Folate receptor

Overview
NameFolate receptor
Smed IDSMED30031359
Length (bp)943
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Folate receptor (SMED30031359) t-SNE clustered cells

Violin plots show distribution of expression levels for Folate receptor (SMED30031359) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Folate receptor (SMED30031359) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Folate receptor (SMED30031359) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031359

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031359SMESG000004287.1 SmedASXL_006609SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30031359SMESG000004287.1 SmedASXL_006609SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30031359SMESG000004287.1 dd_Smed_v4_8103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031359SMESG000004287.1 dd_Smed_v4_8103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Folate receptor vs. Ensembl Human
Match: FOLR2 (folate receptor beta [Source:HGNC Symbol;Acc:HGNC:3793])

HSP 1 Score: 150.214 bits (378), Expect = 1.002e-43
Identity = 77/204 (37.75%), Postives = 108/204 (52.94%), Query Frame = 3
Query:   93 DMISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRT-AHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHK--CRTFSKIYGNARQFCESVWDHSWKIA 695
            DM+  + P+ L+L  +  M CS ++R          NVCM  K HK  P  E  L   C  WK ++CC  + S E     +  + F++DHC + M   C + F+ + C YECSP+LGPW+ +++    RKERF   PLC  DCQ+WW DC   +TC  NW  G+ W  G N C     CRTF   +      CE +W HS+K++
Sbjct:   13 DMVWKWMPLLLLLVCVATM-CSAQDR------TDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGK-MEPACKRHFIQDTCLYECSPNLGPWIQQVN-QSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVS 207          
BLAST of Folate receptor vs. Ensembl Human
Match: FOLR2 (folate receptor beta [Source:HGNC Symbol;Acc:HGNC:3793])

HSP 1 Score: 150.599 bits (379), Expect = 2.558e-43
Identity = 81/229 (35.37%), Postives = 116/229 (50.66%), Query Frame = 3
Query:   96 MISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRT-AHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHK--CRTFSKIYGNARQFCESVWDHSWKI---AKTDNNCLSFSKDSSAIEQNHRVS 764
            M+  + P+ L+L  +  M CS ++R          NVCM  K HK  P  E  L   C  WK ++CC  + S E     +  + F++DHC + M   C + F+ + C YECSP+LGPW+ +++    RKERF   PLC  DCQ+WW DC   +TC  NW  G+ W  G N C     CRTF   +      CE +W HS+K+   ++    C+    DS+    N  V+
Sbjct:    1 MVWKWMPLLLLLVCVATM-CSAQDR------TDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGK-MEPACKRHFIQDTCLYECSPNLGPWIQQVN-QSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVA 220          
BLAST of Folate receptor vs. Ensembl Human
Match: FOLR3 (folate receptor gamma [Source:HGNC Symbol;Acc:HGNC:3795])

HSP 1 Score: 143.665 bits (361), Expect = 8.594e-41
Identity = 74/195 (37.95%), Postives = 102/195 (52.31%), Query Frame = 3
Query:  198 FNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRT-AHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHK--CRTFSKIYGNARQFCESVWDHSWKI---AKTDNNCLSFSKDSSAIEQNHRVS 764
             NVCM  K HK  PS E  L G C  WK ++CC  + S E     +  + F++DHC + M   C + F+ + C YECSP+LGPW+ +++    RKER    PLC  DC++WW DCR  YTC  NW  G+ W  G N C     C TF   +      CE +W HS+K+   ++    C+    DS+    N  V+
Sbjct:   34 LNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGK-MEPTCKRHFIQDSCLYECSPNLGPWIRQVN-QSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVA 226          
BLAST of Folate receptor vs. Ensembl Human
Match: FOLR2 (folate receptor beta [Source:HGNC Symbol;Acc:HGNC:3793])

HSP 1 Score: 137.117 bits (344), Expect = 9.905e-39
Identity = 72/193 (37.31%), Postives = 99/193 (51.30%), Query Frame = 3
Query:   93 DMISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRT-AHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHK--CRTFSKIYGNARQFC 662
            DM+  + P+ L+L  +  M CS ++R          NVCM  K HK  P  E  L   C  WK ++CC  + S E     +  + F++DHC + M   C + F+ + C YECSP+LGPW+ +++    RKERF   PLC  DCQ+WW DC   +TC  NW  G+ W  G N C     CRTF   +      C
Sbjct:   15 DMVWKWMPLLLLLVCVATM-CSAQDR------TDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGK-MEPACKRHFIQDTCLYECSPNLGPWIQQVN-QSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALC 198          
BLAST of Folate receptor vs. Ensembl Human
Match: FOLR2 (folate receptor beta [Source:HGNC Symbol;Acc:HGNC:3793])

HSP 1 Score: 134.806 bits (338), Expect = 2.777e-37
Identity = 75/228 (32.89%), Postives = 109/228 (47.81%), Query Frame = 3
Query:   93 DMISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRT-AHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKIYGNARQFCESVWDHSWKI---AKTDNNCLSFSKDSSAIEQNHRVS 764
            DM+  + P+ L+L  +  M CS ++R          NVCM  K HK  P  E  L   C  WK ++CC  + S E     +  + F++DHC + M   C + F+ + C YECSP+LGPW+ +++    RKERF   PLC  DCQ+WW DC   +TC  NW  G+ W                        CE +W HS+K+   ++    C+    DS+    N  V+
Sbjct:   17 DMVWKWMPLLLLLVCVATM-CSAQDR------TDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGK-MEPACKRHFIQDTCLYECSPNLGPWIQQVN-QSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSA-------------------ALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVA 216          
BLAST of Folate receptor vs. Ensembl Zebrafish
Match: folr (folate receptor [Source:ZFIN;Acc:ZDB-GENE-070615-23])

HSP 1 Score: 134.035 bits (336), Expect = 3.518e-37
Identity = 72/214 (33.64%), Postives = 112/214 (52.34%), Query Frame = 3
Query:   99 ISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNE-YEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKH--KCRTFSKIYGNARQFCESVWDHSWK---IAKTDNNCLSF 722
            +   F   L+L  I++  CS          +   N+CM GK H   P  E  L   C  WK ++CC  N + E ++     + F+++HC   M+ KC K F+ + CFYECSP LGPW ++ +    R+ER    PLC  DC+ W+ DC+ + TC  NW  G+ W  G N C    +CR +++++ +AR  CE +W +S+K   + K+   C+  
Sbjct:    1 MDALFHRRLLLLLIVLPACS--------AAVDKLNMCMDGKHHITEPKPEGQLYQQCSPWKDNACCTANTTEEAHQDNSYLYNFNWNHCG-IMNDKCKKHFIQDTCFYECSPHLGPW-IQPADESWRRERILDVPLCLEDCESWYEDCKEELTCKQNWHKGWDWSSGTNRCPQDSQCRRWTEVFPSARDMCEKIWSNSYKHTTLTKSSGRCMQM 204          
BLAST of Folate receptor vs. Ensembl Zebrafish
Match: zgc:109949 (zgc:109949 [Source:ZFIN;Acc:ZDB-GENE-050522-166])

