ATP synthase-coupling factor 6, mitochondrial

Overview
NameATP synthase-coupling factor 6, mitochondrial
Smed IDSMED30031354
Length (bp)469
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP synthase-coupling factor 6, mitochondrial (SMED30031354) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP synthase-coupling factor 6, mitochondrial (SMED30031354) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP synthase-coupling factor 6, mitochondrial (SMED30031354) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP synthase-coupling factor 6, mitochondrial (SMED30031354) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031354

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30031354SMESG000038869.1 dd_Smed_v4_1046_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031354SMESG000038869.1 dd_Smed_v4_1046_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031354SMESG000038869.1 OX_Smed_1.0.03638ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Fly
Match: ATPsynCF6 (gene:FBgn0016119 transcript:FBtr0333777)

HSP 1 Score: 48.9062 bits (115), Expect = 5.057e-8
Identity = 32/96 (33.33%), Postives = 52/96 (54.17%), Query Frame = 3
Query:   66 LSISKLNVIRCFATGSR----------NPSSDPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKG-ADMESFPQFSFKD 320
            LS S L+ +R   T +R          N +SDPIQ LFL ++RE+++KS+  +  LV ++    +  +  +DR+   + + G  DM  FP+F F D
Sbjct:    2 LSQSLLSGMRVLRTEARRNFGIVAPALNKASDPIQQLFLDKVREYKQKSAGGK--LVDSNPDIERELKTELDRVAKQFGSDGKTDMLKFPEFQFPD 95          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Fly
Match: ATPsynCF6 (gene:FBgn0016119 transcript:FBtr0084432)

HSP 1 Score: 48.9062 bits (115), Expect = 5.057e-8
Identity = 32/96 (33.33%), Postives = 52/96 (54.17%), Query Frame = 3
Query:   66 LSISKLNVIRCFATGSR----------NPSSDPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKG-ADMESFPQFSFKD 320
            LS S L+ +R   T +R          N +SDPIQ LFL ++RE+++KS+  +  LV ++    +  +  +DR+   + + G  DM  FP+F F D
Sbjct:    2 LSQSLLSGMRVLRTEARRNFGIVAPALNKASDPIQQLFLDKVREYKQKSAGGK--LVDSNPDIERELKTELDRVAKQFGSDGKTDMLKFPEFQFPD 95          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Fly
Match: ATPsynCF6 (gene:FBgn0016119 transcript:FBtr0305982)

HSP 1 Score: 48.9062 bits (115), Expect = 5.057e-8
Identity = 32/96 (33.33%), Postives = 52/96 (54.17%), Query Frame = 3
Query:   66 LSISKLNVIRCFATGSR----------NPSSDPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKG-ADMESFPQFSFKD 320
            LS S L+ +R   T +R          N +SDPIQ LFL ++RE+++KS+  +  LV ++    +  +  +DR+   + + G  DM  FP+F F D
Sbjct:    2 LSQSLLSGMRVLRTEARRNFGIVAPALNKASDPIQQLFLDKVREYKQKSAGGK--LVDSNPDIERELKTELDRVAKQFGSDGKTDMLKFPEFQFPD 95          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Zebrafish
Match: atp5pf (ATP synthase peripheral stalk subunit F6 [Source:ZFIN;Acc:ZDB-GENE-040426-2534])

HSP 1 Score: 52.373 bits (124), Expect = 3.213e-9
Identity = 29/73 (39.73%), Postives = 41/73 (56.16%), Query Frame = 3
Query:  129 DPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLEDPRPK 347
            DPIQ LFL +IR++  K SKA  G+V A  V  K   +   ++  +Y   G D+  FPQFSF +  L++   K
Sbjct:   40 DPIQKLFLDKIRDYNSK-SKASGGVVDAGPVYQKNLAEETTKLQRLYG--GGDLSKFPQFSFTEPKLDETTTK 109          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Zebrafish
Match: atp5pf (ATP synthase peripheral stalk subunit F6 [Source:ZFIN;Acc:ZDB-GENE-040426-2534])

