Dual specificity tyrosine-phosphorylation-regulated kinase 1A

Overview
NameDual specificity tyrosine-phosphorylation-regulated kinase 1A
Smed IDSMED30031373
Length (bp)2714
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 1A (SMED30031373) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 1A (SMED30031373) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity tyrosine-phosphorylation-regulated kinase 1A (SMED30031373) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity tyrosine-phosphorylation-regulated kinase 1A (SMED30031373) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031373

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30031373SMESG000080906.1 dd_Smed_v4_6670_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031373SMESG000080906.1 dd_Smed_v6_6670_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1B (dual specificity tyrosine phosphorylation regulated kinase 1B [Source:HGNC Symbol;Acc:HGNC:3092])

HSP 1 Score: 392.119 bits (1006), Expect = 1.058e-124
Identity = 231/498 (46.39%), Postives = 298/498 (59.84%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNPILPNTSSKTAVPSLLST 2361
            L KLSVDLIKTYK+INE+Y              + KK R+                       A Q    D SN+  KK     L H                             D   ++Y+++ GE W  +Y I+ LIG GSFGQVV+A D ++ E VAIKIIKNK+ F+ QA IE+ LL+ +   Q + E+       YIV LK  F  R HLCLVFELL+Y LY+LL+NT+FRGVSLNLTRK AQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L   Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ RI+EV+G+PP+ M+D   K+ +YF+R P             L R K+ +K  +QG  +R+L +++GV TGGP GRR  EPGHS  DY +F DL+ +M+  +P  RI P  AL+H FF R+    TN   P  SS +  P+ L T
Sbjct:   45 LRKLSVDLIKTYKHINEVY--------------YAKKKRR-----------------------AQQAPPQDSSNKKEKK----VLNHG---------------------------YDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMN--QHDTEMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGW--------TLRRTKELRK-DYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATN-TGPAGSSASTSPAPLDT 457          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1B (dual specificity tyrosine phosphorylation regulated kinase 1B [Source:HGNC Symbol;Acc:HGNC:3092])

HSP 1 Score: 392.119 bits (1006), Expect = 1.058e-124
Identity = 231/498 (46.39%), Postives = 298/498 (59.84%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNPILPNTSSKTAVPSLLST 2361
            L KLSVDLIKTYK+INE+Y              + KK R+                       A Q    D SN+  KK     L H                             D   ++Y+++ GE W  +Y I+ LIG GSFGQVV+A D ++ E VAIKIIKNK+ F+ QA IE+ LL+ +   Q + E+       YIV LK  F  R HLCLVFELL+Y LY+LL+NT+FRGVSLNLTRK AQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L   Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ RI+EV+G+PP+ M+D   K+ +YF+R P             L R K+ +K  +QG  +R+L +++GV TGGP GRR  EPGHS  DY +F DL+ +M+  +P  RI P  AL+H FF R+    TN   P  SS +  P+ L T
Sbjct:   45 LRKLSVDLIKTYKHINEVY--------------YAKKKRR-----------------------AQQAPPQDSSNKKEKK----VLNHG---------------------------YDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMN--QHDTEMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGW--------TLRRTKELRK-DYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATN-TGPAGSSASTSPAPLDT 457          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1B (dual specificity tyrosine phosphorylation regulated kinase 1B [Source:HGNC Symbol;Acc:HGNC:3092])

HSP 1 Score: 392.119 bits (1006), Expect = 1.058e-124
Identity = 231/498 (46.39%), Postives = 298/498 (59.84%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNPILPNTSSKTAVPSLLST 2361
            L KLSVDLIKTYK+INE+Y              + KK R+                       A Q    D SN+  KK     L H                             D   ++Y+++ GE W  +Y I+ LIG GSFGQVV+A D ++ E VAIKIIKNK+ F+ QA IE+ LL+ +   Q + E+       YIV LK  F  R HLCLVFELL+Y LY+LL+NT+FRGVSLNLTRK AQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L   Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ RI+EV+G+PP+ M+D   K+ +YF+R P             L R K+ +K  +QG  +R+L +++GV TGGP GRR  EPGHS  DY +F DL+ +M+  +P  RI P  AL+H FF R+    TN   P  SS +  P+ L T
Sbjct:   45 LRKLSVDLIKTYKHINEVY--------------YAKKKRR-----------------------AQQAPPQDSSNKKEKK----VLNHG---------------------------YDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMN--QHDTEMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGW--------TLRRTKELRK-DYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATN-TGPAGSSASTSPAPLDT 457          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1B (dual specificity tyrosine phosphorylation regulated kinase 1B [Source:HGNC Symbol;Acc:HGNC:3092])

HSP 1 Score: 392.119 bits (1006), Expect = 1.058e-124
Identity = 231/498 (46.39%), Postives = 298/498 (59.84%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNPILPNTSSKTAVPSLLST 2361
            L KLSVDLIKTYK+INE+Y              + KK R+                       A Q    D SN+  KK     L H                             D   ++Y+++ GE W  +Y I+ LIG GSFGQVV+A D ++ E VAIKIIKNK+ F+ QA IE+ LL+ +   Q + E+       YIV LK  F  R HLCLVFELL+Y LY+LL+NT+FRGVSLNLTRK AQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L   Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ RI+EV+G+PP+ M+D   K+ +YF+R P             L R K+ +K  +QG  +R+L +++GV TGGP GRR  EPGHS  DY +F DL+ +M+  +P  RI P  AL+H FF R+    TN   P  SS +  P+ L T
Sbjct:   45 LRKLSVDLIKTYKHINEVY--------------YAKKKRR-----------------------AQQAPPQDSSNKKEKK----VLNHG---------------------------YDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMN--QHDTEMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGW--------TLRRTKELRK-DYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATN-TGPAGSSASTSPAPLDT 457          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Match: DYRK1A (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:HGNC Symbol;Acc:HGNC:3091])

HSP 1 Score: 375.941 bits (964), Expect = 6.902e-120
Identity = 195/357 (54.62%), Postives = 255/357 (71.43%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K   + E+       YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++ P      K T        KDGK+  ++   +RKL +I+GV TGGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++    TN
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNK--HDTEMKY-----YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKT--------KDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTN 488          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-1 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q8WQL7])

HSP 1 Score: 377.481 bits (968), Expect = 1.015e-116
Identity = 220/479 (45.93%), Postives = 297/479 (62.00%), Query Frame = 1
Query:  874 KLSVDLIKTYKNINEIYYRKK--RRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQ-KVLSCDGAPQT---KNSDPSNEINKKFGCATL--LHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSI--EKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFF 2280
            KL+ DLIKTYK INE +Y +K  RR +  + D    K  K  SG          N   + S D   Q    +N+ P  + N       +  + ++  +   Q    S   P++N        D   Y+Y++K GEI+  +Y I  +  +G GSFGQV +A D  + E VAIKIIKNK+ F +QA IEI LL+      ++++         IV LK  F HR HLCLVFELL+Y LY+LLKNT+FRGVSLNL RKFAQQ+ + L+FLS P++ IIHCDLKPEN+LL++ +RS I+V+DFGSSC    RIY YIQSRFYRSPE++L + Y   IDMWSLGCI+ E+HTG+PLF G  E +Q+++I+EV+GMPP  M+D G K+ +YFD+        K T        +DG +  ++   +RKL +I+GV +GGP GRRL EPGHS  DY KF DL+++M+  DPK+RI P   ++HPF 
Sbjct:  192 KLTSDLIKTYKAINESFYLRKQVRRDRHKSQDAGKPKGSKDGSGASLTDTFSIHNAIPITSSDNHYQQDAHQNAPPLLDTNAPPTSTMVVPMRTETDLQQQQRQKSSRGGPYNN------GYDDQNYDYILKNGEIFDKRYVILSDTPVGKGSFGQVTKAYDTLNKEEVAIKIIKNKKTFFDQAQIEIHLLELTNAHDKDNKYN-------IVTLKGHFVHRAHLCLVFELLSYNLYDLLKNTSFRGVSLNLARKFAQQLGKTLLFLSSPELSIIHCDLKPENVLLVNAKRSQIRVIDFGSSCQTGHRIYQYIQSRFYRSPEVLLGIAYDTKIDMWSLGCILVEMHTGEPLFAGSSEVDQMMKIVEVLGMPPKEMLDIGPKTHKYFDKTEDGIYYCKKT--------RDGYRHTYKAPGARKLHEILGVTSGGPGGRRLGEPGHSVEDYSKFKDLIKRMLQFDPKQRISPYYVVRHPFL 649          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 236.498 bits (602), Expect = 1.207e-68
Identity = 148/369 (40.11%), Postives = 216/369 (58.54%), Query Frame = 1
Query: 1204 ISSKDVGGYE-----YLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTP 2295
            I   + GGY+     Y +   +    +Y + K+IG GSFGQV++A D K  ++VA+K+++N++ F  QA  EI +L  + + Q++D      G + I+ +  +FN R H C+ FELL+  LYEL+K   F+G SL L RKFA  +   L  L K +  +IHCDLKPEN+LL    RS IKV+DFGSSC  ++RIY YIQSRFYR+PE+IL   Y   IDMWSLGCI+AEL TG PL  G+ E++Q+  IIE++GMPP   +++ K++      F ++    +Y     +    DG  +   G  S++     G   G P  R  +    +  D E F+D L++ +  DP+ R+ P +ALKH +  R  P
Sbjct:  107 IGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRR-QDSD------GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNR--LIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRA----RTFITSKGYPRYCTATSM---PDG-SVVLAGARSKR-----GKMRGPPASRSWSTALKNMGD-ELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRLP 452          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 236.498 bits (602), Expect = 1.207e-68
Identity = 148/369 (40.11%), Postives = 216/369 (58.54%), Query Frame = 1
Query: 1204 ISSKDVGGYE-----YLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTP 2295
            I   + GGY+     Y +   +    +Y + K+IG GSFGQV++A D K  ++VA+K+++N++ F  QA  EI +L  + + Q++D      G + I+ +  +FN R H C+ FELL+  LYEL+K   F+G SL L RKFA  +   L  L K +  +IHCDLKPEN+LL    RS IKV+DFGSSC  ++RIY YIQSRFYR+PE+IL   Y   IDMWSLGCI+AEL TG PL  G+ E++Q+  IIE++GMPP   +++ K++      F ++    +Y     +    DG  +   G  S++     G   G P  R  +    +  D E F+D L++ +  DP+ R+ P +ALKH +  R  P
Sbjct:  107 IGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRR-QDSD------GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNR--LIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRA----RTFITSKGYPRYCTATSM---PDG-SVVLAGARSKR-----GKMRGPPASRSWSTALKNMGD-ELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRLP 452          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 236.498 bits (602), Expect = 1.207e-68
Identity = 148/369 (40.11%), Postives = 216/369 (58.54%), Query Frame = 1
Query: 1204 ISSKDVGGYE-----YLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTP 2295
            I   + GGY+     Y +   +    +Y + K+IG GSFGQV++A D K  ++VA+K+++N++ F  QA  EI +L  + + Q++D      G + I+ +  +FN R H C+ FELL+  LYEL+K   F+G SL L RKFA  +   L  L K +  +IHCDLKPEN+LL    RS IKV+DFGSSC  ++RIY YIQSRFYR+PE+IL   Y   IDMWSLGCI+AEL TG PL  G+ E++Q+  IIE++GMPP   +++ K++      F ++    +Y     +    DG  +   G  S++     G   G P  R  +    +  D E F+D L++ +  DP+ R+ P +ALKH +  R  P
Sbjct:  107 IGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRR-QDSD------GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNR--LIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRA----RTFITSKGYPRYCTATSM---PDG-SVVLAGARSKR-----GKMRGPPASRSWSTALKNMGD-ELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRLP 452          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Match: mbk-2 (Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTF3])

HSP 1 Score: 236.884 bits (603), Expect = 1.398e-68
Identity = 148/369 (40.11%), Postives = 216/369 (58.54%), Query Frame = 1
Query: 1204 ISSKDVGGYE-----YLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTP 2295
            I   + GGY+     Y +   +    +Y + K+IG GSFGQV++A D K  ++VA+K+++N++ F  QA  EI +L  + + Q++D      G + I+ +  +FN R H C+ FELL+  LYEL+K   F+G SL L RKFA  +   L  L K +  +IHCDLKPEN+LL    RS IKV+DFGSSC  ++RIY YIQSRFYR+PE+IL   Y   IDMWSLGCI+AEL TG PL  G+ E++Q+  IIE++GMPP   +++ K++      F ++    +Y     +    DG  +   G  S++     G   G P  R  +    +  D E F+D L++ +  DP+ R+ P +ALKH +  R  P
Sbjct:  107 IGGANNGGYDDENGSYQLVVHDHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRR-QDSD------GTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLCLDLLQKNR--LIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVILGTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRA----RTFITSKGYPRYCTATSM---PDG-SVVLAGARSKR-----GKMRGPPASRSWSTALKNMGD-ELFVDFLKRCLDWDPETRMTPAQALKHKWLRRRLP 452          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0300509)

HSP 1 Score: 387.497 bits (994), Expect = 1.307e-123
Identity = 230/480 (47.92%), Postives = 296/480 (61.67%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            L KLSVDLIKTYK+INE+Y              + KK R+                       A QT+  D S+  NKK      L++D                           D   ++Y+IK GE +  +Y I+ LIG GSFGQVV+A D +    VAIKIIKNK+ F+ QA IE+ LL+ + +       A      YIVKLK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FLS P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY+YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+GMPP  ++D   K+ ++FD+  +            L + ++G+K  ++   SRKL DI+GV TGGP GRRL+EPGHS  DY KF DL+ +M+  DPK R+ P  AL+H FF R+    TN
Sbjct:   97 LRKLSVDLIKTYKHINEVY--------------YAKKKRR-----------------------AQQTQGDDDSS--NKK---ERKLYND-------------------------GYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNR-------ADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYV-------LKKNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKRTADEATN 493          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0299619)