HSP 1 Score: 74.3294 bits (181), Expect = 8.029e-15
Identity = 50/191 (26.18%), Postives = 81/191 (42.41%), Query Frame = 3
Query:  135 SIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFH-NVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKIYGNARQFCESVWDHSWKIAKTD 704
            S +++  +    L     +     C+   +HK TPS E +L   C  +  +SCC   ++ +   +  T     +D C   +S  C       +CFY CSPD   W     G           PLC S C+ W+  C+ D TC  +W       +G+N C   C  + ++Y + R  CES+W  ++   + D
Sbjct:    6 SRVLLGLAHLTSLFAAVVMSHEGACLRDGRHKATPSPERHLQE-CSLYTENSCCSETDIQDLSVSVSTVENTHWDKCGV-LSPLCESFLKRVVCFYRCSPDAARWPHPHQG-----SSLKAVPLCHSFCRDWFEACKMDMTCARDWTTD---PRGQN-CTGACVPYQQMYQHGRDLCESLWGDAFMTVEDD 185          
BLAST of Folate receptor vs. Ensembl Xenopus
Match: folr1 (folate receptor alpha [Source:NCBI gene;Acc:394697])

HSP 1 Score: 140.198 bits (352), Expect = 2.636e-39
Identity = 72/169 (42.60%), Postives = 96/169 (56.80%), Query Frame = 3
Query:  198 FNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNE-YEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKH--KCRTFSKIYGNARQFCESVWDHSWKIA 695
             +VCM GK  K  P  E  L G C  WK  SCC  N S E +  Q   + F++DHC   M+  C   F+ + CFYECSP+LGPW+ K+     RKER    PLC  DC  W+NDC+ +YTC  NW  G+ W  G N C +  KCR   +++ +A  FCE +W +S+K +
Sbjct:   37 MDVCMDGKHQKVEPGKEDALHGQCTPWKDKSCCTANTSQEAHNDQSYLYNFNWDHCGI-MAPACKTHFIQDTCFYECSPNLGPWIQKVDS-SWRKERILDVPLCREDCDGWYNDCKLEYTCMENWHKGWNWTSGTNQCPNGTKCRRVFEVFPSAADFCEKIWSNSYKYS 203          
BLAST of Folate receptor vs. Ensembl Xenopus
Match: folr1 (folate receptor alpha [Source:NCBI gene;Acc:394697])

HSP 1 Score: 139.813 bits (351), Expect = 8.612e-39
Identity = 72/167 (43.11%), Postives = 95/167 (56.89%), Query Frame = 3
Query:  198 FNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNE-YEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKH--KCRTFSKIYGNARQFCESVWDHSWK 689
             +VCM GK  K  P  E  L G C  WK  SCC  N S E +  Q   + F++DHC   M+  C   F+ + CFYECSP+LGPW+ K+     RKER    PLC  DC  W+NDC+ +YTC  NW  G+ W  G N C +  KCR   +++ +A  FCE +W +S+K
Sbjct:   66 MDVCMDGKHQKVEPGKEDALHGQCTPWKDKSCCTANTSQEAHNDQSYLYNFNWDHCGI-MAPACKTHFIQDTCFYECSPNLGPWIQKVDS-SWRKERILDVPLCREDCDGWYNDCKLEYTCMENWHKGWNWTSGTNQCPNGTKCRRVFEVFPSAADFCEKIWSNSYK 230          
BLAST of Folate receptor vs. Ensembl Xenopus
Match: folr1 (folate receptor alpha [Source:NCBI gene;Acc:394697])

HSP 1 Score: 119.013 bits (297), Expect = 1.651e-31
Identity = 65/169 (38.46%), Postives = 88/169 (52.07%), Query Frame = 3
Query:  198 FNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNE-YEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKH--KCRTFSKIYGNARQFCESVWDHSWKIA 695
             +VCM GK  K  P  E  L G C  WK  SCC  N S E +  Q   + F++DHC   M+  C   F+ + CFYECSP+LGPW+ K                   DC  W+NDC+ +YTC  NW  G+ W  G N C +  KCR   +++ +A  FCE +W +S+K +
Sbjct:   22 MDVCMDGKHQKVEPGKEDALHGQCTPWKDKSCCTANTSQEAHNDQSYLYNFNWDHCGI-MAPACKTHFIQDTCFYECSPNLGPWIQK-------------------DCDGWYNDCKLEYTCMENWHKGWNWTSGTNQCPNGTKCRRVFEVFPSAADFCEKIWSNSYKYS 170          
BLAST of Folate receptor vs. Ensembl Xenopus
Match: coro6 (coronin 6 [Source:Xenbase;Acc:XB-GENE-493511])

HSP 1 Score: 86.6557 bits (213), Expect = 2.241e-19
Identity = 52/181 (28.73%), Postives = 85/181 (46.96%), Query Frame = 3
Query:  207 CMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRT--AHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKIYGNARQFCESVWDHSWKIAKTDNNCLSFSKDSSAI 743
            C+ G  HK TPS+E N    C  +  SSCC  N + +         + + Y+ C   +S +C        CFY+CSP    W+       +  E     P+C S C KW++ C +D  C  NW+  + + +  N CK+ C  F+K+Y N    C++ W  S+  + +   CL F++  + +
Sbjct:   22 CLGGPHHKSTPSSETNFQE-CFLYAESSCCHANFTQKLSDSPLIEMNNYYYNRCGN-LSKRCEDYMKRIECFYQCSPLASHWI-----HPNISEAIQHVPVCQSFCDKWFDACHSDLICAYNWISDWTFDETGNHCKNDCIPFNKMYANGTDLCQNAWGISFIASSSPCRCLDFTETDTKV 195          
BLAST of Folate receptor vs. Ensembl Xenopus
Match: prkch (protein kinase C eta [Source:Xenbase;Acc:XB-GENE-486685])

HSP 1 Score: 48.9062 bits (115), Expect = 3.059e-6
Identity = 43/194 (22.16%), Postives = 73/194 (37.63%), Query Frame = 3
Query:  186 TIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNI--CKHKCRTFSKIY-GNARQFCESVWDHSWKIAKTDNNCLSFSKDSSAIEQNHR 758
            T  S + C+ G+     P AE  L   C+++   +CC    + E  +      F +  C   +S  C K      C Y CSP +  +    S         Y  PLC   C +W+  C++D  CT         +    I  C   C  + +++    +  C  +W  S   +  D +C+S + +      +H 
Sbjct:   27 TSGSRDRCLPGRTPNLLPRAEAKLL-ECQQYSEKACC----TQEQISAHPITNFPWGLCGS-LSPSCQKYVSQVQCLYLCSPHISAYWNPDSDTG-----IYNLPLCSGFCDQWFEACKDDLICT---------LTNETIPRCADACVPYKQMFKAGGKDLCNGIWGDSLVASPQDCSCVSPAGEGEKHGNSHE 200          
BLAST of Folate receptor vs. Ensembl Mouse
Match: Folr1 (folate receptor 1 (adult) [Source:MGI Symbol;Acc:MGI:95568])

HSP 1 Score: 147.902 bits (372), Expect = 2.318e-42
Identity = 81/240 (33.75%), Postives = 126/240 (52.50%), Query Frame = 3
Query:   99 ISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNE-YEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNIC--KHKCRTFSKIYGNARQFCESVWDHSWKI---AKTDNNCLSFSKDSSAIEQNHRVSIETAQDIVRTIF 800
            ++    + L+L  + + +C++ +R  R  T +  NVCM  K HK  P  E NL   C  WKT+SCC  N S E ++     + F+++HC   M+S+C + F+ + C YECSP+LGPW+ ++     RKER    PLC  DCQ+WW DC++ +TC  NW  G+ W  G N C     C  F+  +  +   CE +W HS+K+   ++    C+    D +    N  V+   A+ +    F
Sbjct:    1 MAHLMTVQLLLLVMWMAECAQ-SRATRART-ELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGT-MTSECKRHFIQDTCLYECSPNLGPWIQQVD-QSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGAGF 236          
BLAST of Folate receptor vs. Ensembl Mouse
Match: Folr1 (folate receptor 1 (adult) [Source:MGI Symbol;Acc:MGI:95568])

