   + L  EN A A  LY+QA+ +L K    GLVHGDFNEFNLLV     E G  +D+ +  K +                                               KL +IDFPQ+ISR++ TAQEIYERD  GI+SFF KF +I+    P   L+EI R  Y+D++LKAPG+P
Sbjct:    1 MPKSIKIDQFRYMSNEAWRVLMAVEMGMKNHEFVPLDLVHKISKCTRRGSSFLKLLRDDLVPHGLLAYETDNKKGYSGYRLTNLGYDYLALHTLIKGGQICDLGS--IIGVGKESDVYLAVAGETCGHHDEQSSKELENTGKYTVPPANGEYIVIKFHRLGRTSFRKVREKREYHQGRNTCSWLYLDRLAAKREYEMMKILYDDGLPVPSPLANNRNAVVMSLVPDAVPLCKVFPATLRAENAALASSLYSQAREILAKITAEGLVHGDFNEFNLLVSGLVDEPGKENDVAEIVKRA-----------------------------------------------KLVLIDFPQMISRDHWTAQEIYERDLDGIVSFFGKFLDIAPDEMPLRNLKEIPRTGYMDIELKAPGYP 363          
BLAST of Serine:threonine protein kinase rio2 vs. TrEMBL
Match: A0A0R3TUY3 (RIO domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11586 PE=4 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 5.134e-95
Identity = 175/406 (43.10%), Postives = 237/406 (58.37%), Query Frame = 3
Query:   42 MPKVIQTRNFFSVKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN------GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPIC--HEEFE--------IKSDYP-----IVLKFHRLGRTSFKQVKNKREYKNG-NNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYV-NSVALVKF--SKLVLENGA-AELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFTEISESNFPPERLEEIERVEYLDVKLKAPGF 1181
            MPK I+   F  +  + WRVL AVE GM+NHE+V +++V K S     G SF+ LLR+ L+P+ L+A+E +      GYRLTNLGYD+LALH  IKSG + DL +  +   GKESD+Y+  +G  C  H+E +          SD P     IV+KFHRLGRTSF++V+ KREY  G N CSWLY++R+++ REY+ M+ LY+ G+PVP  +  NR AV M  + ++V L K   + L  EN + A  LY+QAK +L K    GLVHGDFNEFNLLV  G  D++ +   ++ I +                                           KL +IDFPQ+ISR++ +AQEIYERD  GI+SFF KF +I+    PP  L EI R   +D+KLKAPG+
Sbjct:    1 MPKSIKIDQFRYMSTEAWRVLMAVEMGMKNHEFVPLDLVHKISKCTRRGSSFLKLLRDDLVPHGLLAYETDNKKGYSGYRLTNLGYDYLALHTLIKSGQICDLGS--IIGVGKESDVYLAVAGENCGRHDEQQNNELEDEKKHSDLPANGEYIVIKFHRLGRTSFRKVREKREYHQGRNTCSWLYLDRLAAKREYEMMQILYDDGLPVPCPLANNRNAVVMSLISDAVPLCKVLPATLRAENASLASSLYSQAKEILAKITAEGLVHGDFNEFNLLVS-GLVDELGEETDAAAIAKRA-----------------------------------------KLVLIDFPQMISRDHWSAQEIYERDLDGILSFFGKFLDIAPDEMPPRNLNEIPRTGNMDIKLKAPGY 362          
BLAST of Serine:threonine protein kinase rio2 vs. TrEMBL
Match: A0A5K3F4V2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 3.138e-93
Identity = 172/406 (42.36%), Postives = 232/406 (57.14%), Query Frame = 3
Query:   42 MPKVIQTRNFFSVKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN------GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFE-------------IKSDYPIVLKFHRLGRTSFKQVKNKREYKNG-NNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYV-NSVALVKF--SKLVLENGA-AELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFTEISESNFPPERLEEIERVEYLDVKLKAPGFPR 1187
            MPK I+   F  +  + WR+L AVE GM+NHE+V  ++V K S     G SF  LLR+ L+P+ L+A+E +      GYRLTNLGYD+LALH  IKSG V DL +  +   GKESD+Y+  +G  C  + E              K DY IV+KFHRLGRTSF++V+ KREY  G N CSWLY++R+++ RE++ M+ LY+ G+PVP  +  NR AV M  V ++V L K   + L   NGA A +LY QA  +L K    GL+HGDFNEFNLL+         D   + +  +  N                                 D D +  +L +IDFPQ+ISR+++ AQEIYERD  GI+ FF KF E+  +N PP+ L +I R   +DV LKAPG+ R