HSP 1 Score: 387.497 bits (994), Expect = 1.727e-123
Identity = 230/480 (47.92%), Postives = 296/480 (61.67%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            L KLSVDLIKTYK+INE+Y              + KK R+                       A QT+  D S+  NKK      L++D                           D   ++Y+IK GE +  +Y I+ LIG GSFGQVV+A D +    VAIKIIKNK+ F+ QA IE+ LL+ + +       A      YIVKLK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FLS P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY+YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+GMPP  ++D   K+ ++FD+  +            L + ++G+K  ++   SRKL DI+GV TGGP GRRL+EPGHS  DY KF DL+ +M+  DPK R+ P  AL+H FF R+    TN
Sbjct:   97 LRKLSVDLIKTYKHINEVY--------------YAKKKRR-----------------------AQQTQGDDDSS--NKK---ERKLYND-------------------------GYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNR-------ADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYV-------LKKNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKRTADEATN 493          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0342786)

HSP 1 Score: 387.111 bits (993), Expect = 8.708e-122
Identity = 229/480 (47.71%), Postives = 297/480 (61.88%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            L KLSVDLIKTYK+INE+Y              + KK R+                       A QT+  D S+  NKK      L++D                           D   ++Y+IK GE +  +Y I+ LIG GSFGQVV+A D +    VAIKIIKNK+ F+ QA IE+ LL+ + +    ++        YIVKLK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FLS P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY+YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+GMPP  ++D   K+ ++FD+  +            L + ++G+K  ++   SRKL DI+GV TGGP GRRL+EPGHS  DY KF DL+ +M+  DPK R+ P  AL+H FF R+    TN
Sbjct:  236 LRKLSVDLIKTYKHINEVY--------------YAKKKRR-----------------------AQQTQGDDDSS--NKK---ERKLYND-------------------------GYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKY-------YIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYV-------LKKNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKRTADEATN 632          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0300508)

HSP 1 Score: 389.423 bits (999), Expect = 7.619e-121
Identity = 230/480 (47.92%), Postives = 296/480 (61.67%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            L KLSVDLIKTYK+INE+Y              + KK R+                       A QT+  D S+  NKK      L++D                           D   ++Y+IK GE +  +Y I+ LIG GSFGQVV+A D +    VAIKIIKNK+ F+ QA IE+ LL+ + +       A      YIVKLK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FLS P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY+YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+GMPP  ++D   K+ ++FD+  +            L + ++G+K  ++   SRKL DI+GV TGGP GRRL+EPGHS  DY KF DL+ +M+  DPK R+ P  AL+H FF R+    TN
Sbjct:   97 LRKLSVDLIKTYKHINEVY--------------YAKKKRR-----------------------AQQTQGDDDSS--NKK---ERKLYND-------------------------GYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNR-------ADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYV-------LKKNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKRTADEATN 493          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Match: mnb (gene:FBgn0259168 transcript:FBtr0300510)

HSP 1 Score: 389.037 bits (998), Expect = 1.920e-119
Identity = 226/480 (47.08%), Postives = 295/480 (61.46%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            L KLSVDLIKTYK+INE+Y              + KK R+      D+                      D SN+  +K      L++D                           D   ++Y+IK GE +  +Y I+ LIG GSFGQVV+A D +    VAIKIIKNK+ F+ QA IE+ LL+ + +    ++        YIVKLK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FLS P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY+YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+GMPP  ++D   K+ ++FD+  +            L + ++G+K  ++   SRKL DI+GV TGGP GRRL+EPGHS  DY KF DL+ +M+  DPK R+ P  AL+H FF R+    TN
Sbjct:  236 LRKLSVDLIKTYKHINEVY--------------YAKKKRRAQQTQGDD----------------------DSSNKKERK------LYND-------------------------GYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKY-------YIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYV-------LKKNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKRTADEATN 632          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B [Source:ZFIN;Acc:ZDB-GENE-060503-499])

HSP 1 Score: 375.555 bits (963), Expect = 5.620e-118
Identity = 200/363 (55.10%), Postives = 257/363 (70.80%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGIS------SRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K   + E+       YIV LK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ M+D   K+ +YFD+  S  L T       + + KD KK+ +   S      +R+L +I+GV TGGP GRR  E GH+  DY KF DL+ +M+  DPK RI P  AL+H FF ++T   TN
Sbjct:  100 IVKNGEKWLDRYEIDSLIGKGSFGQVVKAYDHHEQEWVAIKIIKNKKAFLNQAQIELRLLELMNK--HDTEMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGVPPNHMLDQAPKARKYFDKL-SDGLWT-------VKKNKDIKKVLYPSASEYKPPATRRLHEILGVETGGPGGRRAGEQGHAPCDYLKFKDLILRMLDYDPKTRITPFYALQHNFFKKTTDEGTN 447          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1ab (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, b [Source:ZFIN;Acc:ZDB-GENE-030131-5677])

HSP 1 Score: 376.711 bits (966), Expect = 7.265e-118
Identity = 194/355 (54.65%), Postives = 253/355 (71.27%), Query Frame = 1
Query: 1228 YEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST 2292
            Y+Y++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++        K T        KDGK+  ++  +SRKL  I+GV  GGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++T
Sbjct:  107 YDYVVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKLSDGTWSIKKT--------KDGKR--YKPPASRKLHAILGVECGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTT 444          

HSP 2 Score: 51.6026 bits (122), Expect = 4.795e-6
Identity = 36/86 (41.86%), Postives = 54/86 (62.79%), Query Frame = 1
Query:  787 SIDKTLTSLPME------TGAIKLDPRC-SNPHI--LIKLSVDLIKTYKNINEIYYRKKRRLKE--PTDDNFLKKDRKR-NSGHED 1008
            S D+++T LP        T + +  P+C  +P +  L KLS+DLIKTYK+INE+YY KK+R  +    +D+  KK+RK  N G++D
Sbjct:   19 STDQSVTVLPYSDQTQALTASQRHMPQCFRDPTLAPLRKLSIDLIKTYKHINEVYYAKKKRRHQQGQGEDSSHKKERKVFNDGYDD 104          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1ab (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, b [Source:ZFIN;Acc:ZDB-GENE-030131-5677])

HSP 1 Score: 376.326 bits (965), Expect = 1.284e-117
Identity = 194/355 (54.65%), Postives = 253/355 (71.27%), Query Frame = 1
Query: 1228 YEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST 2292
            Y+Y++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++        K T        KDGK+  ++  +SRKL  I+GV  GGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++T
Sbjct:  115 YDYVVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKLSDGTWSIKKT--------KDGKR--YKPPASRKLHAILGVECGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTT 452          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B [Source:ZFIN;Acc:ZDB-GENE-060503-499])

HSP 1 Score: 375.555 bits (963), Expect = 3.811e-117
Identity = 198/357 (55.46%), Postives = 255/357 (71.43%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ M+D   K+ +YFD+  S  L T       + + KD KK  ++  ++R+L +I+GV TGGP GRR  E GH+  DY KF DL+ +M+  DPK RI P  AL+H FF ++T   TN
Sbjct:  100 IVKNGEKWLDRYEIDSLIGKGSFGQVVKAYDHHEQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGVPPNHMLDQAPKARKYFDKL-SDGLWT-------VKKNKDIKK-EYKPPATRRLHEILGVETGGPGGRRAGEQGHAPCDYLKFKDLILRMLDYDPKTRITPFYALQHNFFKKTTDEGTN 440          

HSP 2 Score: 50.8322 bits (120), Expect = 8.558e-6
Identity = 26/42 (61.90%), Postives = 33/42 (78.57%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKE--PTDDNFLKKDRK 987
            L KLSVDLIKTYK+INE+YY KK+R  +  P +D+  KK+RK
Sbjct:   45 LRKLSVDLIKTYKHINEVYYTKKKRRAQQVPPEDSSTKKERK 86          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 364.77 bits (935), Expect = 3.391e-113
Identity = 217/475 (45.68%), Postives = 289/475 (60.84%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST 2292
            L KLS++LIKTYK+INE+Y              + KK R+   G                       +  D SN+  +K      +++D                           D   ++Y++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PPS +++   K+ ++F++ P +    K T        KDGK+  ++   SRKL  I+GV  GGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++ 
Sbjct:   98 LRKLSIELIKTYKHINEVY--------------YAKKKRRHQQG-----------------------QGEDSSNKKERK------IYND-------------------------GYDDDNFDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGVPPSHILEQAPKARKFFEKMPDSMWCAKKT--------KDGKR--YKPAGSRKLHSILGVEAGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTA 487          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: gdf7 (growth differentiation factor 7 [Source:Xenbase;Acc:XB-GENE-484925])

HSP 1 Score: 377.481 bits (968), Expect = 3.352e-120
Identity = 199/359 (55.43%), Postives = 255/359 (71.03%), Query Frame = 1
Query: 1216 DVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST 2292
            D   Y+Y++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K   + E+       YIV LK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G PP+ M+D   K+ +YFD+ P      K        + KD KK  ++   +R+L +++GV TGGP GRR  E GHS  DY KF DL+ +M+  DPK RI P  AL+H FF ++T
Sbjct:   68 DDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHHDQEWVAIKIIKNKKAFLNQAQIELRLLELMNK--HDTEMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGTPPNHMLDQAPKARKYFDKLPEGTWTVK--------KNKDLKK-DYKVPGTRRLHEVLGVETGGPGGRRAGEQGHSPSDYLKFKDLILRMLDYDPKTRITPFYALQHNFFKKTT 410          

HSP 2 Score: 50.8322 bits (120), Expect = 8.721e-6
Identity = 33/63 (52.38%), Postives = 42/63 (66.67%), Query Frame = 1
Query:  832 IKLDPRCSNPHILIKLSVDLIKTYKNINEIYYRKKRRLKE--PTDDNFLKKDRKR-NSGHEDN 1011
            I L  R S    L KLSVDLIKTYK+INE+YY KK+R  +  P +D+  KK+RK  N G +D+
Sbjct:    8 IPLTFRDSAAAPLRKLSVDLIKTYKHINEVYYAKKKRRAQQVPPEDSSTKKERKVFNDGFDDD 70          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: gdf7 (growth differentiation factor 7 [Source:Xenbase;Acc:XB-GENE-484925])

HSP 1 Score: 380.948 bits (977), Expect = 5.645e-120
Identity = 199/359 (55.43%), Postives = 255/359 (71.03%), Query Frame = 1
Query: 1216 DVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST 2292
            D   Y+Y++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K   + E+       YIV LK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G PP+ M+D   K+ +YFD+ P      K        + KD KK  ++   +R+L +++GV TGGP GRR  E GHS  DY KF DL+ +M+  DPK RI P  AL+H FF ++T
Sbjct:   93 DDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHHDQEWVAIKIIKNKKAFLNQAQIELRLLELMNK--HDTEMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGTPPNHMLDQAPKARKYFDKLPEGTWTVK--------KNKDLKK-DYKVPGTRRLHEVLGVETGGPGGRRAGEQGHSPSDYLKFKDLILRMLDYDPKTRITPFYALQHNFFKKTT 435          

HSP 2 Score: 51.9878 bits (123), Expect = 5.188e-6
Identity = 33/63 (52.38%), Postives = 42/63 (66.67%), Query Frame = 1
Query:  832 IKLDPRCSNPHILIKLSVDLIKTYKNINEIYYRKKRRLKE--PTDDNFLKKDRKR-NSGHEDN 1011
            I L  R S    L KLSVDLIKTYK+INE+YY KK+R  +  P +D+  KK+RK  N G +D+
Sbjct:   33 IPLTFRDSAAAPLRKLSVDLIKTYKHINEVYYAKKKRRAQQVPPEDSSTKKERKVFNDGFDDD 95          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: gdf7 (growth differentiation factor 7 [Source:Xenbase;Acc:XB-GENE-484925])

HSP 1 Score: 380.178 bits (975), Expect = 7.819e-120
Identity = 199/359 (55.43%), Postives = 255/359 (71.03%), Query Frame = 1
Query: 1216 DVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST 2292
            D   Y+Y++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K   + E+       YIV LK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G PP+ M+D   K+ +YFD+ P      K        + KD KK  ++   +R+L +++GV TGGP GRR  E GHS  DY KF DL+ +M+  DPK RI P  AL+H FF ++T
Sbjct:   82 DDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHHDQEWVAIKIIKNKKAFLNQAQIELRLLELMNK--HDTEMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGTPPNHMLDQAPKARKYFDKLPEGTWTVK--------KNKDLKK-DYKVPGTRRLHEVLGVETGGPGGRRAGEQGHSPSDYLKFKDLILRMLDYDPKTRITPFYALQHNFFKKTT 424          

HSP 2 Score: 51.9878 bits (123), Expect = 4.769e-6
Identity = 35/76 (46.05%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  793 DKTLTSLPMETGAIKLDPRCSNPHILIKLSVDLIKTYKNINEIYYRKKRRLKE--PTDDNFLKKDRKR-NSGHEDN 1011
            D  L  + +    I L  R S    L KLSVDLIKTYK+INE+YY KK+R  +  P +D+  KK+RK  N G +D+
Sbjct:    9 DFVLPDMTILQRRIPLTFRDSAAAPLRKLSVDLIKTYKHINEVYYAKKKRRAQQVPPEDSSTKKERKVFNDGFDDD 84          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: gdf7 (growth differentiation factor 7 [Source:Xenbase;Acc:XB-GENE-484925])