HSP 1 Score: 147.902 bits (372), Expect = 2.318e-42
Identity = 81/240 (33.75%), Postives = 126/240 (52.50%), Query Frame = 3
Query:   99 ISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNE-YEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNIC--KHKCRTFSKIYGNARQFCESVWDHSWKI---AKTDNNCLSFSKDSSAIEQNHRVSIETAQDIVRTIF 800
            ++    + L+L  + + +C++ +R  R  T +  NVCM  K HK  P  E NL   C  WKT+SCC  N S E ++     + F+++HC   M+S+C + F+ + C YECSP+LGPW+ ++     RKER    PLC  DCQ+WW DC++ +TC  NW  G+ W  G N C     C  F+  +  +   CE +W HS+K+   ++    C+    D +    N  V+   A+ +    F
Sbjct:    1 MAHLMTVQLLLLVMWMAECAQ-SRATRART-ELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGT-MTSECKRHFIQDTCLYECSPNLGPWIQQVD-QSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGAGF 236          
BLAST of Folate receptor vs. Ensembl Mouse
Match: Folr1 (folate receptor 1 (adult) [Source:MGI Symbol;Acc:MGI:95568])

HSP 1 Score: 147.902 bits (372), Expect = 2.318e-42
Identity = 81/240 (33.75%), Postives = 126/240 (52.50%), Query Frame = 3
Query:   99 ISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNE-YEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNIC--KHKCRTFSKIYGNARQFCESVWDHSWKI---AKTDNNCLSFSKDSSAIEQNHRVSIETAQDIVRTIF 800
            ++    + L+L  + + +C++ +R  R  T +  NVCM  K HK  P  E NL   C  WKT+SCC  N S E ++     + F+++HC   M+S+C + F+ + C YECSP+LGPW+ ++     RKER    PLC  DCQ+WW DC++ +TC  NW  G+ W  G N C     C  F+  +  +   CE +W HS+K+   ++    C+    D +    N  V+   A+ +    F
Sbjct:    1 MAHLMTVQLLLLVMWMAECAQ-SRATRART-ELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGT-MTSECKRHFIQDTCLYECSPNLGPWIQQVD-QSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGAGF 236          
BLAST of Folate receptor vs. Ensembl Mouse
Match: Folr1 (folate receptor 1 (adult) [Source:MGI Symbol;Acc:MGI:95568])

HSP 1 Score: 147.902 bits (372), Expect = 2.318e-42
Identity = 81/240 (33.75%), Postives = 126/240 (52.50%), Query Frame = 3
Query:   99 ISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNE-YEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNIC--KHKCRTFSKIYGNARQFCESVWDHSWKI---AKTDNNCLSFSKDSSAIEQNHRVSIETAQDIVRTIF 800
            ++    + L+L  + + +C++ +R  R  T +  NVCM  K HK  P  E NL   C  WKT+SCC  N S E ++     + F+++HC   M+S+C + F+ + C YECSP+LGPW+ ++     RKER    PLC  DCQ+WW DC++ +TC  NW  G+ W  G N C     C  F+  +  +   CE +W HS+K+   ++    C+    D +    N  V+   A+ +    F
Sbjct:    1 MAHLMTVQLLLLVMWMAECAQ-SRATRART-ELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGT-MTSECKRHFIQDTCLYECSPNLGPWIQQVD-QSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGAGF 236          
BLAST of Folate receptor vs. Ensembl Mouse
Match: Folr1 (folate receptor 1 (adult) [Source:MGI Symbol;Acc:MGI:95568])

HSP 1 Score: 147.902 bits (372), Expect = 2.318e-42
Identity = 81/240 (33.75%), Postives = 126/240 (52.50%), Query Frame = 3
Query:   99 ISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNE-YEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNIC--KHKCRTFSKIYGNARQFCESVWDHSWKI---AKTDNNCLSFSKDSSAIEQNHRVSIETAQDIVRTIF 800
            ++    + L+L  + + +C++ +R  R  T +  NVCM  K HK  P  E NL   C  WKT+SCC  N S E ++     + F+++HC   M+S+C + F+ + C YECSP+LGPW+ ++     RKER    PLC  DCQ+WW DC++ +TC  NW  G+ W  G N C     C  F+  +  +   CE +W HS+K+   ++    C+    D +    N  V+   A+ +    F
Sbjct:    1 MAHLMTVQLLLLVMWMAECAQ-SRATRART-ELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGT-MTSECKRHFIQDTCLYECSPNLGPWIQQVD-QSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGAGF 236          
BLAST of Folate receptor vs. UniProt/SwissProt
Match: sp|P14207|FOLR2_HUMAN (Folate receptor beta OS=Homo sapiens OX=9606 GN=FOLR2 PE=1 SV=4)

HSP 1 Score: 150.599 bits (379), Expect = 1.228e-42
Identity = 81/229 (35.37%), Postives = 116/229 (50.66%), Query Frame = 3
Query:   96 MISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRT-AHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHK--CRTFSKIYGNARQFCESVWDHSWKI---AKTDNNCLSFSKDSSAIEQNHRVS 764
            M+  + P+ L+L  +  M CS ++R          NVCM  K HK  P  E  L   C  WK ++CC  + S E     +  + F++DHC + M   C + F+ + C YECSP+LGPW+ +++    RKERF   PLC  DCQ+WW DC   +TC  NW  G+ W  G N C     CRTF   +      CE +W HS+K+   ++    C+    DS+    N  V+
Sbjct:    1 MVWKWMPLLLLLVCVATM-CSAQDR------TDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGK-MEPACKRHFIQDTCLYECSPNLGPWIQQVN-QSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVA 220          
BLAST of Folate receptor vs. UniProt/SwissProt
Match: sp|P35846|FOLR1_MOUSE (Folate receptor alpha OS=Mus musculus OX=10090 GN=Folr1 PE=1 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 1.621e-41
Identity = 81/240 (33.75%), Postives = 126/240 (52.50%), Query Frame = 3
Query:   99 ISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNE-YEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNIC--KHKCRTFSKIYGNARQFCESVWDHSWKI---AKTDNNCLSFSKDSSAIEQNHRVSIETAQDIVRTIF 800
            ++    + L+L  + + +C++ +R  R  T +  NVCM  K HK  P  E NL   C  WKT+SCC  N S E ++     + F+++HC   M+S+C + F+ + C YECSP+LGPW+ ++     RKER    PLC  DCQ+WW DC++ +TC  NW  G+ W  G N C     C  F+  +  +   CE +W HS+K+   ++    C+    D +    N  V+   A+ +    F
Sbjct:    1 MAHLMTVQLLLLVMWMAECAQ-SRATRART-ELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGT-MTSECKRHFIQDTCLYECSPNLGPWIQQVD-QSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGAGF 236          
BLAST of Folate receptor vs. UniProt/SwissProt
Match: sp|P41439|FOLR3_HUMAN (Folate receptor gamma OS=Homo sapiens OX=9606 GN=FOLR3 PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 4.127e-40
Identity = 74/195 (37.95%), Postives = 102/195 (52.31%), Query Frame = 3
Query:  198 FNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRT-AHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHK--CRTFSKIYGNARQFCESVWDHSWKI---AKTDNNCLSFSKDSSAIEQNHRVS 764
             NVCM  K HK  PS E  L G C  WK ++CC  + S E     +  + F++DHC + M   C + F+ + C YECSP+LGPW+ +++    RKER    PLC  DC++WW DCR  YTC  NW  G+ W  G N C     C TF   +      CE +W HS+K+   ++    C+    DS+    N  V+
Sbjct:   34 LNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGK-MEPTCKRHFIQDSCLYECSPNLGPWIRQVN-QSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVA 226          
BLAST of Folate receptor vs. UniProt/SwissProt
Match: sp|Q05685|FOLR2_MOUSE (Folate receptor beta OS=Mus musculus OX=10090 GN=Folr2 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 3.779e-37
Identity = 75/209 (35.89%), Postives = 101/209 (48.33%), Query Frame = 3
Query:  171 LIRMTTIQS-------FNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKH--KCRTFSKIYGNARQFCESVWDHSWKI---AKTDNNCLSFSKDSSAIEQNHRV 761
            L+ M T  S        NVCM  K HK  P  E  L   C  WK ++CC  N S E     +   F++DHC + M   C   F+ + C YECSP+LGPW+ ++     RKERF   PLC  DC +WW  CR  +TC  +W  G+ W  G N C +   C TF   +      CE +W HS+K+   ++    C+    DS+    N  V
Sbjct:   11 LVYMVTTGSGRDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCSVNTSQELHKADSRLYFNWDHCGK-MEPACKSHFIQDSCLYECSPNLGPWIQQVD-QSWRKERFLDVPLCKEDCHQWWEACRTSFTCKRDWHKGWDWSSGINKCPNTAPCHTFEYYFPTPASLCEGLWSHSYKVSNYSRGSGRCIQMWFDSTQGNPNEDV 217          
BLAST of Folate receptor vs. UniProt/SwissProt
Match: sp|P02702|FOLR1_BOVIN (Folate receptor alpha OS=Bos taurus OX=9913 GN=FOLR1 PE=1 SV=3)