HSP 1 Score: 52.373 bits (124), Expect = 3.213e-9
Identity = 29/73 (39.73%), Postives = 41/73 (56.16%), Query Frame = 3
Query:  129 DPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLEDPRPK 347
            DPIQ LFL +IR++  K SKA  G+V A  V  K   +   ++  +Y   G D+  FPQFSF +  L++   K
Sbjct:   40 DPIQKLFLDKIRDYNSK-SKASGGVVDAGPVYQKNLAEETTKLQRLYG--GGDLSKFPQFSFTEPKLDETTTK 109          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Zebrafish
Match: atp5pf (ATP synthase peripheral stalk subunit F6 [Source:ZFIN;Acc:ZDB-GENE-040426-2534])

HSP 1 Score: 52.373 bits (124), Expect = 3.213e-9
Identity = 29/73 (39.73%), Postives = 41/73 (56.16%), Query Frame = 3
Query:  129 DPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLEDPRPK 347
            DPIQ LFL +IR++  K SKA  G+V A  V  K   +   ++  +Y   G D+  FPQFSF +  L++   K
Sbjct:   40 DPIQKLFLDKIRDYNSK-SKASGGVVDAGPVYQKNLAEETTKLQRLYG--GGDLSKFPQFSFTEPKLDETTTK 109          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Zebrafish
Match: atp5pf (ATP synthase peripheral stalk subunit F6 [Source:ZFIN;Acc:ZDB-GENE-040426-2534])

HSP 1 Score: 49.6766 bits (117), Expect = 3.929e-8
Identity = 27/62 (43.55%), Postives = 36/62 (58.06%), Query Frame = 3
Query:  129 DPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSF 314
            DPIQ LFL +IR++  K SKA  G+V A  V  K   +   ++  +Y   G D+  FPQFSF
Sbjct:   40 DPIQKLFLDKIRDYNSK-SKASGGVVDAGPVYQKNLAEETTKLQRLYG--GGDLSKFPQFSF 98          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Zebrafish
Match: si:dkey-22n8.3 (si:dkey-22n8.3 [Source:ZFIN;Acc:ZDB-GENE-110914-188])

HSP 1 Score: 46.595 bits (109), Expect = 2.487e-7
Identity = 27/69 (39.13%), Postives = 40/69 (57.97%), Query Frame = 3
Query:  129 DPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLED 335
            DPIQ LFL +IRE+  K S+A  G V A A   K F + + ++  +Y   G D+ +FP F F +  L++
Sbjct:    8 DPIQRLFLHKIREYSTK-SQASAGPVDAGADYEKAFSEELSKLQRLY--GGGDLTNFPGFKFSEPVLDE 73          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. UniProt/SwissProt
Match: sp|Q24407|ATP5J_DROME (ATP synthase-coupling factor 6, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsynCF6 PE=3 SV=1)