HSP 1 Score: 381.333 bits (978), Expect = 3.519e-119
Identity = 199/359 (55.43%), Postives = 255/359 (71.03%), Query Frame = 1
Query: 1216 DVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST 2292
            D   Y+Y++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K   + E+       YIV LK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G PP+ M+D   K+ +YFD+ P      K        + KD KK  ++   +R+L +++GV TGGP GRR  E GHS  DY KF DL+ +M+  DPK RI P  AL+H FF ++T
Sbjct:  167 DDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHHDQEWVAIKIIKNKKAFLNQAQIELRLLELMNK--HDTEMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGTPPNHMLDQAPKARKYFDKLPEGTWTVK--------KNKDLKK-DYKVPGTRRLHEVLGVETGGPGGRRAGEQGHSPSDYLKFKDLILRMLDYDPKTRITPFYALQHNFFKKTT 509          

HSP 2 Score: 51.9878 bits (123), Expect = 4.676e-6
Identity = 33/63 (52.38%), Postives = 42/63 (66.67%), Query Frame = 1
Query:  832 IKLDPRCSNPHILIKLSVDLIKTYKNINEIYYRKKRRLKE--PTDDNFLKKDRKR-NSGHEDN 1011
            I L  R S    L KLSVDLIKTYK+INE+YY KK+R  +  P +D+  KK+RK  N G +D+
Sbjct:  107 IPLTFRDSAAAPLRKLSVDLIKTYKHINEVYYAKKKRRAQQVPPEDSSTKKERKVFNDGFDDD 169          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Match: osbpl8 (oxysterol binding protein like 8 [Source:Xenbase;Acc:XB-GENE-5961068])

HSP 1 Score: 356.295 bits (913), Expect = 1.225e-111
Identity = 194/357 (54.34%), Postives = 254/357 (71.15%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K   + E+       YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++ P      K T        KDGKK  ++   +RKL +++GV TGGP GRR  E GH+  DY KF DL+ +M+  D K RI+P  AL+H FF ++    TN
Sbjct:  147 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNK--HDTEMKY-----YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMSKIVEVLGIPPAHILDQAPKARKFFEKMPEGTWNLKKT--------KDGKK-EYKPPGTRKLHNLLGVETGGPGGRRGGESGHTVADYLKFKDLILRMLDYDAKTRIQPYYALQHSFFKKTADEGTN 487          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 382.874 bits (982), Expect = 2.508e-121
Identity = 201/378 (53.17%), Postives = 264/378 (69.84%), Query Frame = 1
Query: 1228 YEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNPILPNTSSKTAVPSLLST 2361
            ++Y+++ GE W  +Y I+ LIG GSFGQVV+A D ++ E VAIKIIKNK+ F+ QA IE+ LL+ +   Q + E+       YIV LK  F  R HLCLVFELL+Y LY+LL+NT+FRGVSLNLTRK AQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L   Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ RI+EV+G+PP+ M++   K+ +YF+R P             L R K+ +K  +QG  +R+L +++GV TGGP GRR  EPGHS  DY +F DL+ +M+  +P  RI P  AL+H FF R+    TN   P  SS +  P+ L T
Sbjct:   97 HDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMN--QHDTEMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGW--------TLRRTKELRK-DYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATN-TGPAGSSASTSPAPLDT 457          

HSP 2 Score: 51.2174 bits (121), Expect = 5.564e-6
Identity = 28/51 (54.90%), Postives = 38/51 (74.51%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKE--PTDDNFLKKDRK-RNSGHEDN 1011
            L KLSVDLIKTYK+INE+YY KK+R  +  P  D+  KK++K  N G++D+
Sbjct:   45 LRKLSVDLIKTYKHINEVYYAKKKRRAQQAPPQDSSTKKEKKVLNHGYDDD 95          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1b (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1b [Source:MGI Symbol;Acc:MGI:1330302])

HSP 1 Score: 383.645 bits (984), Expect = 6.986e-121
Identity = 201/378 (53.17%), Postives = 264/378 (69.84%), Query Frame = 1
Query: 1228 YEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNPILPNTSSKTAVPSLLST 2361
            ++Y+++ GE W  +Y I+ LIG GSFGQVV+A D ++ E VAIKIIKNK+ F+ QA IE+ LL+ +   Q + E+       YIV LK  F  R HLCLVFELL+Y LY+LL+NT+FRGVSLNLTRK AQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L   Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ RI+EV+G+PP+ M++   K+ +YF+R P             L R K+ +K  +QG  +R+L +++GV TGGP GRR  EPGHS  DY +F DL+ +M+  +P  RI P  AL+H FF R+    TN   P  SS +  P+ L T
Sbjct:  157 HDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMN--QHDTEMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGW--------TLRRTKELRK-DYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATN-TGPAGSSASTSPAPLDT 517          

HSP 2 Score: 51.9878 bits (123), Expect = 3.872e-6
Identity = 28/51 (54.90%), Postives = 38/51 (74.51%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKE--PTDDNFLKKDRK-RNSGHEDN 1011
            L KLSVDLIKTYK+INE+YY KK+R  +  P  D+  KK++K  N G++D+
Sbjct:  105 LRKLSVDLIKTYKHINEVYYAKKKRRAQQAPPQDSSTKKEKKVLNHGYDDD 155          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1a (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a [Source:MGI Symbol;Acc:MGI:1330299])

HSP 1 Score: 378.637 bits (971), Expect = 1.386e-118
Identity = 194/357 (54.34%), Postives = 253/357 (70.87%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++ P      K T        KDGK+  ++   +RKL +I+GV TGGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++    TN
Sbjct:  110 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWSLKKT--------KDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTN 450          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1a (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a [Source:MGI Symbol;Acc:MGI:1330299])

HSP 1 Score: 379.022 bits (972), Expect = 3.127e-118
Identity = 194/357 (54.34%), Postives = 253/357 (70.87%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++ P      K T        KDGK+  ++   +RKL +I+GV TGGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++    TN
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWSLKKT--------KDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTN 488          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Match: Dyrk1a (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a [Source:MGI Symbol;Acc:MGI:1330299])

HSP 1 Score: 379.022 bits (972), Expect = 3.127e-118
Identity = 194/357 (54.34%), Postives = 253/357 (70.87%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++ P      K T        KDGK+  ++   +RKL +I+GV TGGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++    TN
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWSLKKT--------KDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTN 488          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q9Y463|DYR1B_HUMAN (Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Homo sapiens OX=9606 GN=DYRK1B PE=1 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 5.080e-124
Identity = 231/498 (46.39%), Postives = 298/498 (59.84%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNPILPNTSSKTAVPSLLST 2361
            L KLSVDLIKTYK+INE+Y              + KK R+                       A Q    D SN+  KK     L H                             D   ++Y+++ GE W  +Y I+ LIG GSFGQVV+A D ++ E VAIKIIKNK+ F+ QA IE+ LL+ +   Q + E+       YIV LK  F  R HLCLVFELL+Y LY+LL+NT+FRGVSLNLTRK AQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L   Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ RI+EV+G+PP+ M+D   K+ +YF+R P             L R K+ +K  +QG  +R+L +++GV TGGP GRR  EPGHS  DY +F DL+ +M+  +P  RI P  AL+H FF R+    TN   P  SS +  P+ L T
Sbjct:   45 LRKLSVDLIKTYKHINEVY--------------YAKKKRR-----------------------AQQAPPQDSSNKKEKK----VLNHG---------------------------YDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMN--QHDTEMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGW--------TLRRTKELRK-DYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATN-TGPAGSSASTSPAPLDT 457          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q9Z188|DYR1B_MOUSE (Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Mus musculus OX=10090 GN=Dyrk1b PE=1 SV=3)

HSP 1 Score: 382.874 bits (982), Expect = 1.755e-120
Identity = 201/378 (53.17%), Postives = 264/378 (69.84%), Query Frame = 1
Query: 1228 YEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNPILPNTSSKTAVPSLLST 2361
            ++Y+++ GE W  +Y I+ LIG GSFGQVV+A D ++ E VAIKIIKNK+ F+ QA IE+ LL+ +   Q + E+       YIV LK  F  R HLCLVFELL+Y LY+LL+NT+FRGVSLNLTRK AQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L   Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ RI+EV+G+PP+ M++   K+ +YF+R P             L R K+ +K  +QG  +R+L +++GV TGGP GRR  EPGHS  DY +F DL+ +M+  +P  RI P  AL+H FF R+    TN   P  SS +  P+ L T
Sbjct:   97 HDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMN--QHDTEMKY-----YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMSRIVEVLGIPPAPMLEQAPKARKYFERLPGGGW--------TLRRTKELRK-DYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATN-TGPAGSSASTSPAPLDT 457          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|P49657|MNB_DROME (Serine/threonine-protein kinase minibrain OS=Drosophila melanogaster OX=7227 GN=mnb PE=1 SV=2)

HSP 1 Score: 389.423 bits (999), Expect = 7.637e-120
Identity = 230/480 (47.92%), Postives = 296/480 (61.67%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            L KLSVDLIKTYK+INE+Y              + KK R+                       A QT+  D S+  NKK      L++D                           D   ++Y+IK GE +  +Y I+ LIG GSFGQVV+A D +    VAIKIIKNK+ F+ QA IE+ LL+ + +       A      YIVKLK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FLS P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY+YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+GMPP  ++D   K+ ++FD+  +            L + ++G+K  ++   SRKL DI+GV TGGP GRRL+EPGHS  DY KF DL+ +M+  DPK R+ P  AL+H FF R+    TN
Sbjct:   97 LRKLSVDLIKTYKHINEVY--------------YAKKKRR-----------------------AQQTQGDDDSS--NKK---ERKLYND-------------------------GYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNR-------ADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYV-------LKKNQNGRK--YKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKRTADEATN 493          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q13627|DYR1A_HUMAN (Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2)

HSP 1 Score: 379.022 bits (972), Expect = 1.830e-117
Identity = 194/357 (54.34%), Postives = 253/357 (70.87%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++ P      K T        KDGK+  ++   +RKL +I+GV TGGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++    TN
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKT--------KDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTN 488          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Match: sp|Q63470|DYR1A_RAT (Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Rattus norvegicus OX=10116 GN=Dyrk1a PE=1 SV=2)

HSP 1 Score: 379.022 bits (972), Expect = 1.970e-117
Identity = 194/357 (54.34%), Postives = 253/357 (70.87%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++ P      K T        KDGK+  ++   +RKL +I+GV TGGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++    TN
Sbjct:  148 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWSLKKT--------KDGKR-EYKPPGTRKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTN 488          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A5J4NG04 (Dual specificity tyrosine-phosphorylation-regulated kinase 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0004529 PE=4 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 5.073e-141
Identity = 228/424 (53.77%), Postives = 302/424 (71.23%), Query Frame = 1
Query: 1081 PSNEINKKFGC--ATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPS-------------TNLQTKYT-----YRPK--LHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIR 2286
            P++    + GC  A L  S      P    +S NVP   V+T+  + +   +   ++ G++W  +Y I  LIG G+FGQVVRA D  +GE VAIK+IKNKR+F++QA +EI LL+E+  FQ N+++A E GANYIV LK+ FNH GHLCLVFELL+Y LY+LL NTN+RGVSLNLTRKFAQQ+C ALVFLS+P VQ+IHCDLKPENILL++P+RSAIKVVDFGSSCH + ++Y YIQSRFYRSPE++LNLDY   IDMWSLGCI+ E+HTG+PLF G  E EQ+L+IIEV+G PP +M+++  K   +F+  PS             T+L    T     ++PK   H++    +  F G+ +R L  ++G  TGGPQGRRL EPGH+  DYEKF+DL+Q+M+V +P++RI+P+EAL H FF+R
Sbjct:  498 PNSSTTIRSGCLVAPLPMSTNSSCCPHGSQIS-NVPVGTVSTANGTVNPYFHHGFVRTGDVWHDRYKILALIGKGTFGQVVRALDEHTGEEVAIKVIKNKRSFLQQAEVEIKLLREMSAFQVNEQVAVEVGANYIVNLKAHFNHHGHLCLVFELLSYNLYDLLVNTNYRGVSLNLTRKFAQQLCAALVFLSRPDVQVIHCDLKPENILLVNPKRSAIKVVDFGSSCHVSEKVYQYIQSRFYRSPEVLLNLDYGLGIDMWSLGCILVEMHTGEPLFSGSNELEQLLQIIEVLGCPPVSMVETSPKLSTFFETIPSYPGTASQPTQSNQTDLLLPATSGLSWFKPKRIWHKQDWTHECTFLGVGARPLRSVVGADTGGPQGRRLGEPGHTPEDYEKFVDLVQRMLVYEPRQRIRPEEALAHRFFVR 920          