HSP 1 Score: 133.65 bits (335), Expect = 2.820e-36
Identity = 72/201 (35.82%), Postives = 101/201 (50.25%), Query Frame = 3
Query:  198 FNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRT-AHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNIC--KHKCRTFSKIYGNARQFCESVWDHSWKI---AKTDNNCLSFSKDSSAIEQNHRVSIETAQD 782
             NVCM  K HK  P  E +L   C  W+ ++CC  N S E     +  + F++DHC + M   C + F+ + C YECSP+LGPW+ +++  + RKER    PLC  DCQ WW DCR  YTC  NW  G+ W  G N C  K  C  F   +      C  +W HS+K+   ++    C+    D      N  V+   A++
Sbjct:   33 LNVCMDAKHHKAEPGPEDSLHEQCSPWRKNACCSVNTSIEAHKDISYLYRFNWDHCGK-MEPACKRHFIQDTCLYECSPNLGPWIREVN-QRWRKERVLGVPLCKEDCQSWWEDCRTSYTCKSNWHKGWNWTSGYNQCPVKAACHRFDFYFPTPAALCNEIWSHSYKVSNYSRGSGRCIQMWFDPFQGNPNEEVARFYAEN 231          
BLAST of Folate receptor vs. TrEMBL
Match: A0A4E0RH52 (G_PROTEIN_RECEP_F2_3 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_003111 PE=4 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 4.079e-58
Identity = 97/230 (42.17%), Postives = 138/230 (60.00%), Query Frame = 3
Query:  123 LILSSIIVMQCSEENRLIRMTTIQSFN-VCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNIC--KHKCRTFSKIYGNARQFCESVWDHSWKIAKTDNNCLSF--SKDSSAIEQNHRVSIETAQDIVRTI 797
            L + S+I ++    NRL  + +++S+  +C LG+ HK  PSAEPNLT IC  W   SCC  +   +   +R  + F + HCNR MS KC   F+ +LCFY+CSP+LGPW+++ S  K   ER Y APLC SDC +WW  CR D TC  NW   F W  GRN+C     C +F ++YGNA +FC +VWD +W  A   + CL F   K  + ++ N+ V++  A DI++ +
Sbjct:   35 LFIYSLINIEAQHNNRLNYIGSVESYTTLCPLGQNHKSGPSAEPNLTDICYNWAERSCCTADTMQKL-YKRIVYSFDHSHCNRTMSEKCEAMFMQDLCFYQCSPNLGPWMIR-SERKIGTERMYAAPLCMSDCNEWWEACRYDMTCVENWSYEFDWSTGRNMCPEGRDCLSFEQVYGNASRFCHAVWDGAWT-ATNSSQCLHFLEGKAHNILKHNYHVAVAQANDILKRL 261          
BLAST of Folate receptor vs. TrEMBL
Match: A0A504Z9T6 (Folate receptor alpha OS=Fasciola gigantica OX=46835 GN=FGIG_11556 PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 7.171e-54
Identity = 94/216 (43.52%), Postives = 129/216 (59.72%), Query Frame = 3
Query:  165 NRLIRMTTIQSF-NVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKH--KCRTFSKIYGNARQFCESVWDHSWKIAKTDNNCLSF--SKDSSAIEQNHRVSIETAQDIVRTI 797
            NRL  + +++S+ N+C LG  HK  PSAEP L  IC +W   SCC  +   + +     + F + HCNR MS KC   FL +LCFY+CSP+LGPW+++ S  K   ER Y APLC SDC +WW  CR++ TC  NW   F W  GRN C     C +F ++YGNA QFC +VWD SW  A + + CL F   K  + ++ NH V++  A  I++ +
Sbjct:   32 NRLNYIGSVESYTNLCPLGPHHKNEPSAEPGLVDICHEWAERSCCTADTLKKSQTG-LIYNFDHSHCNRTMSEKCEAMFLRDLCFYQCSPNLGPWIIR-SERKVGTERMYAAPLCMSDCNEWWEACRHEQTCVENWSYEFDWSTGRNTCPQGRDCLSFEQVYGNASQFCHAVWDGSWA-ATSSSKCLHFLEGKVPNILKHNHDVAVAQANVILKRL 244          
BLAST of Folate receptor vs. TrEMBL
Match: A0A4E0S105 (Folate receptor OS=Fasciola hepatica OX=6192 GN=D915_003112 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 5.166e-53
Identity = 95/236 (40.25%), Postives = 139/236 (58.90%), Query Frame = 3
Query:  105 MFFPINLILSSIIVMQCSEENRLIRMTTIQSF-NVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNIC--KHKCRTFSKIYGNARQFCESVWDHSWKIAKTDNNCLSF--SKDSSAIEQNHRVSIETAQDIVRTI 797
            + F I L++  ++ ++    NRL  + +++S+ N+C LG  HK  PSAEP L  IC +W   SCC  +   + +     + F + HCN+ MS KC   F  +LCFY+CSP+LGPW+++ S  K   ER Y APLC SDC +WW  CR++ TC  NW   F W  GRN+C     C +F ++YGNA QFC +VWD SW  A + + CL F   K  + ++ NH V++  A  I++ +
Sbjct:   43 LMFQILLLVRLLLRIEAQHNNRLNYIGSVESYTNLCPLGPHHKNEPSAEPGLVDICHEWAERSCCTADTLKKSQTG-LIYNFDHSHCNQTMSEKCEAIFKRDLCFYQCSPNLGPWMIR-SERKVGTERMYAAPLCMSDCNEWWEACRHEQTCVENWSYEFDWSTGRNMCPEGRDCLSFEQVYGNASQFCHAVWDGSW-TATSSSQCLHFLEGKVPNILKHNHDVAVAQANVILKRL 275          
BLAST of Folate receptor vs. TrEMBL
Match: A0A162DD41 (Folate receptor gamma OS=Daphnia magna OX=35525 GN=APZ42_030515 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.374e-52
Identity = 94/229 (41.05%), Postives = 130/229 (56.77%), Query Frame = 3
Query:   87 ANDMISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHC-NRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICK--HKCRTFSKIYGNARQFCESVWDHSWKIAKTDNNCLSFSKDSSAIEQNHRVS 764
            A      FF I  +LSS+      ++ R       Q  N C+ G  HK  P  E +L   C  WK +SCC  N +      +  +GF+Y+HC N+ MS+KC + F+ +LCFYECSP++GPW+  +S MK R+ERF   PLC +DC  W+  C++D+TCT NW + F+WI G N C+   +CRTFS+I+ N+  FCE VWDHSWK       C+    D S    N  V+
Sbjct:    9 AGHYFVTFFLILGLLSSVFSQISIKDKR-------QLVNSCIDGNNHKREPGPEDSLHQQCSPWKNNSCCTGNTTVHAHGGK-MYGFNYNHCPNKKMSNKCLEHFVQDLCFYECSPNVGPWVQMVSSMKMRRERFLGVPLCATDCDDWFKACKDDFTCTDNWTLNFEWINGTNRCRPESECRTFSEIFQNSSNFCERVWDHSWKYTDNSEPCMRIWFDGSQGNPNENVA 229          
BLAST of Folate receptor vs. TrEMBL
Match: A0A4S2M3L0 (Folate_rec domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004209 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.645e-52
Identity = 90/230 (39.13%), Postives = 134/230 (58.26%), Query Frame = 3
Query:  120 NLILSSIIVMQCSEENRLIRMTTIQSF-NVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNIC--KHKCRTFSKIYGNARQFCESVWDHSWKIAKTDNNCLSF-SKDSSAIEQNHRVSIETAQDIVRTI 797
            +L+   ++V   + +NRL  + +++ + N+C+ G  HK  PS EP    IC  W + SCC H      +     +GF++ HC +PMS KC   F  ELCFYECSP +GPWLVK   ++ R+ER Y  PLC  DC KW+  C+N+ TC  +W V F+W +G N+C     C  FS +Y +A  FC ++WD  WK+ K    C+ F + D  + E N RV+ + A++I+R +
Sbjct:    5 SLLTVLLVVAANAYDNRLDEIRSVEDYLNICINGTHHKKAPSPEPTDDHICTDWASMSCCEHKTMRSVQ-DSLLYGFNHSHC-KPMSQKCINMFKRELCFYECSPHVGPWLVKTQSLR-RRERSYLVPLCEEDCNKWYEACKNEETCVRDWSVEFEWSEGMNVCPADSSCELFSNVYKDASDFCHAIWDGGWKVEKAP-RCMHFVAVDERSKEHNQRVARQAAEEIIRRL 230          
BLAST of Folate receptor vs. Ensembl Cavefish
Match: folr (folate receptor gamma [Source:NCBI gene;Acc:103026309])