HSP 1 Score: 48.9062 bits (115), Expect = 5.070e-7
Identity = 32/96 (33.33%), Postives = 52/96 (54.17%), Query Frame = 3
Query:   66 LSISKLNVIRCFATGSR----------NPSSDPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKG-ADMESFPQFSFKD 320
            LS S L+ +R   T +R          N +SDPIQ LFL ++RE+++KS+  +  LV ++    +  +  +DR+   + + G  DM  FP+F F D
Sbjct:    2 LSQSLLSGMRVLRTEARRNFGIVAPALNKASDPIQQLFLDKVREYKQKSAGGK--LVDSNPDIERELKTELDRVAKQFGSDGKTDMLKFPEFQFPD 95          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. TrEMBL
Match: A0A0R3T742 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2879 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 8.371e-17
Identity = 46/123 (37.40%), Postives = 72/123 (58.54%), Query Frame = 3
Query:   66 LSISKLNVIRCF-----ATGSRNPSSDPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLEDPRPKAKLTIPVCYQLE--ENNKVIDNLL 413
            L + +L  +R F     AT +   + DPIQ  F++++RE++ KS  AE GLVGAS  +IK  +DS+ ++D V++AKGADM  FP    K+  L +P     +  P    LE  E ++ +D++L
Sbjct:    4 LVLGRLFYVRSFSVFQRATFATQQAVDPIQRAFVEKLREYQMKSKTAEMGLVGASETQIKELKDSLGKLDNVFNAKGADMTQFPILQHKEPELTNPGSSIVVEYPEPVLLEDVEKSERLDDVL 126          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. TrEMBL
Match: A0A0R3W6S9 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5924 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.072e-16
Identity = 36/79 (45.57%), Postives = 55/79 (69.62%), Query Frame = 3
Query:  102 ATGSRNPSSDPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLEDP 338
            AT +  P +DPIQ  F++++RE++ KS  AE GLVGAS  +IK+ +DS++++D V++AKG DM  FP    K+  L +P
Sbjct:   21 ATFATQPVADPIQRAFVEKLREYQGKSRTAEMGLVGASEAQIKSLKDSLEKLDNVFNAKGVDMTQFPVLQHKEPELANP 99          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. TrEMBL
Match: A0A0R3SFF0 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3560 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.449e-16
Identity = 38/96 (39.58%), Postives = 60/96 (62.50%), Query Frame = 3
Query:   66 LSISKLNVIRCFATGSR-----NPSSDPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLEDP 338
            L   +L  +R F+T  R       + DPIQ  F++++RE++EKS  AE GLVGA+  ++K  +DS++++D V++AKG DM  FP    K+  L +P
Sbjct:    4 LVCGRLFAVRAFSTVQRATFATQQAVDPIQRAFVEKLREYQEKSRTAEMGLVGATETQVKNLKDSLEKLDNVFNAKGVDMTQFPVLQHKEPELINP 99          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. TrEMBL
Match: A0A0R3WJ50 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS679 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.135e-16
Identity = 38/98 (38.78%), Postives = 63/98 (64.29%), Query Frame = 3
Query:  126 SDPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLEDPRPKAKLTIPVCYQLEENNKV--IDNLL 413
            +DPIQ  F++++RE++ KS  AE GLVGAS  +IK+ +DS++++D V++AKG DM  FP   +K+  L +P     +  P    L++  K+  +D +L
Sbjct:   29 ADPIQRAFVEKLREYQGKSKTAEMGLVGASQAQIKSLKDSLEKLDNVFNAKGVDMTQFPVLQYKEPELVNPGSSIVVEYPPAEPLQDVEKIERMDGIL 126          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. TrEMBL
Match: U6JIX2 (ATPase F0 complex subunit F6 mitochondrial OS=Echinococcus granulosus OX=6210 GN=EGR_08199 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.938e-16
Identity = 40/96 (41.67%), Postives = 60/96 (62.50%), Query Frame = 3
Query:   66 LSISKLNVIRCF-----ATGSRNPSSDPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLEDP 338
            L  S+L   R F     AT +  P +DPIQ  F++++RE++ KS  AE GLV AS  +IK+ +DS++++D V++AKG DM  FP    K+  L +P
Sbjct:    4 LRCSRLLASRAFSITQRATFATQPVADPIQRAFVEKLREYQGKSKTAEMGLVEASQAQIKSLKDSLEKLDKVFNAKGVDMTQFPVLQHKEPELVNP 99          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Cavefish
Match: ENSAMXT00000012773.2 (uncharacterized LOC103024042 [Source:NCBI gene;Acc:103024042])