HSP 2 Score: 65.0846 bits (157), Expect = 9.040e-7
Identity = 76/260 (29.23%), Postives = 117/260 (45.00%), Query Frame = 1
Query:  277 VYGHLVTADQLNQIEKRKGVLGLHST--DSASKTIFSAINTGIEISSDNFIYANLANTNEPMDITNISSEVQMASPNHHSGSLSSII-STYAS--PKFEKKSEDDVGGSYYHYP------DFSYCQGNLGIDKLYVNTFVSNAQQNLIRSHNISTS---LTSSKALTEKQSNFAGNLNFPKSDSSI---DKTLTSLPMET---GAIK--LDPRCSNPHILIKLSVDLIKTYKNINEIYYRKKRRLKE-PTDDNFLKKDRK 987
            +YG LVTADQL+Q+E+++          + ASK + S +   + +              +P D + +   +        S S+  I  S YA+  P +  K + +      H P       FS+  G+   D      + +N    +     +  S   +     LT  Q+NF    + P +D+      KT+  +   T   GAI+     R      L+K+SV+LI+TYKNINE YYRKKRRL+E  T+DN  K+DRK
Sbjct:  107 IYGQLVTADQLSQLEQQQNTATCDDLKGEDASKLLISLVKKRLSMC-------------KPEDESKVVDSIST------SASVYGITQSAYANLDPSYTAKRDLN------HQPMDVIADSFSFPTGSHPTD------YATNQSTAMDVGGYVEASSYVVPGRSVLTSPQANFP--CSPPPTDAPTCTRGKTVGDVKPTTVAGGAIQSVYTLREHEQRPLMKMSVNLIRTYKNINEAYYRKKRRLRELATEDNSQKRDRK 333          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A4E0R639 (Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Fasciola hepatica OX=6192 GN=D915_005203 PE=4 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 6.071e-134
Identity = 220/396 (55.56%), Postives = 280/396 (70.71%), Query Frame = 1
Query: 1225 GYEY--LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFP------------STNLQTKYT--------------------------YRPK-LHREKDGK-KIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIR 2286
            GY +  L++ G+IW+ +Y I  LIG G+FGQVVRA D  +GE VAIK+IKNKR+F++QA IEI LL+E+  FQ ND++A E GANYIV LK+ F+H GHLCLVFELL+Y LY+LL NTN+RGVSLNLTRKFAQQ+C ALVFLS+P VQ+IHCDLKPENILL++P+RSAIKV+DFGSSCH + ++Y YIQSRFYRSPE++ NLDY   IDMWSLGCI+ E+HTG+PLF G  E EQ+L+IIEV+G PP  MI+S  K   +F+  P            S  L + Y                           Y+ K L ++ DG  +  F G+ +R L  ++G  TGGP GRR +EPGH   DY+KF+DL+Q+M+V DP+ RI+P+EAL H FFIR
Sbjct:  642 GYAHHGLVRIGDIWQDRYKILALIGKGTFGQVVRALDQMTGEEVAIKVIKNKRSFLQQAEIEIKLLREMAMFQVNDQMAAEVGANYIVNLKAHFSHHGHLCLVFELLSYNLYDLLGNTNYRGVSLNLTRKFAQQLCAALVFLSRPDVQVIHCDLKPENILLVNPKRSAIKVIDFGSSCHVSEKVYQYIQSRFYRSPEVLFNLDYGLGIDMWSLGCILVEMHTGEPLFSGSNELEQVLQIIEVLGFPPVHMIESSPKLSTFFEMIPVGSGNSSTASSGSNTLSSDYVQSQPTHYSSVECGANSVLRSANGHICYKLKRLWKKNDGTYECNFAGVEARPLRAVVGADTGGPHGRRKDEPGHGPEDYDKFIDLVQRMLVYDPRHRIRPEEALAHRFFIR 1037          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: G7YBA5 (Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Clonorchis sinensis OX=79923 GN=CLF_104273 PE=4 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 4.049e-133
Identity = 220/420 (52.38%), Postives = 293/420 (69.76%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPS-----------------------TNLQTKYT-------------------YRPK-LHREKDGK-KIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNPILPNTSSKTAVPSLLSTS 2364
             ++ G++W+ +Y I  LIG G+FGQVVRA D +SGE VAIK+IKNKR+F++QA +EI LL E+  FQ N+++A E GANYIV LK+ F + GHLCLVFELL+Y LY+LL NTN+RGVSLNLTRKFAQQ+C ALVFLS+P VQ+IHCDLKPENILL++P+RSAIKV+DFGSSCH + ++Y YIQSRFYR PE++LNLDY   IDMWSLGCI+ E+HTG+PLF G  E EQIL+IIEV+G PP  M+++  K   +F+   S                       +N ++++T                   YRPK + ++ D   +  F G+ +R L  ++G  TGGPQGRR  EPGHS  DYEKF+DL+Q+M+V DP +RI+P+EAL H FF+R     +N  L +T++ + VP+  +T+
Sbjct:  596 FVRIGDVWQDRYKILALIGKGTFGQVVRALDQESGEEVAIKVIKNKRSFLQQAGVEIKLLCEMAAFQSNEQLATEVGANYIVNLKAHFTYHGHLCLVFELLSYNLYDLLVNTNYRGVSLNLTRKFAQQLCAALVFLSRPDVQVIHCDLKPENILLVNPKRSAIKVIDFGSSCHVSEKVYQYIQSRFYRCPEVLLNLDYGLGIDMWSLGCILVEMHTGEPLFSGSNELEQILQIIEVLGFPPVHMVEASPKLSVFFETLCSPTPPVSATNSTAMPASSSACLSPSNTRSQFTGESTAASSGLLPSSCESSWYRPKRIWKKNDWTYECNFLGVGARPLRTVLGADTGGPQGRRRGEPGHSPEDYEKFVDLVQRMLVFDPSQRIRPEEALAHRFFMRKDEGQSNAYLVSTTT-SIVPTAAATT 1014          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A504YAM6 (Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Fasciola gigantica OX=46835 GN=FGIG_02085 PE=4 SV=1)

HSP 1 Score: 437.573 bits (1124), Expect = 4.722e-133
Identity = 221/407 (54.30%), Postives = 286/407 (70.27%), Query Frame = 1
Query: 1192 VNTSISSKDVGGYEY--LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFP-----------------STNLQTKYTYRP----------------------KLHREKDGK-KIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIR 2286
            V+T+  S    GY +  L++ G+IW+ +Y I  LIG G+FGQVVRA D  +GE VAIK+IKNKR+F++QA IEI LL+E+  FQ ND++A E GANYIV LK+ F++ GHLCLVFELL+Y LY+LL NTN+RGVSLNLTRKFAQQ+C ALVFLS+P VQ+IHCDLKPENILL++P+RSAIKV+DFGSSCH + ++Y YIQSRFYRSPE++ NLDY   IDMWSLGCI+ E+HTG+PLF G  E EQ+L+IIEV+G PP  MI+S  K   +F+  P                 S  +Q++ T+                        +L ++ DG  +  F G+ +R L  ++G  TGGP GRR +EPGH   DYEKF+DL+Q+M+V DP+ RI+P+EAL H FFIR
Sbjct:  630 VSTAAVSIASTGYAHHGLVRIGDIWQDRYKILALIGKGTFGQVVRALDQMTGEEVAIKVIKNKRSFLQQAEIEIKLLREMAMFQVNDQMAAEVGANYIVNLKAHFSYHGHLCLVFELLSYNLYDLLGNTNYRGVSLNLTRKFAQQLCAALVFLSRPDVQVIHCDLKPENILLVNPKRSAIKVIDFGSSCHVSEKVYQYIQSRFYRSPEVLFNLDYGLGIDMWSLGCILVEMHTGEPLFSGSNELEQVLQIIEVLGFPPVHMIESSPKLSTFFEMIPMGSSNSSTASSGSNTLSSDYVQSQPTHYSSVECSANSVLRSANGHICYKLKRLWKKNDGTYECNFAGVEARPLRAVVGADTGGPHGRRKDEPGHGPEDYEKFIDLVQRMLVYDPRHRIRPEEALAHRFFIR 1036          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Match: A0A4S2LKG7 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007957 PE=4 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 1.560e-132
Identity = 221/423 (52.25%), Postives = 292/423 (69.03%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPS-----------------------TNLQTKYT-------------------YRPK-LHREKDGK-KIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNPILPNTSSKTAVPSLLSTSCDK 2373
             ++ G++W+ +Y I  LIG G+FGQVVRA D +SGE VAIK+IKNKR+F++QA +EI LL E+  FQ N+++A E GANYIV LK+ F + GHLCLVFELL+Y LY+LL NTN+RGVSLNLTRKFAQQ+C ALVFLS+P VQ+IHCDLKPENILL++P+RSAIKV+DFGSSCH + ++Y YIQSRFYR PE++LNLDY   IDMWSLGCI+ E+HTG+PLF G  E EQIL+IIEV+G PP  M+++  K   +F+   S                       +N +++ T                   YRPK + ++ D   +  F G+ +R L  ++G  TGGPQGRR  EPGHS  DYEKF+DL+Q+M+V DP +RI+P+EAL H FF+R     +N  L +T++ + VP+  +T   K
Sbjct:  529 FVRIGDVWQDRYKILALIGKGTFGQVVRALDQESGEEVAIKVIKNKRSFLQQAGVEIKLLCEMAAFQSNEQLATEVGANYIVNLKAHFTYHGHLCLVFELLSYNLYDLLVNTNYRGVSLNLTRKFAQQLCAALVFLSRPDVQVIHCDLKPENILLVNPKRSAIKVIDFGSSCHVSEKVYQYIQSRFYRCPEVLLNLDYGLGIDMWSLGCILVEMHTGEPLFSGSNELEQILQIIEVLGFPPVHMVEASPKLSVFFETLCSPTPPVAATNTTVMPTSSSACLSPSNTRSQSTGESTAASSGLLPSSCESSWYRPKRIWKKNDWTYECNFLGVGARPLRTVLGADTGGPQGRRRGEPGHSPEDYEKFVDLVQRMLVFDPSQRIRPEEALAHRFFMRKDEGQSNAHLVSTTT-SIVPTAAATVTSK 950          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk1ab (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, b [Source:ZFIN;Acc:ZDB-GENE-030131-5677])

HSP 1 Score: 364.77 bits (935), Expect = 4.261e-113
Identity = 224/516 (43.41%), Postives = 306/516 (59.30%), Query Frame = 1
Query:  787 SIDKTLTSLPM--ETGAIKLD---------PRC-SNPHI--LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST 2292
            S D+++T LP   +T A+  +         P+C  +P +  L KLS+DLIKTYK+INE+Y              + KK R+   G  +++                                     H  +R  + + +                  D   ++Y++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++    +   K T        KDGK+  ++  +SRKL  I+GV  GGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++ 
Sbjct:   48 STDQSVTVLPYSDQTQALTANQVMTAHRHMPQCFRDPAVAPLRKLSIDLIKTYKHINEVY--------------YAKKKRRHQQGQGEDSS------------------------------------HKKERKVVNEGY------------------DDDNFDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRAEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKLSDGSWSVKKT--------KDGKR--YKPPASRKLHAILGVEAGGPGGRRAGESGHAVADYLKFKDLVLRMLDYDPKTRIQPYYALQHSFFKKTA 478          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 363.614 bits (932), Expect = 7.877e-113
Identity = 217/475 (45.68%), Postives = 289/475 (60.84%), Query Frame = 1
Query:  868 LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST 2292
            L KLS++LIKTYK+INE+Y              + KK R+   G                       +  D SN+  +K      +++D                           D   ++Y++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PPS ++D   K+ ++F++   +    K T        KDGK+  ++   SRKL +I+GV  GGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++ 
Sbjct:   76 LRKLSIELIKTYKHINEVY--------------YAKKKRRHQQG-----------------------QGEDSSNKKERK------IYND-------------------------GYDDDNFDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRHEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGVPPSHILDQAPKARKFFEKMSDSTWCAKKT--------KDGKR--YKPAGSRKLHNILGVEAGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFFKKTA 465          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 251.136 bits (640), Expect = 3.666e-72
Identity = 145/348 (41.67%), Postives = 208/348 (59.77%), Query Frame = 1
Query: 1267 QYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNP 2310
            +Y + ++IG GSFGQV++  D K+ E VAIKII+NK+ F +QA +E+ +L  + +   +         + ++ +K +F  R HLC+ FELL   LYEL+K  NF+G SL L R+FA  + + L  L + +  IIHCDLKPENILL    +  IKVVDFGSSC+  +R+Y YIQSRFYRSPE+IL   YS AIDMWSLGCI+AEL+TG PLF G+ E EQI  I+EV+GMPP+  + +  +   +FD   +          P+      GKK   +  +S++L+ ++          + N+P         FLD +++ +V DP KR+ PDE ++H +      T   P
Sbjct:  195 RYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRD-------SCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREK--IIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGN----------PRNVTNSKGKK---RRPNSKELASVL----------KTNDP--------LFLDFIRRCLVWDPTKRMTPDEGMQHEWITEGRLTRLRP 502          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 250.751 bits (639), Expect = 4.110e-72
Identity = 145/348 (41.67%), Postives = 207/348 (59.48%), Query Frame = 1
Query: 1267 QYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNP 2310
            +Y + ++IG GSFGQV++  D K+ E VAIKII+NK+ F +QA +E+ +L  + +   +         + ++ +K +F  R HLC+ FELL   LYEL+K  NF+G SL L R+FA  + + L  L + +  IIHCDLKPENILL    +  IKVVDFGSSC+  +R+Y YIQSRFYRSPE+IL   YS AIDMWSLGCI+AEL+TG PLF G+ E EQI  I+EV+GMPP+  + +  +   +FD              P+      GKK   +  +S++L+ ++          + N+P         FLD +++ +V DP KR+ PDE ++H +      T   P
Sbjct:  198 RYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRD-------SCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREK--IIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDS----------KGNPRNVTNSKGKK---RRPNSKELASVL----------KTNDP--------LFLDFIRRCLVWDPTKRMTPDEGMQHEWITEGRLTRLRP 505          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Match: dyrk4 (dual specificity tyrosine phosphorylation regulated kinase 4 [Source:NCBI gene;Acc:103029392])