HSP 1 Score: 135.576 bits (340), Expect = 4.480e-38
Identity = 70/184 (38.04%), Postives = 103/184 (55.98%), Query Frame = 3
Query:  189 IQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNE-YEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICK--HKCRTFSKIYGNARQFCESVWDHSWK---IAKTDNNCLSF 722
            +   N+CM GK  K  P  E  L   C  W+ ++CC  N S E +E     + F+++HC   MS KC   F+ + CFYECSP LGPW ++++    RKER    PLC  DC+ W+NDC+ D+TC  NW  G+ W  G N C    +CR +S ++ +A+  CE++W +S+K   + K    C+  
Sbjct:    9 LDKLNMCMNGKHQKTEPGPEGELYKQCVPWRENACCTANTSAEAHEDNSYLYNFNWNHCGV-MSPKCKSHFVQDTCFYECSPHLGPW-IQLADSSWRKERIIDVPLCLEDCESWYNDCKYDFTCKDNWHKGWDWSSGTNHCPTGAECRLWSDVFPDAKSMCENIWTNSYKYTTLTKDSGRCMQM 190          
BLAST of Folate receptor vs. Ensembl Cavefish
Match: folr (folate receptor gamma [Source:NCBI gene;Acc:103026309])

HSP 1 Score: 135.961 bits (341), Expect = 4.695e-38
Identity = 70/185 (37.84%), Postives = 104/185 (56.22%), Query Frame = 3
Query:  186 TIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNE-YEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICK--HKCRTFSKIYGNARQFCESVWDHSWK---IAKTDNNCLSF 722
            ++   N+CM GK  K  P  E  L   C  W+ ++CC  N S E +E     + F+++HC   MS KC   F+ + CFYECSP LGPW ++++    RKER    PLC  DC+ W+NDC+ D+TC  NW  G+ W  G N C    +CR +S ++ +A+  CE++W +S+K   + K    C+  
Sbjct:   26 SLDKLNMCMNGKHQKTEPGPEGELYKQCVPWRENACCTANTSAEAHEDNSYLYNFNWNHCGV-MSPKCKSHFVQDTCFYECSPHLGPW-IQLADSSWRKERIIDVPLCLEDCESWYNDCKYDFTCKDNWHKGWDWSSGTNHCPTGAECRLWSDVFPDAKSMCENIWTNSYKYTTLTKDSGRCMQM 208          
BLAST of Folate receptor vs. Ensembl Cavefish
Match: zgc:109949 (riboflavin-binding protein-like [Source:NCBI gene;Acc:103041622])

HSP 1 Score: 72.7886 bits (177), Expect = 2.162e-14
Identity = 48/170 (28.24%), Postives = 77/170 (45.29%), Query Frame = 3
Query:  201 NVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCF-HNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKA-PLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKIYGNARQFCESVWDHSWKIAKTD 704
              C+   +HK TPS EP L   C  +  ++CC   ++++         G  +D C   +S  C       +CFY CSP    W         ++  F KA PLC S C+ W+  C++D TC  +W       +G N C   C  + ++Y + R  CES+W  ++   + +
Sbjct:   26 GACLQDGRHKATPSPEPYLK-ECTMYMENACCSEQDITDLTAPPAGDDGTPWDRCGT-LSPVCDAFLKRVVCFYRCSPHAAHW------PHPQRNSFLKAVPLCTSFCRDWYEACKSDLTCARDWAGD---PRGLN-CTGSCVPYQQMYQHGRDLCESLWGDAFMTVEDE 183          
BLAST of Folate receptor vs. Ensembl Cavefish
Match: zgc:109949 (riboflavin-binding protein-like [Source:NCBI gene;Acc:103041622])

HSP 1 Score: 72.7886 bits (177), Expect = 2.162e-14
Identity = 48/170 (28.24%), Postives = 77/170 (45.29%), Query Frame = 3
Query:  201 NVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCF-HNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKA-PLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKIYGNARQFCESVWDHSWKIAKTD 704
              C+   +HK TPS EP L   C  +  ++CC   ++++         G  +D C   +S  C       +CFY CSP    W         ++  F KA PLC S C+ W+  C++D TC  +W       +G N C   C  + ++Y + R  CES+W  ++   + +
Sbjct:   26 GACLQDGRHKATPSPEPYLK-ECTMYMENACCSEQDITDLTAPPAGDDGTPWDRCGT-LSPVCDAFLKRVVCFYRCSPHAAHW------PHPQRNSFLKAVPLCTSFCRDWYEACKSDLTCARDWAGD---PRGLN-CTGSCVPYQQMYQHGRDLCESLWGDAFMTVEDE 183          
BLAST of Folate receptor vs. Ensembl Cavefish
Match: zgc:109949 (riboflavin-binding protein-like [Source:NCBI gene;Acc:103041622])