Sbjct:    1 MPKSIKIDQFRYMTSESWRILMAVEMGMKNHEFVPSDLVHKISRCARRGSSFAKLLRDDLVPHGLLAYETDNRKGYSGYRLTNLGYDYLALHALIKSGQVIDLGS--MIGVGKESDVYLAVAGDSCGRQCEELDGEEKNRADLPSKGDY-IVIKFHRLGRTSFRKVREKREYHQGRNTCSWLYLDRLAAKREFEMMQILYDYGLPVPCPLANNRNAVVMSLVSDAVPLCKVLPTTLRANNGALANILYAQAVEILEKITSNGLIHGDFNEFNLLIGGLAGGASKDSTAAPDDGDTTN---------------------------------DVDLDKVQLILIDFPQMISRDHRNAQEIYERDLNGIVGFFDKFLELDPTNIPPKSLLDIPRTGSMDVDLKAPGYIR 370          
BLAST of Serine:threonine protein kinase rio2 vs. TrEMBL
Match: A0A0R3UK87 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7979 PE=4 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 4.336e-92
Identity = 172/413 (41.65%), Postives = 232/413 (56.17%), Query Frame = 3
Query:   42 MPKVIQTRNFFSVKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN-------------GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFE-------------IKSDYPIVLKFHRLGRTSFKQVKNKREYKNG-NNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYV-NSVALVKF--SKLVLENGA-AELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFTEISESNFPPERLEEIERVEYLDVKLKAPGFPR 1187
            MPK I+   F  +  + WR+L AVE GM+NHE+V  ++V K S     G SF  LLR+ L+P+ L+A+E +             GYRLTNLGYD+LALH  IKSG V DL +  +   GKESD+Y+  +G  C  + E              K DY IV+KFHRLGRTSF++V+ KREY  G N CSWLY++R+++ RE++ M+ LY+ G+PVP  +  NR AV M  V ++V L K   + L   NGA A +LY QA  +L K    GL+HGDFNEFNLL+         D   + +  +  N                                 D D +  +L +IDFPQ+ISR+++ AQEIYERD  GI+ FF KF E+  +N PP+ L +I R   +DV LKAPG+ R
Sbjct:    1 MPKSIKIDQFRYMTSESWRILMAVEMGMKNHEFVPSDLVHKISRCARRGSSFAKLLRDDLVPHGLLAYETDNRKGNRHLFDGYSGYRLTNLGYDYLALHALIKSGQVIDLGS--MIGVGKESDVYLAVAGDSCGRQCEELDGEEKNRADLPSKGDY-IVIKFHRLGRTSFRKVREKREYHQGRNTCSWLYLDRLAAKREFEMMQILYDYGLPVPCPLANNRNAVVMSLVSDAVPLCKVLPTTLRANNGALANILYAQAVEILEKITSNGLIHGDFNEFNLLIGGLAGGASKDSTAAPDDGDTTN---------------------------------DVDLDKVQLILIDFPQMISRDHRNAQEIYERDLNGIVGFFDKFLELDPTNIPPKSLLDIPRTGSMDVDLKAPGYIR 377          
BLAST of Serine:threonine protein kinase rio2 vs. TrEMBL
Match: A0A0R3X595 (RIO domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8605 PE=4 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 4.648e-90
Identity = 167/403 (41.44%), Postives = 225/403 (55.83%), Query Frame = 3
Query:   42 MPKVIQTRNFFSVKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFE------------IKSDYP-----IVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYV-NSVALVKFSKLVLENGAAEL---LYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFTEISESNFPPERLEEIERVEYLDVKLKAPGFP 1184
            MPK I+   F  +  + WRVL AVE GM+NHE+V +++V K S       +F+ LLR+ L+P+       +GYRLTNLGYD+LAL+   KSG V DL +  +  +GKESD+Y+  +G +C  + +            ++ D P     IV+KFHRLGRTSF++V+ KREY ++ N CSWLY++R+++ REY+ MR LY  G+PVP  +  NR AV M  + + V L K    +L    A L   LY QA  +L    + GLVHGDFNEFNLLV     D  +D            E                                       KL +IDFPQ+ISRN+ TAQEIYERD  GIISFF +F EIS ++ PP  L +I R  ++DV+LKAPG+P