HSP 1 Score: 250.751 bits (639), Expect = 5.382e-72
Identity = 145/348 (41.67%), Postives = 208/348 (59.77%), Query Frame = 1
Query: 1267 QYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNP 2310
            +Y + ++IG GSFGQV++  D K+ E VAIKII+NK+ F +QA +E+ +L  + +   +         + ++ +K +F  R HLC+ FELL   LYEL+K  NF+G SL L R+FA  + + L  L + +  IIHCDLKPENILL    +  IKVVDFGSSC+  +R+Y YIQSRFYRSPE+IL   YS AIDMWSLGCI+AEL+TG PLF G+ E EQI  I+EV+GMPP+  + +  +   +FD   +          P+      GKK   +  +S++L+ ++          + N+P         FLD +++ +V DP KR+ PDE ++H +      T   P
Sbjct:  206 RYEVLEVIGKGSFGQVLKCLDHKTNEMVAIKIIRNKKRFHQQALVELKILDAVRRKDRD-------SCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNFQGFSLALIRRFAHSLLKCLQMLHREK--IIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEVMGMPPNDFVQTASRRRLFFDSKGN----------PRNVTNSKGKK---RRPNSKELASVL----------KTNDP--------LFLDFIRRCLVWDPTKRMTPDEGMQHEWITEGRLTRLRP 513          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: dyrk1aa (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, a [Source:ZFIN;Acc:ZDB-GENE-050302-29])

HSP 1 Score: 383.645 bits (984), Expect = 1.305e-120
Identity = 198/357 (55.46%), Postives = 255/357 (71.43%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTN 2307
            ++K GE W  +Y I+ LIG GSFGQVV+A D +  E+VAIKIIKNK+ F+ QA IE+ LL+ + K   + +        YIV LK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ M++   K+ +YF+R    +   K T        KD K+  ++   SRKL DIIGV +GGP GRR+ E GH+  DY KF DL+ +M+  DPK RI P  AL+H FF ++T   TN
Sbjct:  151 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDHQEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTDMKY-------YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGIPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGLPPTHMLEQAPKARKYFERLSDGSWTVKKT--------KDSKR-EYKTAGSRKLHDIIGVESGGPGGRRMGEAGHTVADYLKFKDLILRMLDYDPKTRITPFYALQHNFFKKTTDEGTN 491          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 240.736 bits (613), Expect = 7.773e-70
Identity = 143/337 (42.43%), Postives = 196/337 (58.16%), Query Frame = 1
Query: 1267 QYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPF 2277
            +Y + K+IG GSFGQVV+A D K+   VA+K+++N++ F  QA  EI +L+ + K    + +        I+ L   F  RGH+C+ FELL+  LYEL+K   F+G SL L RKFA  I Q L  L +   +IIHCDLKPENILL  P RS IKV+DFGSSC  ++R+Y YIQSRFYR+PE++L   Y   IDMWSLGCI+AEL TG PL  G+ E +Q+   +E++GMPP  ++  GK+S      F S+    +Y     +    DG  +   G S R           GP G R         D    LD L+  +  +P +R+ P +AL+HP+
Sbjct:  161 RYEVLKVIGKGSFGQVVKAFDHKTQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDRENSMN-------IIHLLESFTFRGHVCMTFELLSMNLYELIKKNKFQGFSLALVRKFAHSILQCLDTLHR--NRIIHCDLKPENILLKQPGRSGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVVLGARYGPPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELLGMPPQRLLAQGKRS----RNFVSSRGHPRYC---GVTEAPDGAVVLNAGRSRRGKPR-------GPPGSRELPAALRGCDDPLLLDFLRGCLEWEPSERLTPAQALRHPW 474          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 221.09 bits (562), Expect = 8.789e-63
Identity = 143/368 (38.86%), Postives = 207/368 (56.25%), Query Frame = 1
Query: 1186 SNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVV-DFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIR 2286
            S VN +    + G Y ++  P +    +Y + ++IG GSFGQVV+A D ++ ++VA+K+++N++ F  QA  EI +L+ + K  + + +      N I  L+SF N R H+C+ FELL+  LYEL+K   F+G SL + RKFA  I   L  L K   +IIHCDLKPENILL    RS IK++ DFGSSC+ ++R+Y YIQSRFYR+P       Y   IDMWSLGCI+AEL TG PL  G+ E +Q+   +E+ G PP+ +++  K++ ++F         T  T          G  +   G  +R+     G   G P  R          D   F+D L+K +  DP  R+ P +ALKHP+  R
Sbjct:  146 SGVNNNGFDDEQGSYIHV--PHDHVAYRYEVLRVIGKGSFGQVVKAYDHRTHQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKENTM------NVIHMLESF-NFRNHICMTFELLSMNLYELIKKNKFQGFSLQVVRKFAHSILLCLNALHK--NRIIHCDLKPENILLRQQGRSGIKIIIDFGSSCYEHQRVYTYIQSRFYRAP----GGRYGLPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELTGSPPARLLEQSKRARQFFSSLGHPRYCTVTTL--------PGGPVVLNGGRTRR-----GKLRGPPSSRDWTT-ALKGCDDHLFIDFLKKCLDWDPATRLTPSQALKHPWLRR 484          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: hipk2 (homeodomain interacting protein kinase 2 [Source:ZFIN;Acc:ZDB-GENE-031125-4])

HSP 1 Score: 211.46 bits (537), Expect = 8.173e-57
Identity = 131/365 (35.89%), Postives = 195/365 (53.42%), Query Frame = 1
Query: 1231 EYLIKPGEIWKSQ---YSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSA--IKVVDFGSSCHANRRIY-YYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLH------REKDGKKIAFQGISS----RKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPF 2277
            +Y +   E+ +S    Y + + +G G+FGQVV+     + E VAIKI+KN  ++  Q  +E+ +L  +     +D        N+ V+    F H+ H CLVFE+L   LY+ LK  NF  + L   R   QQ+  AL+ L    + +IH DLKPENI+L+ P R    +KV+DFGS+ H ++ +   Y+QSR+YR+PEIIL L +  AIDMWSLGC++AEL  G PL+ G  E++QI  I    G+PP  ++ +G K+ R+F R             P+ H      + K+ +K  F  +         SD+ G          L E      D  +F++LL++M+ +D  KRI P E L HPF
Sbjct:  176 DYTLVQHEVLRSMTNSYEVLEFLGRGTFGQVVKCWKRGTSEIVAIKILKNHPSYARQGQVEVGILARLSSESADDY-------NF-VRAHECFQHKSHTCLVFEMLEQNLYDFLKQNNFSPLPLKYIRPVLQQVASALMKLKS--LGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISATQGLPPEQLLSAGTKTGRFFQRETGAGYPLWRIKSPEEHEAETGIKSKEARKYMFNCLEDMGQVNPASDLEG-------SDVLAE----KADRRQFIELLRRMLTMDADKRISPLETLAHPF 519          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007962.1 (pep scaffold:Pmarinus_7.0:GL476685:157455:173154:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007962.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.088 bits (427), Expect = 4.681e-47
Identity = 117/344 (34.01%), Postives = 176/344 (51.16%), Query Frame = 1
Query: 1267 QYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYI-EISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDY------EKFLDLLQKMMVIDPKKRIKPDEALKHPF 2277
            +Y + +++G GSFG+V++  D KS EFVAIK++ N+  F E  +  EI +LK +   +E+ +I         +++   F+ RG  C+VFELL   L   LK T+ +G  L + R FA  + ++L  L    V  IH DLKP NI +       +K+ DFG SC  +   +  IQ+R YR+PE+IL+L YS   DMWSLGC +AELH+GQ LF G    +Q+  I+EV G+PP  MI+  +  L +F                     K G++ + Q       S++           RL  PG  +L        E F D ++  +  DP+ R+ P  A+ H +
Sbjct:    6 RYEVLEVLGQGSFGKVLKCLDHKSKEFVAIKVL-NRARFNESVHRREIEILKRLQTARESSKI---------IRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANV--IHGDLKPGNIGICSYEAGEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFF--------------------VKSGRRFSVQ------CSNV-----------RLKVPGSRALPLALRTTDEHFTDFIRSCLQWDPEWRLTPHGAMDHEW 300          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: YAK1 (Serine-threonine protein kinase; component of a glucose-sensing system that inhibits growth in response to glucose availability; upon nutrient deprivation Yak1p phosphorylates Pop2p to regulate mRNA deadenylation, the co-repressor Crf1p to inhibit transcription of ribosomal genes, and the stress-responsive transcription factors Hsf1p and Msn2p; nuclear localization negatively regulated by the Ras/PKA signaling pathway in the presence of glucose [Source:SGD;Acc:S000003677])

HSP 1 Score: 229.18 bits (583), Expect = 5.317e-64
Identity = 137/347 (39.48%), Postives = 208/347 (59.94%), Query Frame = 1
Query: 1267 QYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRF-PSTNLQTKYTYRPK----LHREKD-GKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSL-DYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIR 2286
            +Y +  ++G G+FGQVV+ ++L + E +A+K++K++  ++ Q+  E  +L+ +   Q+ D   +    ++ +++   F H+ HLCLVFELL+  LYELLK   F G+S+ L R F  QI  +L  L   + ++IHCDLKPENILL  P +  +K++DFGSSC   R +Y YIQSRFYR+PEIIL + YS +IDMWSLGCI+AEL  G P+F G  E+ Q+ RII+ +G PPS MID GK S ++  +  P  +  +   +R K      RE +  +K + Q    RKL DII  Y      +   E     + + E  +  L  ++ ++P +R  P +A+ HPF  +
Sbjct:  368 KYLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELLN--QKIDPTNK----HHFLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLK--ESKLIHCDLKPENILLCAPDKPELKIIDFGSSCEEARTVYTYIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMIDMGKNSGKFMKKLAPEESSSSTQKHRMKTIEEFCREYNIVEKPSKQYFKWRKLPDIIRNYRYPKSIQNSQELIDQEMQNRECLIHFLGGVLNLNPLERWTPQQAMLHPFITK 706          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 121.324 bits (303), Expect = 4.226e-30
Identity = 110/362 (30.39%), Postives = 163/362 (45.03%), Query Frame = 1
Query: 1264 SQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIK--NKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFG-SSCHANRR---------IYYYIQSRFYRSPEIILNL-DYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDS--GKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFF-IRSTPTD 2301
            SQY +  LIG G++G V  A    SG  VAIK I+  +K+ FV +   EI LL+   + +    I  +     I KL + +     L               +N+ F  +S +  + F  QI +AL   S    Q+IH D+KP N+LL       +KV DFG + C A+           +  Y+ +R+YR+PEI+L   +Y+ A+D+WS GCI+AE+ +G+PLF G+  H Q+  I+EV+G P     +    K++  Y    P          RP L  E    K            D+I                          DLL KM+  +P KRI   EAL+HP+  +   P+D
Sbjct:   11 SQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVY-----LVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALK--SIHSAQVIHRDIKPSNLLL--NSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPM---------RPPLPWETVWSKTDLN-------PDMI--------------------------DLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSD 321          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 113.235 bits (282), Expect = 5.944e-28
Identity = 97/349 (27.79%), Postives = 168/349 (48.14%), Query Frame = 1
Query: 1264 SQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIK--NKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNF----RGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYY---IQSRFYRSPEIIL-NLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFF 2280
            SQ+   + +G G++  V +  +  +G +VA+K +K  ++      A  EISL+KE+    EN           IV+L    +    L LVFE +   L + + +       RG+ LNL + F  Q+ Q L F    + +I+H DLKP+N+L+   +R  +K+ DFG +      +  +   + + +YR+P++++ +  YS +ID+WS GCI+AE+ TG+PLF G  + EQ+  I +++G P  ++  S  K  +Y     + N+Q     RP                  R L  ++  +T  P    L             +D L  ++ ++P  R+   +AL HP+F
Sbjct:    5 SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELK--HEN-----------IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCH--ENKILHRDLKPQNLLI--NKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKY-----NPNIQQ----RP-----------------PRDLRQVLQPHTKEPLDGNL-------------MDFLHGLLQLNPDMRLSAKQALHHPWF 297          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: KNS1 (Protein kinase involved in negative regulation of PolIII transcription; effector kinase of the TOR signaling pathway and phosphorylates Rpc53p to regulate ribosome and tRNA biosynthesis; member of the LAMMER family of protein kinases, which are serine/threonine kinases also capable of phosphorylating tyrosine residues; capable of autophosphorylation [Source:SGD;Acc:S000003942])