HSP 1 Score: 72.0182 bits (175), Expect = 2.679e-14
Identity = 47/172 (27.33%), Postives = 77/172 (44.77%), Query Frame = 3
Query:  195 SFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCF-HNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKA-PLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKIYGNARQFCESVWDHSWKIAKTD 704
            S   C+   +HK TPS EP L   C  +  ++CC   ++++         G  +D C   +S  C       +CFY CSP    W         ++  F KA PLC S C+ W+  C++D TC  +W    + +     C   C  + ++Y + R  CES+W  ++   + +
Sbjct:    4 SKGACLQDGRHKATPSPEPYLK-ECTMYMENACCSEQDITDLTAPPAGDDGTPWDRCGT-LSPVCDAFLKRVVCFYRCSPHAAHW------PHPQRNSFLKAVPLCTSFCRDWYEACKSDLTCARDWAGDPRGLN----CTGSCVPYQQMYQHGRDLCESLWGDAFMTVEDE 163          
BLAST of Folate receptor vs. Ensembl Sea Lamprey
Match: folr (folate receptor [Source:ZFIN;Acc:ZDB-GENE-070615-23])

HSP 1 Score: 156.377 bits (394), Expect = 1.601e-46
Identity = 78/176 (44.32%), Postives = 104/176 (59.09%), Query Frame = 3
Query:  198 FNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNE-YEAQRTAHGFSYDHC---NRP-MSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNIC--KHKCRTFSKIYGNARQFCESVWDHSWKIAKTD 704
             N+CM  K HK  P  E  L G CE WK ++CC  N + + +E Q   + F+++HC    +P +S KC K F+ + C YECSP+LGPW+ K      RKER    PLC SDCQ WWNDCRNDYTC  NW  G++WI G N+C    +C+ F  I+   +  CE +W  S+K  + D
Sbjct:   28 LNICMDAKHHKTKPGPEGLLYGQCEPWKDNACCNANTTEQAHEDQSYLYNFNWNHCWSLGQPKLSDKCKKHFVQDTCLYECSPNLGPWIQKTDS-SWRKERILNVPLCKSDCQSWWNDCRNDYTCKENWHSGWEWINGTNLCPPDSQCQMFDVIFPTPKDLCERIWSSSYKYTEDD 202          
BLAST of Folate receptor vs. Ensembl Sea Lamprey
Match: zgc:109949 (zgc:109949 [Source:ZFIN;Acc:ZDB-GENE-050522-166])

HSP 1 Score: 78.1814 bits (191), Expect = 3.683e-17
Identity = 51/197 (25.89%), Postives = 81/197 (41.12%), Query Frame = 3
Query:  207 CMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAH--GFSYDHCNRPMSSKCTKSFLNEL-CFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKIYGNARQFCESVWDHS-WKIAKTDNNCLSFSKDSSAIEQNHRVSIETAQDI 785
            CM G K KP P  EP L   C ++  ++CC      +             +D C   ++  C +SFL  + C+  CSP    W       ++     +  P+C   C  W++ CR D+TC  NW+  + W    N C   C  FS+++ + R  CE  W  +   +A     C+S       I      +I T+  +
Sbjct:   29 CMAGSKSKPRPGPEPGLQA-CSQYNQNACCTPESVRQLSQSPVVRVDELLWDRCGN-LTPSC-ESFLKRVECYSRCSPLASRW-----AHRAHPSLLHHVPVCSHFCDSWFDACREDFTCVRNWIYDWDWSVEGNFCPGACVPFSQMFRDGRDLCEGFWGLALLPVAHGVEPCISPGDREGDITATATGAIVTSTVV 217          
BLAST of Folate receptor vs. Ensembl Nematostella
Match: EDO49768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFR7])

HSP 1 Score: 125.176 bits (313), Expect = 2.796e-34
Identity = 77/245 (31.43%), Postives = 121/245 (49.39%), Query Frame = 3
Query:  123 LILSSIIVMQCSEENRLIRMTTIQSF-NVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTA--HGFSYDHC--NRPMSSKCTKSFLNELCFYECSPDLGPWL-VKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNW--LVGFQWIKGRNICKHKCRTFSKIYGNARQFCESVWDHSWKI--AKTDNNCLSFSKDSSAIEQNHRVSIETAQ--------DIVRTIFS 803
            L++ +  +M        +    +  F NVC+  K HK  P  E +    C  WK  +CC  N +   E+  T   +   +D C   R MS+KC + F  + CFYECSP L PW+ V      +R+ERF   PLC SDC  W+  C+ DYTC+ NW  +  + W K  N CK +C+TF   +G+   FC  ++++S+K    K   +C+    + +    N +V+ + A+        D++R  F+
Sbjct:    4 LVILATAIMALPAVCYAVTDKQVNDFLNVCIDSKHHKEKPGPEVDYFHHCTPWKDHACCKSNTTKHIESDGTITLYRMRWDQCPQKRAMSAKCKRFFEMDTCFYECSPYLRPWIEVDPHSKVTRRERFTNVPLCSSDCDAWFEACKFDYTCSNNWGDMETWNWTKNGNDCKMECKTFKDYFGSPANFCNRLFNYSFKYISGKAGEDCMVLWPNGTNSRLNSQVARKYARKELSVSQSDVLRPRFA 248          
BLAST of Folate receptor vs. Ensembl Nematostella
Match: EDO49867 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REX3])

HSP 1 Score: 102.064 bits (253), Expect = 6.113e-26
Identity = 61/213 (28.64%), Postives = 102/213 (47.89%), Query Frame = 3
Query:  165 NRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQR--TAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNIC--KHKCRTFSKIYGNARQFCESVWDHSWKIAKTDNNCLSFSKDSSAIEQNHRVSIETAQDIVR 791
            ++ + +    + + C+ G  HK  P  E      C  WK +SCC  + + +    R  + +  +Y+HC   +S +C     NE CF++C P+L  W  K SG+  R      AP+C S C  W+  C++D TC  +WL GF +      C  K+KCRTF +I+ +    C ++W  S+K   ++ NC+  +            +I +A  I +
Sbjct:    3 DKTLVLKASYAVDTCIEGPLHKSKPGPEGPDYAECFPWKENSCCTADFTIQLAKDRVESLYNLTYNHCGN-LSQRCEAFVKNEECFWQCEPNLIKWH-KSSGIIDR------APICGSYCDAWFLACQDDMTCVQDWLNGFNYTSSTYTCPVKNKCRTFKEIFKSGEVLCNTMWGSSFKYEASNKNCMVMNFTGPNPNTKVSPTISSANTIAQ 207          
BLAST of Folate receptor vs. Ensembl Nematostella
Match: EDO47015 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN66])

HSP 1 Score: 96.6709 bits (239), Expect = 2.500e-24
Identity = 54/175 (30.86%), Postives = 87/175 (49.71%), Query Frame = 3
Query:  207 CMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHG-FSYDHCNRP-MSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWI-KGRNICKHKCRTFSKIYGNARQFCESVWDHSWKIAKTDNNCLSF 722
            C+     K +PS+  ++   C+ ++ +SCC    + +  +     G FS+  C +  +SSKC +  +   CFY CSP++  W        + K  F  APLC + C  W++ C++D TC  +WL GF +   G N CK  C+ FS+ Y N    C   W  S+K ++    CL+ 
Sbjct:    1 CLSTSTAKTSPSSNSDVFSACQVYQNNSCCSATFTQQLSSPVKGVGNFSWLQCGQAKLSSKCERFQVAVECFYRCSPNVAFWQ-----NPTYKAGFLGAPLCSNFCDDWFDACKDDLTCAEDWLTGFNYTSSGENTCKTPCKKFSEYYKNGTGLCTKQWGDSFKYSQKSGECLNL 170          
BLAST of Folate receptor vs. Ensembl Nematostella
Match: EDO43863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXK6])