HSP 1 Score: 46.595 bits (109), Expect = 2.936e-6
Identity = 27/73 (36.99%), Postives = 42/73 (57.53%), Query Frame = 3
Query:  129 DPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLEDPRPK 347
            DPI+ LFL +IRE+  K SKA  GLV A     + F + + ++  +Y     D+ +FP+F F +  L++  PK
Sbjct:  505 DPIKRLFLDKIREYSTK-SKAHDGLVDAGPEYEREFSEELAKLQRLY--GNGDLTAFPEFEFPEPVLDEFNPK 574          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Cavefish
Match: si:ch211-140m22.7 (skin secretory protein xP2-like [Source:NCBI gene;Acc:103025933])

HSP 1 Score: 45.0542 bits (105), Expect = 3.495e-6
Identity = 25/69 (36.23%), Postives = 39/69 (56.52%), Query Frame = 3
Query:  129 DPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLED 335
            DPIQ LFL  IR++  +S K+  GLV A     K   + + ++  +Y   G D+ SFP+F F +  L++
Sbjct:   84 DPIQRLFLDSIRDYSTQS-KSSGGLVDAGPEYQKALAEEIAKLQRLYG--GGDLNSFPEFKFPEPKLDE 149          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Cavefish
Match: atp5pf (ATP synthase peripheral stalk subunit F6 [Source:NCBI gene;Acc:103041413])

HSP 1 Score: 43.5134 bits (101), Expect = 5.487e-6
Identity = 23/69 (33.33%), Postives = 38/69 (55.07%), Query Frame = 3
Query:  129 DPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLED 335
            DP+Q +F+ +IRE+  K SK+  G+V A     K   + + ++  +Y   G D+  FP F F +  LE+
Sbjct:   39 DPVQKMFVDKIREYNSK-SKSAGGVVDAGPSYQKNMTEEITKLQRLYG--GGDLTKFPDFKFPEPKLEE 104          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Medaka
Match: si:ch211-140m22.7 (fibrous sheath CABYR-binding protein [Source:NCBI gene;Acc:101171978])

HSP 1 Score: 51.9878 bits (123), Expect = 4.014e-8
Identity = 28/69 (40.58%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  129 DPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLED 335
            DPIQ LFL  IR++  +S +A  GL+ A A   KT  + + ++  +Y   G D+ESFP+FSF +  L++
Sbjct:  433 DPIQKLFLDSIRQYSSES-RAAGGLLDAGADYQKTVAEEVAKLQRLYG--GGDLESFPEFSFPEPRLDE 498          
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Planmine SMEST
Match: SMESG000038869.1 (SMESG000038869.1)