HSP 1 Score: 110.538 bits (275), Expect = 2.530e-25
Identity = 111/443 (25.06%), Postives = 190/443 (42.89%), Query Frame = 1
Query: 1234 YLIKPGEIWKS--QYSIEKLIGTGSFGQVVRAKDLK-SGEFVAIKIIKNKRNFVEQAYIEISLLKEI------GKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHP------------------RRSA------------IKVVDFGSSCHANRRIYYY------IQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMP-PSTMIDS----------------GKKSLRYFDR------FPSTNLQ----TKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGP----------------QGRRLNEPGHSSLDYEKFL------DLLQKMMVIDPKKRIKPDEALKHPFF 2280
            Y+ +  +I+ S  ++ ++ L+G G+FG+V++  D K    +VA+K+I+    + E A  E+ +L+ I      G+FQ              + L+  F+++ H+CLV +L   ++Y+ + +        +  +  A+Q+ +++ FL    + IIH DLKPENIL+                     RR A            IK++DFGS+      I++Y      I +R YR+PEI+L L +S   D+WS+ C++ EL  G+ L+      E +  +  + G P P+ +ID                     +++FDR      +P  N +    T      ++ +  D   I    +  +   D + +    P                Q    +      LD E FL      DLL+KM   DP KRI   +AL H +F
Sbjct:  299 YVYQENDIFGSGGRFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELRILQTILNNDPQGQFQ-------------CLLLRECFDYKNHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAIARQLIRSVCFLH--DLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRREASKGKRKILKNPEIKIIDFGSA------IFHYEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIGESLYPIHENLEHMAMMQRINGTPFPTDIIDKMFYKSKHKLGNSPSDLNSTVIKHFDRKTLSLQWPEKNKRGDTITTEKSMKRVLQSCDRLDIYISKVLKQDYGDSLSINWNLPPEKNWSLINSKLAWKRQTHSSSSSTTDELDKETFLFWYWFIDLLRKMFEFDPTKRITAKDALDHEWF 720          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 105.145 bits (261), Expect = 2.364e-24
Identity = 95/336 (28.27%), Postives = 152/336 (45.24%), Query Frame = 1
Query: 1288 IGTGSFGQVVRAKDLKSGEFVAIKIIKNKRN---FVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLD-YSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDS--GKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPF 2277
            +G G+FG V  A D  + + VAIK I    +     ++ Y E+ LLK +    EN           ++ L+  F     L  ++ +      +L +    R +     + F  QI + L ++    V  IH DLKP NIL+       +K+ DFG +   + ++  Y+ +R+YR+PEI+L    Y   +D+WS GCI AE+  G+PLF G+    Q   I +++G PP  +I++   + +L++    P              HR+     I F    S +   +              EP          +DLL+KM+V DPKKRI   +AL HP+
Sbjct:   29 VGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLR--HEN-----------LICLQDIF--LSPLEDIYFVTELQGTDLHRLLQTRPLEKQFVQYFLYQILRGLKYVHSAGV--IHRDLKPSNILI--NENCDLKICDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSLP--------------HRD----PIPF----SERFKTV--------------EPDA--------VDLLEKMLVFDPKKRITAADALAHPY 301          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO45187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC8])

HSP 1 Score: 383.259 bits (983), Expect = 1.711e-124
Identity = 206/379 (54.35%), Postives = 262/379 (69.13%), Query Frame = 1
Query: 1216 DVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTDTNPILPNTSSKTAVPSL 2352
            D   Y+Y++K GE W  +Y IE LIG GSFGQV +A D +  E +A+KIIKNK+ F+ QA IE+ LL+ + K   ND      G  YIV+LK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL  P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y+ AIDMWSLGCI+ E+HTG+PLF G  E +Q+++I+EV+GMPP  ++D+  K+ ++FDR P  + Q          + KDG K  +    SRKL DI+G  TGGP GRRL E GH+  DY KF DL+ +M+  D K RI P  AL H FF ++    TN     T S T  P++
Sbjct:   61 DDENYDYIVKAGEKWFDRYEIESLIGKGSFGQVCKAYDHQEKEHIAVKIIKNKKPFLNQAQIEVKLLELMNK---NDPD----GKYYIVRLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLCSPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQIGQRIYQYIQSRFYRSPEVLLGIPYNLAIDMWSLGCILVEMHTGEPLFSGANEFDQMMKIVEVLGMPPKDILDNAPKARKFFDRLPDGSYQCL--------KVKDGVK-EYLSPGSRKLHDILGCETGGPGGRRLGEAGHTLQDYLKFKDLILRMLDYDRKTRIVPYAALHHCFFKKTAEEGTN----TTHSATNSPAM 419          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO36294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ45])

HSP 1 Score: 228.409 bits (581), Expect = 1.299e-67
Identity = 120/246 (48.78%), Postives = 171/246 (69.51%), Query Frame = 1
Query: 1267 QYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFD 2004
            +Y + +++G GSFGQVV+A D K+G+ VA+KII+NK+ F +QA +E+ +L  + K  +++        + ++ +   F  R HLC+ FEL+   LYEL+K  NF+G SL L R+FA  +   L  + K +  IIHCDLKPENILL    +++IKV+DFGSSC+ ++R+Y YIQSRFYRSPE+IL L YS AIDMWS GCI+AEL+TG PLF G+ E EQ+  I+EV+G+P   +I+S  +   +FD
Sbjct:   59 RYEVLEVLGKGSFGQVVKALDHKTGQHVAVKIIRNKKRFHQQALVEVKILDNLRKKDKDN-------THNLIHMIEHFYFRNHLCITFELMGMNLYELIKKNNFQGFSLALIRRFAFALLHCLKVIHKEK--IIHCDLKPENILLRQRGQTSIKVIDFGSSCYEHQRVYTYIQSRFYRSPEVILGLPYSMAIDMWSFGCILAELYTGYPLFPGENEVEQLACIMEVLGLPSPKLIESASRRRLFFD 295          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO46144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP1])

HSP 1 Score: 232.646 bits (592), Expect = 1.163e-66
Identity = 149/371 (40.16%), Postives = 211/371 (56.87%), Query Frame = 1
Query: 1234 YLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIR----STPTDTNPILPNTSSK 2334
            Y+  P +    +Y + K+IG GSFGQVV+A D K+   VA+K+++N++ F  QA  EI +L+ + K Q+ D        + I+ +   F  R H+C+ FELL+  LYEL+K   F+G SL L RKFA  I Q L  L K +  IIHCDLKPENILL    RS IKV+DFGSSC+ ++RIY YIQSRFYR+PE+IL   Y   IDMWS GCI+AEL TG PLF G+ E +Q+   +E++G  P  + ++ K++      F ++    +Y     L    DG  +A  G  SR+     G   G P  +   +      D   F+D L++ +  DP  R+ P +AL+HP+  R      P   N +   TS++
Sbjct:  155 YIHVPKDHIAYRYEVLKIIGKGSFGQVVKALDHKTNTHVALKMVRNEKRFHRQAQEEIRILEHLKK-QDKDN------THNIIHMLEHFTFRNHVCMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNR--IIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGARYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACNMELLGYIPEKLRETSKRA----KNFINSKGYPRYCTITTL---PDG-SVAVSGGRSRR-----GKTRGAPNSKTFVQ-ALKGCDDAMFIDFLKRCLEWDPSARMTPSQALRHPWLRRRALPRAPESNNNLASATSTE 502          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO49238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV4])

HSP 1 Score: 201.06 bits (510), Expect = 1.767e-57
Identity = 132/354 (37.29%), Postives = 200/354 (56.50%), Query Frame = 1
Query: 1276 IEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQ-VQIIHCDLKPENILLLHPRRSA--IKVVDFGSSCHANRRIY-YYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTN---LQTKYTYRPKLHRE-----KDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTD 2301
            + + +G G+FGQVV+     + E VAIKI+K+  ++  Q  IEIS+L ++    EN E      A   V+    F H+ H CLVFE+L   LY+ LK + F  + L   R   QQ+   LV LSK + + +IH DLKPENI+L+ P +    +KV+DFGS+ H ++ +   Y+QSR+YR+PE+IL L +  +IDMWSLGC++AEL  G PL+ G  E +QI  II+  G+P   ++++  K+ R+F +  +T+   L+ K     +  RE     K+ +K  F  +      ++    TG       NE     +D  +F+ LL++M+ ID +KRI P+EAL H F   S   D
Sbjct:    1 VLEFLGRGTFGQVVKCWKKGTNELVAIKILKDHPSYARQGQIEISILAKLSA--ENSE------AYNFVRAIECFQHKNHTCLVFEMLQQNLYDYLKQSKFNPLPLKHIRPIVQQV---LVALSKLRTLGLIHADLKPENIMLVDPDKQPFRVKVIDFGSATHVSKVVCSTYLQSRYYRAPEVILGLPFCESIDMWSLGCVIAELFLGWPLYPGSSEFDQIRYIIQTQGLPYDHLLNNATKTSRFFKKAINTHTGVLEWKLKNANEHERETKIPSKEARKYIFNSLDDIAQVNLSSSLTG-------NERIAEKIDRYEFVSLLKRMLTIDQEKRITPEEALSHQFVTLSHLVD 336          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Match: EDO33758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR83])

HSP 1 Score: 176.792 bits (447), Expect = 6.752e-48
Identity = 115/383 (30.03%), Postives = 197/383 (51.44%), Query Frame = 1
Query: 1183 HSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLL-----------------HPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFF 2280
            H+      +S+D      +   G+   S+Y +  L+G G+FG+V+   D K+G+ VA+K+IKN   + E A +EI +L++I   Q+N      +G +  +K+  +FNH GH+CLVFE +  ++++ +K+ N+    L+  R  + Q+  A+ FL   ++++ H DLKPEN+L +                 + + S ++++DFGS+   +      + +R YR+PE+IL L +S+  D+WS+GCIM EL+TG  LF      E +  +  ++G  PS   D  KKS +           TKY Y+ KL  ++      +   + + L   +       +G +L            F +LL  ++  DP+KRI   EA++HPFF
Sbjct:   96 HAEERCYSTSRDDEDGHLIYHKGDQLHSRYEVHCLLGEGTFGKVLECYDKKTGDVVAVKVIKNIEKYREAAKLEIKVLEKIN--QKN-----RYGKSLCIKMLDWFNHHGHMCLVFEKMGLSVFDFMKDNNYEPYPLDQVRHISYQLIVAVKFLH--EMKLTHTDLKPENMLFVNSDCDVFYNKDTKQDQRYVKSSHMRLIDFGSATFEHEHHSTTVSTRHYRAPEVILELGWSYPCDIWSIGCIMFELYTGFTLFQTHENREHLAMMERIIGPIPS---DFAKKSRK-----------TKYFYKGKLEWDEKSSSGKYVRENCKPLKKYM---LSDSEGHQL------------FFNLLDYLLEYDPEKRITAKEAMQHPFF 440          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1ab (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:NCBI gene;Acc:101169628])

HSP 1 Score: 370.163 bits (949), Expect = 1.310e-115
Identity = 192/352 (54.55%), Postives = 250/352 (71.02%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST 2292
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++        K T        KDGK+  ++  +SRKL  I+GV TGGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++ 
Sbjct:  110 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKLSDGTWSVKKT--------KDGKR--YKPPASRKLHSILGVETGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFFKKTA 444          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1ab (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:NCBI gene;Acc:101169628])

HSP 1 Score: 370.933 bits (951), Expect = 1.505e-115
Identity = 192/352 (54.55%), Postives = 250/352 (71.02%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST 2292
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++        K T        KDGK+  ++  +SRKL  I+GV TGGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++ 
Sbjct:  139 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKLSDGTWSVKKT--------KDGKR--YKPPASRKLHSILGVETGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFFKKTA 473          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1ab (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:NCBI gene;Acc:101169628])

HSP 1 Score: 370.933 bits (951), Expect = 1.505e-115
Identity = 192/352 (54.55%), Postives = 250/352 (71.02%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST 2292
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++        K T        KDGK+  ++  +SRKL  I+GV TGGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++ 
Sbjct:  139 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKLSDGTWSVKKT--------KDGKR--YKPPASRKLHSILGVETGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFFKKTA 473          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1ab (dual specificity tyrosine phosphorylation regulated kinase 1A [Source:NCBI gene;Acc:101169628])

HSP 1 Score: 370.933 bits (951), Expect = 1.630e-115
Identity = 192/352 (54.55%), Postives = 250/352 (71.02%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRST 2292
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFE+L+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PP+ ++D   K+ ++F++        K T        KDGK+  ++  +SRKL  I+GV TGGP GRR  E GH+  DY KF DL+ +M+  DPK RI+P  AL+H FF ++ 
Sbjct:  136 IVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFEMLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVDQMNKIVEVLGIPPNHIMDLAPKARKFFEKLSDGTWSVKKT--------KDGKR--YKPPASRKLHSILGVETGGPGGRRAGESGHAVADYLKFKDLILRMLDYDPKSRIQPYYALQHSFFKKTA 470          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Match: dyrk1b (dual specificity tyrosine-phosphorylation-regulated kinase 1B [Source:NCBI gene;Acc:101167568])

HSP 1 Score: 302.753 bits (774), Expect = 5.426e-92
Identity = 156/258 (60.47%), Postives = 196/258 (75.97%), Query Frame = 1
Query: 1237 LIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSG-KKSLRYFDR 2007
            ++K GE W  +Y I+ LIG GSFGQVV+A D    E+VAIKIIKNK+ F+ QA IE+ LL+ + K     +        YIV LK  F  R HLCLVFELL+Y LY+LL+NTNFRGVSLNLTRKFAQQ+C AL+FL+ P++ IIHCDLKPENILL +P+RSAIK+VDFGSSC   +RIY YIQSRFYRSPE++L + Y  AIDMWSLGCI+ E+HTG+PLF G  E +Q+ +I+EV+G+PPS M+D+  KK++R   R
Sbjct:   81 IVKNGEKWLDRYEIDSLIGKGSFGQVVKAYDHHEQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDTEMKY-------YIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNKIVEVLGVPPSHMLDAAPKKNVRLCGR 331          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000080906.1 (SMESG000080906.1)