Sbjct:    1 MPKSIKIDQFRYMTNESWRVLMAVEMGMKNHEFVPIDLVHKISRCSRRSSAFLKLLRDDLVPHGY-----SGYRLTNLGYDYLALNTLTKSGQVIDLGS--MIGSGKESDVYLALAGDLCGRQGDATEEKYAAVDQNLRPDLPSKGDYIVIKFHRLGRTSFRKVREKREYHQHRNTCSWLYLDRLAAKREYEMMRMLYHHGLPVPCPLANNRNAVVMSLLMDMVPLCKVLPTILRADDAVLASTLYAQAVDILDNITRNGLVHGDFNEFNLLVHGLVQDGGDDGADVKTATTVATEP--------------------------------------KLFLIDFPQMISRNHPTAQEIYERDLNGIISFFSRFLEISPADTPPRSLTDIPRTGHMDVELKAPGYP 358          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Cavefish
Match: riok2 (RIO kinase 2 [Source:NCBI gene;Acc:103037025])

HSP 1 Score: 170.629 bits (431), Expect = 6.358e-47
Identity = 94/242 (38.84%), Postives = 148/242 (61.16%), Query Frame = 3
Query:   87 DEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN----GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVE 797
            +++RVLTAVE GM+NHE V ++++   + ++  G    N +   L+ ++L+A+E +    GYRL   GYD+LAL       ++  + N      GKESD+Y+  +     E+F         LK HRLGRTSF+ ++NKR+Y K+ +  SWLY++R+S+ +EY  M+ALY+ G PVP  +  NR A+ ME +N   L +  +  +E+ A+  LY++   L+VK    GL+HGDFNEFNL+++
Sbjct:   15 EDFRVLTAVEMGMKNHEIVPMSLISSIASLRHGG---CNKVLRELVKHKLLAYERSKTVQGYRLNYGGYDYLALKTLSSRDVILSVGN--QMGVGKESDIYIVANAE--GEQF--------ALKLHRLGRTSFRNLRNKRDYHKHRHKMSWLYLSRLSAMKEYAYMKALYDRGFPVPKPVDYNRHAIVMELINGYPLCQVRE--IEDPAS--LYSEIMELIVKLANHGLIHGDFNEFNLMLD 237          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Yeast
Match: RIO2 (Essential serine kinase involved in the processing of 20S pre-rRNA; involved in the processing of the 20S pre-rRNA into mature 18S rRNA; has similarity to Rio1p [Source:SGD;Acc:S000005151])

HSP 1 Score: 146.747 bits (369), Expect = 1.035e-39
Identity = 113/411 (27.49%), Postives = 184/411 (44.77%), Query Frame = 3
Query:   54 IQTRNFFSVKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQF---SGKSFINLLRNSLIPYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY--KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQK---------FTEISESNFP-------PERLEEIERVEYLDVKLKAPGF----PRNLHLKTIV 1211
            + T +   +  D++RVL AVE G R+HE V   ++ + SG++    + ++  +L + SLI  ++   + +GYRLT  G D+LAL   +    VY + N      GKESD+Y              K+  P V+K HRLGRTSF  V+N R+Y  K+    +W++++R+++ +EYQ M  LY  G  VP     +R  V ME +    + +  K    +     LY+   C +V     GL+H DFNEFN++++    D+                                          N+C ++          +IDFPQ IS  ++ A   ++RD   I  FF+K          + +    F        P+   +++R + LD  ++A GF    P +  L+T V
Sbjct:    3 LDTSHMRYLTTDDFRVLQAVEQGSRSHEVVPTPLIHQISGMRSQSGTNRAISDLAKLSLIS-KMRNVKYDGYRLTYNGIDYLALKTMLNRDTVYSVGN--TIGVGKESDIYKVSD----------KNGNPRVMKIHRLGRTSFHSVRNNRDYLKKSNQGANWMHLSRLAANKEYQFMSMLYSKGFKVPEPFDNSRHIVVMELIEGYPMRRLRK----HKNIPKLYSDLMCFIVDLANSGLIHCDFNEFNIMIKDKLEDE------------------------------------------NDCGFV----------VIDFPQCISIQHQDADYYFQRDVDCIRRFFKKKLKYEPKPDSSMLDTEGFGDGYKYAYPDFKRDVKRTDNLDELVQASGFSKKHPGDRGLETAV 344          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Nematostella
Match: EDO34624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNU4])

HSP 1 Score: 171.785 bits (434), Expect = 2.620e-48