HSP 1 Score: 274.633 bits (701), Expect = 1.767e-96
Identity = 133/133 (100.00%), Postives = 133/133 (100.00%), Query Frame = 3
Query:   45 MILNTVKLSISKLNVIRCFATGSRNPSSDPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLEDPRPKAKLTIPVCYQLEENNKVIDNLLDISNDVDYFH 443
            MILNTVKLSISKLNVIRCFATGSRNPSSDPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLEDPRPKAKLTIPVCYQLEENNKVIDNLLDISNDVDYFH
Sbjct:    1 MILNTVKLSISKLNVIRCFATGSRNPSSDPIQNLFLKRIREFREKSSKAEFGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLEDPRPKAKLTIPVCYQLEENNKVIDNLLDISNDVDYFH 133          
The following BLAST results are available for this feature:
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ATPsynCF65.057e-833.33gene:FBgn0016119 transcript:FBtr0333777[more]
ATPsynCF65.057e-833.33gene:FBgn0016119 transcript:FBtr0084432[more]
ATPsynCF65.057e-833.33gene:FBgn0016119 transcript:FBtr0305982[more]
back to top
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp5pf3.213e-939.73ATP synthase peripheral stalk subunit F6 [Source:Z... [more]
atp5pf3.213e-939.73ATP synthase peripheral stalk subunit F6 [Source:Z... [more]
atp5pf3.213e-939.73ATP synthase peripheral stalk subunit F6 [Source:Z... [more]
atp5pf3.929e-843.55ATP synthase peripheral stalk subunit F6 [Source:Z... [more]
si:dkey-22n8.32.487e-739.13si:dkey-22n8.3 [Source:ZFIN;Acc:ZDB-GENE-110914-18... [more]
back to top
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q24407|ATP5J_DROME5.070e-733.33ATP synthase-coupling factor 6, mitochondrial OS=D... [more]
back to top
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3T7428.371e-1737.40Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3W6S91.072e-1645.57Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0R3SFF01.449e-1639.58Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3WJ502.135e-1638.78Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
U6JIX24.938e-1641.67ATPase F0 complex subunit F6 mitochondrial OS=Echi... [more]
back to top
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000012773.22.936e-636.99uncharacterized LOC103024042 [Source:NCBI gene;Acc... [more]
si:ch211-140m22.73.495e-636.23skin secretory protein xP2-like [Source:NCBI gene;... [more]
atp5pf5.487e-633.33ATP synthase peripheral stalk subunit F6 [Source:N... [more]
back to top
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-140m22.74.014e-840.58fibrous sheath CABYR-binding protein [Source:NCBI ... [more]
back to top
BLAST of ATP synthase-coupling factor 6, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000038869.11.767e-96100.00SMESG000038869.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031354 ID=SMED30031354|Name=ATP synthase-coupling factor 6, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=469bp
GGATTATTAAGTAAATCAGTAATTAAAATAATAAATTAAATGACATGATC
CTAAACACTGTAAAATTATCGATATCCAAACTAAATGTCATAAGATGTTT
TGCCACCGGGTCAAGAAATCCTTCATCTGATCCAATTCAAAATTTATTTC
TTAAGCGTATTCGAGAATTCCGAGAGAAATCCAGCAAAGCAGAATTCGGT
TTGGTTGGTGCATCAGCAGTTGAAATAAAAACATTTCAGGATTCAATGGA
TCGAATAGATGCAGTTTACCATGCAAAGGGTGCCGATATGGAATCATTTC
CTCAATTTAGTTTCAAAGATGAAAATCTTGAAGATCCGAGACCGAAAGCC
AAATTAACAATACCCGTTTGTTATCAACTGGAAGAAAATAATAAAGTTAT
CGACAACCTACTCGATATTTCAAACGATGTTGATTATTTCCACTAGTTTA
ATATTAATAAATTGTTAGA
back to top

protein sequence of SMED30031354-orf-1

>SMED30031354-orf-1 ID=SMED30031354-orf-1|Name=SMED30031354-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=134bp
MILNTVKLSISKLNVIRCFATGSRNPSSDPIQNLFLKRIREFREKSSKAE
FGLVGASAVEIKTFQDSMDRIDAVYHAKGADMESFPQFSFKDENLEDPRP
KAKLTIPVCYQLEENNKVIDNLLDISNDVDYFH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
GO:0000276mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0015986ATP synthesis coupled proton transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036204ATP_synth_f6_sf_mt
IPR008387ATP_synth_f6_mt
Vocabulary: molecular function
TermDefinition
GO:0015078hydrogen ion transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036204ATP synthase-coupling factor 6 superfamily, mitochondrialGENE3DG3DSA:1.10.246.110coord: 31..96
e-value: 2.0E-12
score: 49.5
IPR036204ATP synthase-coupling factor 6 superfamily, mitochondrialSUPERFAMILYSSF111357Mitochondrial ATP synthase coupling factor 6coord: 27..97
IPR008387ATP synthase-coupling factor 6, mitochondrialPFAMPF05511ATP-synt_F6coord: 25..92
e-value: 1.7E-12
score: 47.6
IPR008387ATP synthase-coupling factor 6, mitochondrialPANTHERPTHR12441ATP SYNTHASE COUPLING FACTOR 6, MITOCHONDRIALcoord: 25..99