HSP 1 Score: 83.1889 bits (204), Expect = 3.015e-19
Identity = 52/184 (28.26%), Postives = 94/184 (51.09%), Query Frame = 3
Query:  207 CMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTA--HGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIK-GRNIC--KHKCRTFSKIYGNARQFCESVWDHSWKIAKTDNNCLSFS-KDSSA 740
            C+ GK HK +P  E    G C+ ++ +SCC    + E  A RT   +  ++D C + +S  C + ++ + CFY+C P    ++ K   M S     +  P+C S C  W++ C+ND  C  + L G+++ + G N C     C+T++ ++ N    C  +W+ S+  +   + C+  + KD +A
Sbjct:    1 CIKGKYHKASPGPELGKFGECKVYEKNSCCTPEFTVELAATRTEKLYNHTWDLC-KNLSRACERFWIEQECFYQCDP----YIYKYQHMSSAG-AIHGVPICSSYCDSWFDACKNDQICVEDVLTGYEFNQHGINSCPVNSTCQTYASMFKNGEGLCNKMWNTSYTYSTDKSVCMEMTYKDPTA 178          
BLAST of Folate receptor vs. Ensembl Medaka
Match: folr (folate receptor alpha [Source:NCBI gene;Acc:101171932])

HSP 1 Score: 131.724 bits (330), Expect = 2.173e-36
Identity = 64/172 (37.21%), Postives = 93/172 (54.07%), Query Frame = 3
Query:  180 MTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRT-AHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKH--KCRTFSKIYGNARQFCESVWDHSW 686
            + ++   N+CM  K HK  P  E  L   C  W+ ++CC  N S E     +  + F+++HC   MS  C K F+ + CFYECSP LGPW ++ +    RKER    PLC  DC+ WW+DC+ND TC  +W  G+ W  G N C    KC  ++ ++   +  CE +W  S+
Sbjct:   15 VLSLDKLNMCMDAKHHKVEPGPEGQLYSQCSPWRENACCTANTSEEAHNDNSYLYKFNWNHCG-AMSDACKKHFIQDTCFYECSPHLGPW-IQEADQSWRKERIIDVPLCKEDCESWWSDCKNDTTCKTDWHKGWDWSSGTNKCPEGSKCSKWTDVFPTPKSMCEQIWSQSY 184          
BLAST of Folate receptor vs. Ensembl Medaka
Match: zgc:109949 (riboflavin-binding protein [Source:NCBI gene;Acc:101163821])

HSP 1 Score: 80.8777 bits (198), Expect = 2.662e-17
Identity = 63/206 (30.58%), Postives = 91/206 (44.17%), Query Frame = 3
Query:  105 MFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRP------MSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKIYGNARQFCESVWDHSWKIAKTD 704
            M    +LILS  I +  +    LI   + +    C+   KHK  PS EP LT  C  +  +SCC  +     + Q  +H  S  + N P      +SS+C        CFY CSPD   W         R+      PLC S C+ W++ CR D TC  NW    +  +G N C   C  + ++Y + R  CES+W  ++   + D
Sbjct:    1 MDVTSHLILSFCIYLAAA----LIGGASAE--GACLQDGKHKAKPSPEPYLTE-CGLYADNSCCTSD-----DIQDISHVPSVSNKNEPWDKCGPLSSECEGFLKRVSCFYRCSPDASRW-----PHPHRRSYIQAVPLCHSFCRDWFDACRMDMTCARNWA---RDPRGHN-CTGNCVQYQQMYQHGRDLCESLWGDAFMTVEDD 185          
BLAST of Folate receptor vs. Ensembl Medaka
Match: zgc:109949 (riboflavin-binding protein [Source:NCBI gene;Acc:101163821])

HSP 1 Score: 61.6178 bits (148), Expect = 1.197e-10
Identity = 60/202 (29.70%), Postives = 88/202 (43.56%), Query Frame = 3
Query:  105 MFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKIS--GMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKIYGNARQFCESVWDHSWKIAKTD 704
            M    +LILS  I +  +    LI   + +    C+   KHK  PS EP LT  C  +  +SCC  +     + Q  +H  S  + N P   KC     +E  F  C    G +L   S      R+      PLC S C+ W++ CR D TC  NW    +  +G N C   C  + ++Y + R  CES+W  ++   + D
Sbjct:    1 MDVTSHLILSFCIYLAAA----LIGGASAE--GACLQDGKHKAKPSPEPYLTE-CGLYADNSCCTSD-----DIQDISHVPSVSNKNEPWD-KCGP-LSSEYVFSLCDQCEG-FLKHASRWPHPHRRSYIQAVPLCHSFCRDWFDACRMDMTCARNWA---RDPRGHN-CTGNCVQYQQMYQHGRDLCESLWGDAFMTVEDD 183          
BLAST of Folate receptor vs. Planmine SMEST
Match: SMESG000004287.1 (SMESG000004287.1)

HSP 1 Score: 491.5 bits (1264), Expect = 5.891e-178
Identity = 235/236 (99.58%), Postives = 236/236 (100.00%), Query Frame = 3
Query:   96 MISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKIYGNARQFCESVWDHSWKIAKTDNNCLSFSKDSSAIEQNHRVSIETAQDIVRTIFS 803
            MISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKI+GNARQFCESVWDHSWKIAKTDNNCLSFSKDSSAIEQNHRVSIETAQDIVRTIFS
Sbjct:    1 MISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKIFGNARQFCESVWDHSWKIAKTDNNCLSFSKDSSAIEQNHRVSIETAQDIVRTIFS 236          
BLAST of Folate receptor vs. Planmine SMEST
Match: SMESG000004287.1 (SMESG000004287.1)