Identity = 100/243 (41.15%), Postives = 145/243 (59.67%), Query Frame = 3
Query:   78 VKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN---GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLV 794
            +  +++RVLTAVE GM+NHE V   +V   + ++  G    + L   L+ ++LIA+++    GYRLT  GYD+LAL       IVY + N      GKESD+Y+     + +EE     D    LK HRLGRTSF+++K KR+Y K  ++ SWLY++R+++ +E+  M+ALY+ G PVP  I  NR AV ME VN   L +   L  + GA   +Y+    L+VK    GL+H DFNEFNL++
Sbjct:   12 LSREDYRVLTAVEMGMKNHEIVPTPLVASIAALKHGG---CHKLIKELVKHKLIAYDHGKVEGYRLTYTGYDYLALKALASRDIVYSVGN--QIGVGKESDIYI-----VANEE-----DQQFALKLHRLGRTSFRKLKEKRDYLKKRSSASWLYLSRLAAMKEFAYMKALYDNGYPVPKPIDFNRHAVVMELVNGHPLCQVHNLN-DPGA---VYSDLMELIVKLASFGLIHCDFNEFNLML 235          
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Medaka
Match: ENSORLT00000010866.2 (RIO kinase 2 [Source:NCBI gene;Acc:101175658])

HSP 1 Score: 170.629 bits (431), Expect = 6.131e-47
Identity = 96/245 (39.18%), Postives = 147/245 (60.00%), Query Frame = 3
Query:   78 VKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENN----GYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREY-KNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVE 797
            +  D++RVLTA+E GM+NHE V V+++   + ++  G    N +   L+ ++L+ +E +    GYRL   GYD+LAL       ++  + N      GKESD+Y+  + P   +           LK HRLGRTSF+ +KNKR+Y K+  N SWLY++R+S+ +E+  M+ALY+ G PVP  +  NR AV ME +N   L +  +  L++ +A  LY++   L+VK    GL+HGDFNEFNL+V+
Sbjct:   12 LSRDDFRVLTAIEMGMKNHEIVPVSLLASIASLKHGG---CNKILRELVKHKLVVYERSKTVQGYRLNYGGYDYLALKTLCSREVILSVGN--QMGVGKESDIYIV-ANPNGDQ---------YALKLHRLGRTSFRNLKNKRDYHKHRKNMSWLYLSRLSAMKEFAYMKALYDRGFPVPKPVDYNRHAVVMELINGFPLCQVRE--LQDPSA--LYSELMELIVKLANHGLIHGDFNEFNLMVD 237          
BLAST of Serine:threonine protein kinase rio2 vs. Planmine SMEST
Match: SMESG000041471.1 (SMESG000041471.1)

HSP 1 Score: 760.37 bits (1962), Expect = 0.000e+0
Identity = 427/427 (100.00%), Postives = 427/427 (100.00%), Query Frame = 3
Query:  123 MRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREYKNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFTEISESNFPPERLEEIERVEYLDVKLKAPGFPRNLHLKTIVXXXXXXXXXXXXXXXXQSVIKLDEIKKRVAKEKVKQVRNNRINKQQRNSRKTDCRRDLKDDFFQ 1403
            MRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREYKNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKSSEINEENNESCEEESSESEEESEEEISENDETSELNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFTEISESNFPPERLEEIERVEYLDVKLKAPGFPRNLHLKTIVDEDGESEDEISSEHEEQSVIKLDEIKKRVAKEKVKQVRNNRINKQQRNSRKTDCRRDLKDDFFQ
Sbjct:    1 MRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREYKNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKSSEINEENNESCEEESSESEEESEEEISENDETSELNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFTEISESNFPPERLEEIERVEYLDVKLKAPGFPRNLHLKTIVDEDGESEDEISSEHEEQSVIKLDEIKKRVAKEKVKQVRNNRINKQQRNSRKTDCRRDLKDDFFQ 427          
BLAST of Serine:threonine protein kinase rio2 vs. Planmine SMEST
Match: SMESG000041471.1 (SMESG000041471.1)

HSP 1 Score: 733.791 bits (1893), Expect = 0.000e+0