HSP 1 Score: 1566.59 bits (4055), Expect = 0.000e+0
Identity = 787/791 (99.49%), Postives = 788/791 (99.62%), Query Frame = 1
Query:  250 HTMGVTNVPVYGHLVTADQLNQIEKRKGVLGLHSTDSASKTIFSAINTGIEISSDNFIYANLANTNEPMDITNISSEVQMASPNHHSGSLSSIISTYASPKFEKKSEDDVGGSYYHYPDFSYCQGNLGIDKLYVNTFVSNAQQNLIRSHNISTSLTSSKALTEKQSNFAGNLNFPKSDSSIDKTLTSLPMETGAIKLDPRCSNPHILIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPT-DTNPILPNTSSKTAVPSLLSTSCDKNLISMAATSKVSGNPRFAKATDSSGDKLPVNISMSTQTPQNQISGSNIACXXXXXXXXXXXXXXXHQESTYLSLATITTTAN 2619
            HTMGVTNVPVYGHLVTADQLNQIEKRKGVLGLHSTDSASKTIFSAINTGIEISSDNFIYANLANTNEPMDITNISSEVQMASPNHHSGSLSSIISTYASPKFEKKSEDDVGGSYYHYPDFSYCQGNLGIDKLYVNTFVSNAQQNLIRSHNISTSLTSSK LTEKQSNFAGNLNFPKSDSSIDKTLTSLPMETGAIKLDPRCSNPHILIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFELLTYTLYELLKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPP+TMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPT DTNPILPNTSSKTAVPSLLSTSCDKNLISMAATSKVSGNPRFAKATDSSGDKLPVNISMSTQTPQNQISGSNIACDSSNLLD SASASLSHQESTYLSLATITTTAN
Sbjct:   11 HTMGVTNVPVYGHLVTADQLNQIEKRKGVLGLHSTDSASKTIFSAINTGIEISSDNFIYANLANTNEPMDITNISSEVQMASPNHHSGSLSSIISTYASPKFEKKSEDDVGGSYYHYPDFSYCQGNLGIDKLYVNTFVSNAQQNLIRSHNISTSLTSSKTLTEKQSNFAGNLNFPKSDSSIDKTLTSLPMETGAIKLDPRCSNPHILIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFELLTYTLYELLKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPNTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTSDTNPILPNTSSKTAVPSLLSTSCDKNLISMAATSKVSGNPRFAKATDSSGDKLPVNISMSTQTPQNQISGSNIACDSSNLLDPSASASLSHQESTYLSLATITTTAN 801          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000080906.1 (SMESG000080906.1)

HSP 1 Score: 1562.74 bits (4045), Expect = 0.000e+0
Identity = 785/789 (99.49%), Postives = 786/789 (99.62%), Query Frame = 1
Query:  256 MGVTNVPVYGHLVTADQLNQIEKRKGVLGLHSTDSASKTIFSAINTGIEISSDNFIYANLANTNEPMDITNISSEVQMASPNHHSGSLSSIISTYASPKFEKKSEDDVGGSYYHYPDFSYCQGNLGIDKLYVNTFVSNAQQNLIRSHNISTSLTSSKALTEKQSNFAGNLNFPKSDSSIDKTLTSLPMETGAIKLDPRCSNPHILIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPT-DTNPILPNTSSKTAVPSLLSTSCDKNLISMAATSKVSGNPRFAKATDSSGDKLPVNISMSTQTPQNQISGSNIACXXXXXXXXXXXXXXXHQESTYLSLATITTTAN 2619
            MGVTNVPVYGHLVTADQLNQIEKRKGVLGLHSTDSASKTIFSAINTGIEISSDNFIYANLANTNEPMDITNISSEVQMASPNHHSGSLSSIISTYASPKFEKKSEDDVGGSYYHYPDFSYCQGNLGIDKLYVNTFVSNAQQNLIRSHNISTSLTSSK LTEKQSNFAGNLNFPKSDSSIDKTLTSLPMETGAIKLDPRCSNPHILIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFELLTYTLYELLKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPP+TMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPT DTNPILPNTSSKTAVPSLLSTSCDKNLISMAATSKVSGNPRFAKATDSSGDKLPVNISMSTQTPQNQISGSNIACDSSNLLD SASASLSHQESTYLSLATITTTAN
Sbjct:    1 MGVTNVPVYGHLVTADQLNQIEKRKGVLGLHSTDSASKTIFSAINTGIEISSDNFIYANLANTNEPMDITNISSEVQMASPNHHSGSLSSIISTYASPKFEKKSEDDVGGSYYHYPDFSYCQGNLGIDKLYVNTFVSNAQQNLIRSHNISTSLTSSKTLTEKQSNFAGNLNFPKSDSSIDKTLTSLPMETGAIKLDPRCSNPHILIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFELLTYTLYELLKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPNTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRSTPTSDTNPILPNTSSKTAVPSLLSTSCDKNLISMAATSKVSGNPRFAKATDSSGDKLPVNISMSTQTPQNQISGSNIACDSSNLLDPSASASLSHQESTYLSLATITTTAN 789          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000041146.1 (SMESG000041146.1)

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 354/720 (49.17%), Postives = 443/720 (61.53%), Query Frame = 1
Query:  211 KCEDTIRFKESQQHTMGVTNV-----------PVYGHLVTADQLNQIEKRKGVLGLHSTDSASKTIFSAINTGIEISSDNFIYANLANTNEPMDITNISSEVQMASPNHHSGSLSSIISTYASPKFEKKSEDDVGGSYYHYPDFSYCQGNLGIDKLYVNTFVSNAQQNLIRSHNISTSLTSSKALTEKQSNFAGNLNFPKSDSSIDKTLTSLPMETGAIKLDPRCSNPHI-----LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDV--GGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRS---TPTDTN 2307
            K E+T +  + + H +   NV           PVYG L+T DQ+NQ+  +   +GL S  S                     Y NL     PM  + + S     S N  S   S++                    YYHYP+F +                +N+QQNL            S     K   +A    F  S                   L   CS+P       LIKLSVDLI TYKNINE+YY+KKRR ++P DD+  KK++K+ +  +  +D                T     S  I+  +  A   H        QN      +P    N  +S K++  G YEY IKPGEIWKS+Y IE+LIGTGSFGQVV+A+D+ + E VAIKIIKNK+NFVEQA  EI+LL E+ K+Q  DE+AQEWG+NYIVKLK+ F H GHLCLVFELLTY LY+LLKNTNF+GVSLNLTRKF  QIC+AL FLSKPQ+QIIHCDLKPENILL+HPRRSAIKVVDFGSSC  + RIY YIQSRFYRSPEIILN++YS AID+WSLGCI+ ELHTGQPLFIGQFEHEQILRI+E++GMPPS M+ +GKK+ +YF++   T+     +Y+PK++R++D KKI+F+G+SSR L DI+GVYTGGP GRR +E GHSS DYEKFLDL+QKM+V+DP+ RIKP+ ALKHPFFIR+   + +DTN
Sbjct:    9 KEENTTKLNQLKAHQLQKQNVFPHRTEAKKSGPVYGQLLTEDQVNQLNNQN--IGLDSKTSG--------------------YVNL-----PM--SQVGSVKTSCSSNETSKRQSAV-------------------PYYHYPEFPF----------------TNSQQNL-----------KSNPQCNKNKVYANTSQFNIS------------------PLSNNCSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSD----------------TSEKSSSKNIHHNYQNAGHHHHHHHHHYHQN---KPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAIKIIKNKKNFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTD--GAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTN 614          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000041146.1 (SMESG000041146.1)

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 354/720 (49.17%), Postives = 443/720 (61.53%), Query Frame = 1
Query:  211 KCEDTIRFKESQQHTMGVTNV-----------PVYGHLVTADQLNQIEKRKGVLGLHSTDSASKTIFSAINTGIEISSDNFIYANLANTNEPMDITNISSEVQMASPNHHSGSLSSIISTYASPKFEKKSEDDVGGSYYHYPDFSYCQGNLGIDKLYVNTFVSNAQQNLIRSHNISTSLTSSKALTEKQSNFAGNLNFPKSDSSIDKTLTSLPMETGAIKLDPRCSNPHI-----LIKLSVDLIKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKVLSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSNVNTSISSKDV--GGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFFIRS---TPTDTN 2307
            K E+T +  + + H +   NV           PVYG L+T DQ+NQ+  +   +GL S  S                     Y NL     PM  + + S     S N  S   S++                    YYHYP+F +                +N+QQNL            S     K   +A    F  S                   L   CS+P       LIKLSVDLI TYKNINE+YY+KKRR ++P DD+  KK++K+ +  +  +D                T     S  I+  +  A   H        QN      +P    N  +S K++  G YEY IKPGEIWKS+Y IE+LIGTGSFGQVV+A+D+ + E VAIKIIKNK+NFVEQA  EI+LL E+ K+Q  DE+AQEWG+NYIVKLK+ F H GHLCLVFELLTY LY+LLKNTNF+GVSLNLTRKF  QIC+AL FLSKPQ+QIIHCDLKPENILL+HPRRSAIKVVDFGSSC  + RIY YIQSRFYRSPEIILN++YS AID+WSLGCI+ ELHTGQPLFIGQFEHEQILRI+E++GMPPS M+ +GKK+ +YF++   T+     +Y+PK++R++D KKI+F+G+SSR L DI+GVYTGGP GRR +E GHSS DYEKFLDL+QKM+V+DP+ RIKP+ ALKHPFFIR+   + +DTN
Sbjct:   18 KEENTTKLNQLKAHQLQKQNVFPHRTEAKKSGPVYGQLLTEDQVNQLNNQN--IGLDSKTSG--------------------YVNL-----PM--SQVGSVKTSCSSNETSKRQSAV-------------------PYYHYPEFPF----------------TNSQQNL-----------KSNPQCNKNKVYANTSQFNIS------------------PLSNNCSSPPTNRNKPLIKLSVDLITTYKNINELYYQKKRRNRDPLDDSLNKKNKKQINTEQTLSD----------------TSEKSSSKNIHHNYQNAGHHHHHHHHHYHQN---KPPLPPPQGNAPVSMKNMIEGSYEYFIKPGEIWKSRYYIEQLIGTGSFGQVVKARDMVTQENVAIKIIKNKKNFVEQAQTEIALLMEMAKYQITDEMAQEWGSNYIVKLKTTFTHHGHLCLVFELLTYNLYDLLKNTNFKGVSLNLTRKFGSQICEALAFLSKPQLQIIHCDLKPENILLIHPRRSAIKVVDFGSSCRVSERIYCYIQSRFYRSPEIILNVEYSQAIDIWSLGCILVELHTGQPLFIGQFEHEQILRIVELMGMPPSHMLMAGKKTYKYFEQVIGTD--GAISYQPKIYRDRDNKKISFRGVSSRNLCDILGVYTGGPFGRRASELGHSSTDYEKFLDLVQKMLVLDPEYRIKPEAALKHPFFIRNLQPSNSDTN 623          
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Match: SMESG000003953.1 (SMESG000003953.1)