HSP 1 Score: 485.723 bits (1249), Expect = 1.125e-175
Identity = 232/233 (99.57%), Postives = 233/233 (100.00%), Query Frame = 3
Query:  105 MFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKIYGNARQFCESVWDHSWKIAKTDNNCLSFSKDSSAIEQNHRVSIETAQDIVRTIFS 803
            MFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKI+GNARQFCESVWDHSWKIAKTDNNCLSFSKDSSAIEQNHRVSIETAQDIVRTIFS
Sbjct:    1 MFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSAEPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKSFLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRNDYTCTPNWLVGFQWIKGRNICKHKCRTFSKIFGNARQFCESVWDHSWKIAKTDNNCLSFSKDSSAIEQNHRVSIETAQDIVRTIFS 233          
The following BLAST results are available for this feature:
BLAST of Folate receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOLR21.002e-4337.75folate receptor beta [Source:HGNC Symbol;Acc:HGNC:... [more]
FOLR22.558e-4335.37folate receptor beta [Source:HGNC Symbol;Acc:HGNC:... [more]
FOLR38.594e-4137.95folate receptor gamma [Source:HGNC Symbol;Acc:HGNC... [more]
FOLR29.905e-3937.31folate receptor beta [Source:HGNC Symbol;Acc:HGNC:... [more]
FOLR22.777e-3732.89folate receptor beta [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Folate receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Folate receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Folate receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
folr3.518e-3733.64folate receptor [Source:ZFIN;Acc:ZDB-GENE-070615-2... [more]
zgc:1099498.029e-1526.18zgc:109949 [Source:ZFIN;Acc:ZDB-GENE-050522-166][more]
back to top
BLAST of Folate receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
folr12.636e-3942.60folate receptor alpha [Source:NCBI gene;Acc:394697... [more]
folr18.612e-3943.11folate receptor alpha [Source:NCBI gene;Acc:394697... [more]
folr11.651e-3138.46folate receptor alpha [Source:NCBI gene;Acc:394697... [more]
coro62.241e-1928.73coronin 6 [Source:Xenbase;Acc:XB-GENE-493511][more]
prkch3.059e-622.16protein kinase C eta [Source:Xenbase;Acc:XB-GENE-4... [more]
back to top
BLAST of Folate receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Folr12.318e-4233.75folate receptor 1 (adult) [Source:MGI Symbol;Acc:M... [more]
Folr12.318e-4233.75folate receptor 1 (adult) [Source:MGI Symbol;Acc:M... [more]
Folr12.318e-4233.75folate receptor 1 (adult) [Source:MGI Symbol;Acc:M... [more]
Folr12.318e-4233.75folate receptor 1 (adult) [Source:MGI Symbol;Acc:M... [more]
Folr12.318e-4233.75folate receptor 1 (adult) [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Folate receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P14207|FOLR2_HUMAN1.228e-4235.37Folate receptor beta OS=Homo sapiens OX=9606 GN=FO... [more]
sp|P35846|FOLR1_MOUSE1.621e-4133.75Folate receptor alpha OS=Mus musculus OX=10090 GN=... [more]
sp|P41439|FOLR3_HUMAN4.127e-4037.95Folate receptor gamma OS=Homo sapiens OX=9606 GN=F... [more]
sp|Q05685|FOLR2_MOUSE3.779e-3735.89Folate receptor beta OS=Mus musculus OX=10090 GN=F... [more]
sp|P02702|FOLR1_BOVIN2.820e-3635.82Folate receptor alpha OS=Bos taurus OX=9913 GN=FOL... [more]
back to top
BLAST of Folate receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RH524.079e-5842.17G_PROTEIN_RECEP_F2_3 domain-containing protein OS=... [more]
A0A504Z9T67.171e-5443.52Folate receptor alpha OS=Fasciola gigantica OX=468... [more]
A0A4E0S1055.166e-5340.25Folate receptor OS=Fasciola hepatica OX=6192 GN=D9... [more]
A0A162DD411.374e-5241.05Folate receptor gamma OS=Daphnia magna OX=35525 GN... [more]
A0A4S2M3L02.645e-5239.13Folate_rec domain-containing protein OS=Opisthorch... [more]
back to top
BLAST of Folate receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
folr4.480e-3838.04folate receptor gamma [Source:NCBI gene;Acc:103026... [more]
folr4.695e-3837.84folate receptor gamma [Source:NCBI gene;Acc:103026... [more]
zgc:1099492.162e-1428.24riboflavin-binding protein-like [Source:NCBI gene;... [more]
zgc:1099492.162e-1428.24riboflavin-binding protein-like [Source:NCBI gene;... [more]
zgc:1099492.679e-1427.33riboflavin-binding protein-like [Source:NCBI gene;... [more]
back to top
BLAST of Folate receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
folr1.601e-4644.32folate receptor [Source:ZFIN;Acc:ZDB-GENE-070615-2... [more]
zgc:1099493.683e-1725.89zgc:109949 [Source:ZFIN;Acc:ZDB-GENE-050522-166][more]
back to top
BLAST of Folate receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Folate receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO497682.796e-3431.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498676.113e-2628.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470152.500e-2430.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438633.015e-1928.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Folate receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
folr2.173e-3637.21folate receptor alpha [Source:NCBI gene;Acc:101171... [more]
zgc:1099492.662e-1730.58riboflavin-binding protein [Source:NCBI gene;Acc:1... [more]
zgc:1099491.197e-1029.70riboflavin-binding protein [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Folate receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000004287.15.891e-17899.58SMESG000004287.1[more]
SMESG000004287.11.125e-17599.57SMESG000004287.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031359 ID=SMED30031359|Name=Folate receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=943bp
ATTTTATTTGTTTTACTATTTTGTCTCTTTAAAATTGTTTAAAATATAAA
GTAATGTTACATTTTTGTAGATAAAATTCAATATTTGCAAATGACATGAT
TTCTATGTTTTTCCCAATTAATCTAATATTAAGTTCAATTATTGTTATGC
AATGTTCTGAAGAAAACAGACTTATACGAATGACAACGATTCAAAGTTTT
AACGTATGCATGTTAGGAAAGAAACACAAACCAACTCCATCAGCTGAACC
AAATCTTACTGGAATTTGTGAGAAATGGAAAACAAGTAGTTGTTGTTTTC
ATAATGTTTCAAATGAATATGAGGCGCAGAGAACAGCTCATGGATTTTCT
TATGATCATTGCAATCGTCCAATGTCTTCAAAGTGTACCAAATCATTTTT
AAATGAACTGTGCTTTTACGAATGTTCGCCGGATCTAGGGCCTTGGCTAG
TAAAAATATCCGGAATGAAATCCAGAAAAGAAAGATTCTACAAAGCTCCA
TTATGTCCATCTGATTGCCAAAAATGGTGGAATGATTGTCGCAATGACTA
CACCTGTACTCCAAATTGGCTTGTAGGTTTTCAATGGATCAAAGGTCGTA
ATATTTGCAAACATAAATGTCGAACATTTTCAAAAATATATGGAAATGCT
AGGCAATTTTGTGAAAGTGTATGGGATCATTCATGGAAAATCGCCAAAAC
CGATAACAACTGTTTGAGTTTTTCTAAAGACAGTTCAGCTATCGAACAAA
ATCATCGTGTTTCTATAGAAACTGCTCAAGACATTGTGCGTACTATTTTT
AGTTGAAAGATTTTTTGTTGAATTTATCATGTTTGTGATGTTATTTTCTG
TTACAGTCATTTGTAACTGTTAATTTTTGCATTTATGTGTCTAAGAATTT
TGTTTGATTCTTAATAGAATTAATTTTTTAGCTAAATTATCTT
back to top

protein sequence of SMED30031359-orf-1

>SMED30031359-orf-1 ID=SMED30031359-orf-1|Name=SMED30031359-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=237bp
MISMFFPINLILSSIIVMQCSEENRLIRMTTIQSFNVCMLGKKHKPTPSA
EPNLTGICEKWKTSSCCFHNVSNEYEAQRTAHGFSYDHCNRPMSSKCTKS
FLNELCFYECSPDLGPWLVKISGMKSRKERFYKAPLCPSDCQKWWNDCRN
DYTCTPNWLVGFQWIKGRNICKHKCRTFSKIYGNARQFCESVWDHSWKIA
KTDNNCLSFSKDSSAIEQNHRVSIETAQDIVRTIFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005542folic acid binding
GO:0061714folic acid receptor activity
Vocabulary: biological process
TermDefinition
GO:0071231cellular response to folic acid
GO:1904447folic acid import across plasma membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR004269Folate_rcpt
IPR018143Folate_rcpt-like
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018143Folate receptor-likePFAMPF03024Folate_reccoord: 37..207
e-value: 1.1E-43
score: 149.1
NoneNo IPR availablePANTHERPTHR10517:SF14ZGC:165502coord: 12..228
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.554
IPR004269Folate receptorPANTHERPTHR10517FOLATE RECEPTORcoord: 12..228