Identity = 421/454 (92.73%), Postives = 421/454 (92.73%), Query Frame = 3
Query:   42 MPKVIQTRNFFSVKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREYKNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFTEISESNFPPERLEEIERVEYLDVKLKAPGFPRNLHLKTIVXXXXXXXXXXXXXXXXQSVIKLDEIKKRVAKEKVKQVRNNRINKQQRNSRKTDCRRDLKDDFFQ 1403
            MPKVIQTRNFFSVKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREYKNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKSSEINEENNESCEEESSESEEESEEEISENDETSELNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQ                                 ERVEYLDVKLKAPGFPRNLHLKTIVDEDGESEDEISSEHEEQSVIKLDEIKKRVAKEKVKQVRNNRINKQQRNSRKTDCRRDLKDDFFQ
Sbjct:    1 MPKVIQTRNFFSVKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREYKNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKSSEINEENNESCEEESSESEEESEEEISENDETSELNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQ---------------------------------ERVEYLDVKLKAPGFPRNLHLKTIVDEDGESEDEISSEHEEQSVIKLDEIKKRVAKEKVKQVRNNRINKQQRNSRKTDCRRDLKDDFFQ 421          
BLAST of Serine:threonine protein kinase rio2 vs. Planmine SMEST
Match: SMESG000041471.1 (SMESG000041471.1)

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 396/427 (92.74%), Postives = 396/427 (92.74%), Query Frame = 3
Query:  123 MRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNKREYKNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFTEISESNFPPERLEEIERVEYLDVKLKAPGFPRNLHLKTIVXXXXXXXXXXXXXXXXQSVIKLDEIKKRVAKEKVKQVRNNRINKQQRNSRKTDCRRDLKDDFFQ 1403
            MRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQ                               ALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKSSEINEENNESCEEESSESEEESEEEISENDETSELNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFTEISESNFPPERLEEIERVEYLDVKLKAPGFPRNLHLKTIVDEDGESEDEISSEHEEQSVIKLDEIKKRVAKEKVKQVRNNRINKQQRNSRKTDCRRDLKDDFFQ
Sbjct:    1 MRNHEYVQVNMVQKYSGIQFSGKSFINLLRNSLIPYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNFQLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQ-------------------------------ALYEAGMPVPIAIGQNRGAVAMEYVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLLVEVGTADDINDWFKSSEINEENNESCEEESSESEEESEEEISENDETSELNECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFTEISESNFPPERLEEIERVEYLDVKLKAPGFPRNLHLKTIVDEDGESEDEISSEHEEQSVIKLDEIKKRVAKEKVKQVRNNRINKQQRNSRKTDCRRDLKDDFFQ 396          
The following BLAST results are available for this feature:
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RIOK26.791e-5042.15RIO kinase 2 [Source:HGNC Symbol;Acc:HGNC:18999][more]
RIOK21.450e-4942.15RIO kinase 2 [Source:HGNC Symbol;Acc:HGNC:18999][more]
back to top
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
riok-27.618e-4439.42Serine/threonine-protein kinase RIO2 [Source:UniP... [more]
back to top
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RIOK25.068e-4540.65gene:FBgn0039306 transcript:FBtr0084816[more]
back to top
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
riok21.695e-4940.08RIO kinase 2 (yeast) [Source:ZFIN;Acc:ZDB-GENE-040... [more]