HSP 1 Score: 489.574 bits (1259), Expect = 5.628e-160
Identity = 264/510 (51.76%), Postives = 342/510 (67.06%), Query Frame = 1
Query:  865 ILIKLSVDLIKTYKNINEIYYRKKRR--LKEPTDDNFLKKDRKR--NSGHEDNTDLKSSNQKVLSCD--------------GAPQTKNSDPSNEIN-----------KKFGCATLLHSDQRVP---IPQNFTLSGNVPHSNVNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSGEFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQ--EWGANYIVKLKSFFNHRGHLCLVFXXXXXXXXXXXKNTNFRGVSLNLTRKFAQQICQALVFLSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSRFYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIEVVGMPPSTMIDSGKKSLRYF----DRFPSTNLQTKYTYRPKLHREKDGKKIAFQGISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKKRIKPDEALKHPFF 2280
            IL++++V LIKTY+ INE+YY KKRR   +  + D+   +D KR  N+ +  N ++   +  V  C                    K +D    I+                     +D ++    +P +        H N N+S +       EYL+KPGE+W ++YS++ LIGTGSFGQVVRA DL +GE VAIKII+N+R+FV+QA  EI LL+ + K+QE+ ++     WGAN IV+LKS F +RGHLCLVFELLTY+LYELLKNT+F GVSLNLT+KF  Q+C AL FLS+P +QIIHCDLKPEN+LL+HP+RSAIKVVDFGSSC  N R+Y YIQSRFYR+PE++L L Y+ AIDMWSLGCI+ ELHTGQPLF+GQ+EHEQILRIIEV GMPP  MI   K++ +YF     +   +      ++ PK+ R +DGK+I F+G+ +RKLS IIG  TGGP GRR +EPGHS  DY  FLDL+ +M+ IDP KRI P+EALKHPFF
Sbjct:  300 ILLRMTVSLIKTYQIINEMYYSKKRRRTTEHISSDDSFHRDTKRFLNTCNCSNNEVVQCHNDVDWCSKKRYHHHHHRHNHHHHHLQKPNDIQGNIDMPPKRRHHKHLHPHHHHHKHLNDSKIEKKHLPHDACCVPKCSHCNTNSSTAK------EYLVKPGEVWMNRYSMDLLIGTGSFGQVVRANDLITGEPVAIKIIRNRRSFVQQAETEIRLLRMLAKYQEDQDVVTVPHWGANCIVRLKSHFMYRGHLCLVFELLTYSLYELLKNTSFSGVSLNLTKKFGLQLCSALHFLSQPSLQIIHCDLKPENVLLVHPKRSAIKVVDFGSSCRLNERLYVYIQSRFYRAPEVLLYLPYNMAIDMWSLGCILVELHTGQPLFVGQYEHEQILRIIEVCGMPPDHMIRCSKRANKYFIESEIQMNESGNANHISHEPKVFRNRDGKRIPFEGVGARKLSSIIGTETGGPDGRRKDEPGHSPQDYACFLDLINRMLTIDPFKRITPEEALKHPFF 803          
The following BLAST results are available for this feature:
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYRK1B1.058e-12446.39dual specificity tyrosine phosphorylation regulate... [more]
DYRK1B1.058e-12446.39dual specificity tyrosine phosphorylation regulate... [more]
DYRK1B1.058e-12446.39dual specificity tyrosine phosphorylation regulate... [more]
DYRK1B1.058e-12446.39dual specificity tyrosine phosphorylation regulate... [more]
DYRK1A6.902e-12054.62dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbk-11.015e-11645.93Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-21.207e-6840.11Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-21.207e-6840.11Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-21.207e-6840.11Dual specificity tyrosine-phosphorylation-regulate... [more]
mbk-21.398e-6840.11Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mnb1.307e-12347.92gene:FBgn0259168 transcript:FBtr0300509[more]
mnb1.727e-12347.92gene:FBgn0259168 transcript:FBtr0299619[more]
mnb8.708e-12247.71gene:FBgn0259168 transcript:FBtr0342786[more]
mnb7.619e-12147.92gene:FBgn0259168 transcript:FBtr0300508[more]
mnb1.920e-11947.08gene:FBgn0259168 transcript:FBtr0300510[more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk1b5.620e-11855.10dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1ab7.265e-11854.65dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1ab1.284e-11754.65dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1b3.811e-11755.46dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1aa3.391e-11345.68dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdf73.352e-12055.43growth differentiation factor 7 [Source:Xenbase;Ac... [more]
gdf75.645e-12055.43growth differentiation factor 7 [Source:Xenbase;Ac... [more]
gdf77.819e-12055.43growth differentiation factor 7 [Source:Xenbase;Ac... [more]
gdf73.519e-11955.43growth differentiation factor 7 [Source:Xenbase;Ac... [more]
osbpl81.225e-11154.34oxysterol binding protein like 8 [Source:Xenbase;A... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dyrk1b2.508e-12153.17dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1b6.986e-12153.17dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1a1.386e-11854.34dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1a3.127e-11854.34dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
Dyrk1a3.127e-11854.34dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y463|DYR1B_HUMAN5.080e-12446.39Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q9Z188|DYR1B_MOUSE1.755e-12053.17Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|P49657|MNB_DROME7.637e-12047.92Serine/threonine-protein kinase minibrain OS=Droso... [more]
sp|Q13627|DYR1A_HUMAN1.830e-11754.34Dual specificity tyrosine-phosphorylation-regulate... [more]
sp|Q63470|DYR1A_RAT1.970e-11754.34Dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NG045.073e-14153.77Dual specificity tyrosine-phosphorylation-regulate... [more]
A0A4E0R6396.071e-13455.56Dual specificity tyrosine-phosphorylation-regulate... [more]
G7YBA54.049e-13352.38Dual specificity tyrosine-phosphorylation-regulate... [more]
A0A504YAM64.722e-13354.30Dual specificity tyrosine-phosphorylation-regulate... [more]
A0A4S2LKG71.560e-13252.25Protein kinase domain-containing protein OS=Opisth... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk1ab4.261e-11343.41dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk1aa7.877e-11345.68dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk43.666e-7241.67dual specificity tyrosine phosphorylation regulate... [more]
dyrk44.110e-7241.67dual specificity tyrosine phosphorylation regulate... [more]
dyrk45.382e-7241.67dual specificity tyrosine phosphorylation regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk1aa1.305e-12055.46dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk27.773e-7042.43dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
dyrk28.789e-6338.86dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
hipk28.173e-5735.89homeodomain interacting protein kinase 2 [Source:Z... [more]
ENSPMAT00000007962.14.681e-4734.01pep scaffold:Pmarinus_7.0:GL476685:157455:173154:-... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YAK15.317e-6439.48Serine-threonine protein kinase; component of a gl... [more]
KSS14.226e-3030.39Mitogen-activated protein kinase (MAPK); involved ... [more]
PHO855.944e-2827.79Cyclin-dependent kinase; has ten cyclin partners; ... [more]
KNS12.530e-2525.06Protein kinase involved in negative regulation of ... [more]
HOG12.364e-2428.27Mitogen-activated protein kinase involved in osmor... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451871.711e-12454.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362941.299e-6748.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461441.163e-6640.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492381.767e-5737.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337586.752e-4830.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyrk1ab1.310e-11554.55dual specificity tyrosine phosphorylation regulate... [more]
dyrk1ab1.505e-11554.55dual specificity tyrosine phosphorylation regulate... [more]
dyrk1ab1.505e-11554.55dual specificity tyrosine phosphorylation regulate... [more]
dyrk1ab1.630e-11554.55dual specificity tyrosine phosphorylation regulate... [more]
dyrk1b5.426e-9260.47dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Dual specificity tyrosine-phosphorylation-regulated kinase 1A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080906.10.000e+099.49SMESG000080906.1[more]
SMESG000080906.10.000e+099.49SMESG000080906.1[more]
SMESG000041146.10.000e+049.17SMESG000041146.1[more]
SMESG000041146.10.000e+049.17SMESG000041146.1[more]
SMESG000003953.15.628e-16051.76SMESG000003953.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031373 ID=SMED30031373|Name=Dual specificity tyrosine-phosphorylation-regulated kinase 1A|organism=Schmidtea mediterranea sexual|type=transcript|length=2714bp
TCTATATAAATCTTATATGAGTGAGAAATAATTGACGCGATATGAGGATT
TTTGATTCAATATTACACTGTTTTTAATTGTAATTTTCTCCTAAAATGAA
GAAGCCTAATCATGAAAAATTGTTTATTTTAATTTTTAAAAATGAGTCAT
TTGAATATTTCAAATAAAGTTGATGGATCTAAAATGCAACATACAGATTT
ATCGAAAACTAAATGTGAAGACACAATAAGATTCAAAGAAAGTCAACAAC
ACACCATGGGTGTAACTAATGTGCCTGTTTACGGGCATTTAGTCACAGCT
GATCAATTGAATCAAATTGAAAAACGTAAAGGTGTCTTAGGTTTACATTC
AACCGATTCGGCTTCAAAAACCATATTTTCCGCTATCAACACCGGAATCG
AAATATCATCAGATAATTTCATCTATGCTAATCTTGCAAACACAAATGAG
CCGATGGATATTACAAATATCTCTTCTGAAGTGCAAATGGCTTCTCCTAA
TCATCATTCTGGTTCTTTATCCTCAATAATTTCTACTTATGCTAGTCCGA
AATTTGAAAAGAAATCCGAAGATGATGTCGGTGGATCTTATTATCATTAT
CCAGACTTTAGTTATTGCCAAGGAAATTTAGGTATAGATAAGCTATATGT
CAATACCTTTGTTTCAAATGCTCAACAAAACCTTATTCGGTCTCATAATA
TATCTACATCACTTACTTCCTCAAAGGCATTAACTGAAAAACAATCAAAT
TTTGCTGGTAACTTAAATTTTCCAAAATCCGATTCTTCAATTGATAAAAC
TCTCACGTCTTTGCCAATGGAAACAGGCGCTATAAAATTAGATCCTCGAT
GTTCCAATCCTCACATACTAATAAAATTGTCAGTTGACCTAATAAAAACC
TACAAAAACATAAACGAGATTTATTATCGGAAAAAGCGCAGATTAAAAGA
ACCTACCGATGATAATTTCTTGAAAAAAGACCGCAAAAGGAACAGTGGCC
ATGAAGACAACACTGATTTGAAATCATCGAATCAAAAAGTATTAAGCTGT
GATGGTGCTCCACAGACAAAAAATTCAGATCCGTCTAATGAGATCAATAA
AAAATTTGGATGTGCAACTCTGTTACATTCAGATCAAAGAGTTCCCATTC
CGCAAAATTTCACTTTATCAGGAAATGTACCTCATTCTAATGTAAATACT
TCCATTTCTTCTAAAGATGTCGGTGGTTATGAATATTTAATCAAACCTGG
TGAAATTTGGAAAAGTCAGTACAGCATTGAAAAGTTGATAGGAACTGGCT
CATTTGGACAGGTTGTACGTGCCAAAGATCTGAAATCAGGAGAATTTGTT
GCTATCAAAATAATTAAAAACAAACGCAATTTTGTCGAACAAGCTTATAT
AGAAATCAGTTTGCTTAAGGAAATCGGAAAATTTCAAGAAAATGATGAAA
TAGCTCAAGAATGGGGTGCAAATTATATTGTGAAATTAAAATCTTTCTTC
AATCATCGTGGTCATCTGTGCCTAGTATTTGAGCTTCTAACATATACTCT
ATATGAGTTACTAAAGAACACTAATTTTCGGGGAGTGTCTTTAAATCTTA
CTCGCAAGTTCGCTCAACAAATCTGTCAAGCCTTGGTATTCTTATCCAAA
CCTCAAGTGCAAATTATCCATTGTGATTTGAAACCAGAAAACATCCTATT
ACTTCATCCTAGGCGATCAGCGATTAAAGTTGTGGATTTTGGTAGTTCAT
GCCATGCCAATCGTCGAATATATTATTATATTCAGTCAAGATTTTACAGG
TCACCAGAAATTATATTAAATCTCGATTATTCCCACGCAATAGATATGTG
GTCACTTGGGTGTATCATGGCTGAATTGCATACAGGTCAACCCTTGTTTA
TTGGACAATTTGAGCACGAACAAATATTGAGGATAATTGAAGTTGTTGGA
ATGCCACCAAGCACAATGATTGACAGCGGCAAAAAAAGTCTCCGATACTT
TGACCGATTTCCTTCTACGAACTTACAAACCAAATATACATACAGACCCA
AACTCCATCGAGAAAAAGATGGGAAAAAAATTGCATTTCAAGGAATTTCC
AGTCGAAAGTTGAGTGATATAATTGGTGTATATACCGGTGGACCTCAAGG
TCGTAGACTAAACGAACCAGGTCATTCATCATTAGATTATGAGAAATTTC
TAGATTTGCTTCAAAAAATGATGGTAATTGATCCCAAGAAACGAATCAAA
CCCGATGAAGCCTTGAAACATCCCTTTTTTATTCGATCCACTCCAACAGA
TACAAACCCTATTTTACCAAATACTTCCTCTAAAACTGCAGTACCTTCTC
TATTATCTACCTCTTGTGATAAAAATTTGATCTCCATGGCAGCAACTAGT
AAAGTCAGTGGTAATCCGCGATTTGCTAAGGCCACTGATAGCTCAGGAGA
TAAGTTGCCTGTCAACATCTCAATGAGCACGCAAACACCTCAAAATCAAA
TATCTGGCAGTAATATTGCCTGTGATTCTTCTAATTTGTTAGACGCATCA
GCATCAGCATCATTATCTCACCAAGAGTCCACTTATCTCTCATTAGCAAC
AATAACTACAACTGCAAATTGATTTTTACACTTATTTTGTACATAAAATC
TTTATATGCATTCGTACAATCTTTGGAGAAAATTCGATTTCCTTTTTGAT
TTTTTCTTTTAATC
back to top

protein sequence of SMED30031373-orf-1

>SMED30031373-orf-1 ID=SMED30031373-orf-1|Name=SMED30031373-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=827bp
MSHLNISNKVDGSKMQHTDLSKTKCEDTIRFKESQQHTMGVTNVPVYGHL
VTADQLNQIEKRKGVLGLHSTDSASKTIFSAINTGIEISSDNFIYANLAN
TNEPMDITNISSEVQMASPNHHSGSLSSIISTYASPKFEKKSEDDVGGSY
YHYPDFSYCQGNLGIDKLYVNTFVSNAQQNLIRSHNISTSLTSSKALTEK
QSNFAGNLNFPKSDSSIDKTLTSLPMETGAIKLDPRCSNPHILIKLSVDL
IKTYKNINEIYYRKKRRLKEPTDDNFLKKDRKRNSGHEDNTDLKSSNQKV
LSCDGAPQTKNSDPSNEINKKFGCATLLHSDQRVPIPQNFTLSGNVPHSN
VNTSISSKDVGGYEYLIKPGEIWKSQYSIEKLIGTGSFGQVVRAKDLKSG
EFVAIKIIKNKRNFVEQAYIEISLLKEIGKFQENDEIAQEWGANYIVKLK
SFFNHRGHLCLVFELLTYTLYELLKNTNFRGVSLNLTRKFAQQICQALVF
LSKPQVQIIHCDLKPENILLLHPRRSAIKVVDFGSSCHANRRIYYYIQSR
FYRSPEIILNLDYSHAIDMWSLGCIMAELHTGQPLFIGQFEHEQILRIIE
VVGMPPSTMIDSGKKSLRYFDRFPSTNLQTKYTYRPKLHREKDGKKIAFQ
GISSRKLSDIIGVYTGGPQGRRLNEPGHSSLDYEKFLDLLQKMMVIDPKK
RIKPDEALKHPFFIRSTPTDTNPILPNTSSKTAVPSLLSTSCDKNLISMA
ATSKVSGNPRFAKATDSSGDKLPVNISMSTQTPQNQISGSNIACDSSNLL
DASASASLSHQESTYLSLATITTTAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004712protein serine/threonine/tyrosine kinase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0046777protein autophosphorylation
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028318DYRK1A/B_MNB
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 339..675
e-value: 1.8E-77
score: 273.4
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 339..675
e-value: 5.4E-49
score: 166.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 339..675
score: 38.619
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 325..427
e-value: 2.3E-123
score: 413.6
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 395..675
e-value: 2.3E-123
score: 413.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 234..256
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 257..278
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 234..278
NoneNo IPR availablePANTHERPTHR24058DUAL SPECIFICITY PROTEIN KINASEcoord: 197..723
IPR028318Dual specificity tyrosine-phosphorylation-regulated kinase 1A/BPANTHERPTHR24058:SF12DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-REGULATED KINASE 1Bcoord: 197..723
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 470..482
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 345..368
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 328..692