riok21.730e-4940.08RIO kinase 2 (yeast) [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
riok23.295e-4538.84RIO kinase 2 [Source:NCBI gene;Acc:549436][more]
riok24.979e-4538.84RIO kinase 2 [Source:NCBI gene;Acc:549436][more]
back to top
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Riok24.699e-5041.32RIO kinase 2 [Source:MGI Symbol;Acc:MGI:1914295][more]
Riok24.820e-5041.32RIO kinase 2 [Source:MGI Symbol;Acc:MGI:1914295][more]
Riok21.471e-1243.90RIO kinase 2 [Source:MGI Symbol;Acc:MGI:1914295][more]
back to top
BLAST of Serine:threonine protein kinase rio2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CQS5|RIOK2_MOUSE3.372e-4941.32Serine/threonine-protein kinase RIO2 OS=Mus muscul... [more]
sp|Q9BVS4|RIOK2_HUMAN6.965e-4942.15Serine/threonine-protein kinase RIO2 OS=Homo sapie... [more]
sp|Q95Q34|RIOK2_CAEEL7.765e-4339.42Serine/threonine-protein kinase RIO2 OS=Caenorhabd... [more]
sp|Q9P7W5|RIO2_SCHPO1.527e-4239.52Serine/threonine-protein kinase rio2 OS=Schizosacc... [more]
sp|Q54T05|RIO2_DICDI3.716e-4237.19Serine/threonine-protein kinase rio2 OS=Dictyostel... [more]
back to top
BLAST of Serine:threonine protein kinase rio2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SR764.784e-9542.48RIO domain-containing protein OS=Hymenolepis dimin... [more]
A0A0R3TUY35.134e-9543.10RIO domain-containing protein OS=Rodentolepis nana... [more]
A0A5K3F4V23.138e-9342.36Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3UK874.336e-9241.65Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3X5954.648e-9041.44RIO domain-containing protein OS=Hydatigena taenia... [more]
back to top
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
riok26.358e-4738.84RIO kinase 2 [Source:NCBI gene;Acc:103037025][more]
back to top
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RIO21.035e-3927.49Essential serine kinase involved in the processing... [more]
back to top
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO346242.620e-4841.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine:threonine protein kinase rio2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000010866.26.131e-4739.18RIO kinase 2 [Source:NCBI gene;Acc:101175658][more]
back to top
BLAST of Serine:threonine protein kinase rio2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000041471.10.000e+0100.00SMESG000041471.1[more]
SMESG000041471.10.000e+092.73SMESG000041471.1[more]
SMESG000041471.10.000e+092.74SMESG000041471.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031378 ID=SMED30031378|Name=Serine:threonine protein kinase rio2|organism=Schmidtea mediterranea sexual|type=transcript|length=1427bp
AAATAATTGTTTAAATAATATACATTTGTTTCAAAAATATAATGCCAAAA
GTTATTCAAACTCGAAACTTTTTTTCAGTCAAAGAAGATGAATGGAGGGT
TTTGACTGCAGTTGAAACTGGTATGAGAAATCATGAATATGTTCAAGTCA
ACATGGTTCAAAAATATTCTGGTATTCAATTTTCAGGAAAAAGTTTTATC
AATCTTCTACGCAATAGTCTAATACCATATAGACTAATTGCATTTGAAAA
TAACGGTTATCGGTTAACAAATCTCGGATACGATTTTTTAGCACTTCATA
AATTCATTAAATCTGGAATTGTTTATGATTTATCCAACTTCCAATTATTT
GCAACTGGAAAAGAATCCGATCTTTATGTTTGTAAATCTGGACCAATTTG
TCATGAAGAATTTGAAATCAAAAGTGATTATCCAATTGTCCTAAAGTTCC
ATAGACTTGGTCGAACATCTTTCAAACAAGTGAAAAACAAACGAGAATAT
AAAAATGGAAACAATTGTTCATGGTTATACATGAATAGAATTTCATCTAC
CAGAGAATATCAAACAATGAGGGCATTATATGAAGCGGGAATGCCAGTAC
CGATTGCAATCGGTCAAAATAGAGGCGCCGTTGCAATGGAATATGTCAAC
AGTGTTGCATTAGTTAAGTTTTCTAAACTCGTATTAGAAAATGGAGCAGC
TGAGCTTCTGTACAACCAAGCTAAATGCTTGTTGGTTAAATTTGTGCAAT
TGGGTCTAGTCCATGGGGATTTTAATGAGTTCAATTTACTTGTCGAGGTT
GGGACTGCAGATGATATCAATGATTGGTTTAAAAGCTCGGAAATCAACGA
AGAAAACAATGAGAGTTGTGAAGAAGAATCGTCTGAGAGTGAAGAAGAAT
CTGAAGAAGAGATTTCCGAGAACGACGAAACTAGTGAATTGAATGAATGC
CCTTATTTGGATCAAGATTACAACACGTTCAAGTTGAGAATGATTGATTT
TCCACAAGTAATCAGTCGAAACAACAAAACGGCACAAGAAATATACGAAC
GAGATCGCCAGGGAATAATTAGTTTCTTCCAGAAGTTCACGGAAATATCC
GAAAGTAATTTCCCGCCGGAACGCCTGGAGGAAATTGAGCGTGTCGAATA
TCTAGATGTGAAATTGAAAGCTCCAGGATTCCCGAGAAATTTGCATCTTA
AAACTATTGTTGATGAAGATGGAGAAAGTGAGGATGAAATTTCGTCGGAA
CATGAGGAACAGAGTGTGATAAAATTGGATGAAATCAAGAAACGAGTGGC
AAAAGAAAAAGTGAAGCAAGTAAGAAATAATCGAATTAACAAACAGCAAA
GAAATTCCAGGAAAACTGACTGCCGAAGGGATTTGAAAGATGATTTTTTC
CAATAAATTTAATTTGTCTTTTGAAAA
back to top

protein sequence of SMED30031378-orf-1

>SMED30031378-orf-1 ID=SMED30031378-orf-1|Name=SMED30031378-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=455bp
MPKVIQTRNFFSVKEDEWRVLTAVETGMRNHEYVQVNMVQKYSGIQFSGK
SFINLLRNSLIPYRLIAFENNGYRLTNLGYDFLALHKFIKSGIVYDLSNF
QLFATGKESDLYVCKSGPICHEEFEIKSDYPIVLKFHRLGRTSFKQVKNK
REYKNGNNCSWLYMNRISSTREYQTMRALYEAGMPVPIAIGQNRGAVAME
YVNSVALVKFSKLVLENGAAELLYNQAKCLLVKFVQLGLVHGDFNEFNLL
VEVGTADDINDWFKSSEINEENNESCEEESSESEEESEEEISENDETSEL
NECPYLDQDYNTFKLRMIDFPQVISRNNKTAQEIYERDRQGIISFFQKFT
EISESNFPPERLEEIERVEYLDVKLKAPGFPRNLHLKTIVDEDGESEDEI
SSEHEEQSVIKLDEIKKRVAKEKVKQVRNNRINKQQRNSRKTDCRRDLKD
DFFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR000687RIO_kinase
IPR011991WHTH_DNA-bd_dom
IPR015285RIO2_wHTH_N
IPR018935RIO_kinase_CS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004674protein serine/threonine kinase activity
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 266..293
NoneNo IPR availableCOILSCoilCoilcoord: 417..437
NoneNo IPR availablePFAMPF01163RIO1coord: 131..271
e-value: 6.1E-24
score: 84.7
coord: 314..350
e-value: 1.1E-4
score: 21.9
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 101..204
e-value: 2.3E-28
score: 100.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 267..301
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 426..454
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 272..301
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 436..454
NoneNo IPR availablePANTHERPTHR45852FAMILY NOT NAMEDcoord: 10..443
IPR000687RIO kinaseSMARTSM00090rio_2coord: 69..367
e-value: 3.5E-10
score: 49.1
IPR015285RIO2 kinase winged helix domain, N-terminalPFAMPF09202Rio2_Ncoord: 13..90
e-value: 3.1E-19
score: 69.0
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 4..92
e-value: 4.3E-22
score: 79.8
IPR018935RIO kinase, conserved sitePROSITEPS01245RIO1coord: 239..250
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 14..92
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 127..346