GATA-binding factor 2

Overview
NameGATA-binding factor 2
Smed IDSMED30031351
Length (bp)1350
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GATA-binding factor 2 (SMED30031351) t-SNE clustered cells

Violin plots show distribution of expression levels for GATA-binding factor 2 (SMED30031351) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GATA-binding factor 2 (SMED30031351) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GATA-binding factor 2 (SMED30031351) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031351

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30031351SMESG000028503.1 dd_Smed_v4_8208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031351SMESG000028503.1 dd_Smed_v4_8208_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric musculatureSMED30031351SMESG000028503.1 dd_Smed_v4_8208_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
enteric musculatureSMED30031351SMESG000028503.1 dd_Smed_v4_8208_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
enteric musculatureSMED30031351SMESG000028503.1 dd_Smed_v4_8208_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30031351SMESG000028503.1 dd_Smed_v4_8208_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031351SMESG000028503.1 dd_Smed_v4_8208_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30031351SMESG000028503.1 dd_Smed_v4_8208_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GATA-binding factor 2 vs. Ensembl Human
Match: GATA3 (GATA binding protein 3 [Source:HGNC Symbol;Acc:HGNC:4172])

HSP 1 Score: 177.178 bits (448), Expect = 6.812e-50
Identity = 86/104 (82.69%), Postives = 97/104 (93.27%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  261 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 364          

HSP 2 Score: 56.6102 bits (135), Expect = 4.395e-8
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  315 GTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR 367          
BLAST of GATA-binding factor 2 vs. Ensembl Human
Match: GATA3 (GATA binding protein 3 [Source:HGNC Symbol;Acc:HGNC:4172])

HSP 1 Score: 177.178 bits (448), Expect = 6.881e-50
Identity = 86/104 (82.69%), Postives = 97/104 (93.27%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  260 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 363          

HSP 2 Score: 56.6102 bits (135), Expect = 4.625e-8
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  314 GTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR 366          
BLAST of GATA-binding factor 2 vs. Ensembl Human
Match: GATA2 (GATA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:4171])

HSP 1 Score: 175.252 bits (443), Expect = 6.492e-49
Identity = 87/104 (83.65%), Postives = 96/104 (92.31%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA  TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+V+RP TMKKEGIQT
Sbjct:  292 GRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 395          

HSP 2 Score: 54.6842 bits (130), Expect = 2.337e-7
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  346 GTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 398          
BLAST of GATA-binding factor 2 vs. Ensembl Human
Match: GATA2 (GATA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:4171])

HSP 1 Score: 175.252 bits (443), Expect = 6.492e-49
Identity = 87/104 (83.65%), Postives = 96/104 (92.31%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA  TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+V+RP TMKKEGIQT
Sbjct:  292 GRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 395          

HSP 2 Score: 54.6842 bits (130), Expect = 2.337e-7
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  346 GTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 398          
BLAST of GATA-binding factor 2 vs. Ensembl Human
Match: GATA4 (GATA binding protein 4 [Source:HGNC Symbol;Acc:HGNC:4173])

HSP 1 Score: 168.318 bits (425), Expect = 7.671e-49
Identity = 83/104 (79.81%), Postives = 91/104 (87.50%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA++TPLWRRDG G+YLCNACGLY KMNG NRPLIKP+RRLSASRR G  C+NC T+TTTLWRRN+ GEPVCNACGLY KLH V RP  M+KEGIQT
Sbjct:    8 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 111          

HSP 2 Score: 57.3806 bits (137), Expect = 8.236e-9
Identity = 24/53 (45.28%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+ +G  +CNACGLY K++G  RPL   K  +   +R
Sbjct:   62 GLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKR 114          
BLAST of GATA-binding factor 2 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 155.606 bits (392), Expect = 1.299e-42
Identity = 78/103 (75.73%), Postives = 84/103 (81.55%), Query Frame = 2
Query:  515 RECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            RECVNCG  NTPLWRRDG GNYLCNACGLY KMN   RPL+KPK+R +A +RTG  C NC T+TTTLWRRN  G PVCNACGLYFKLH V RP TMKK+GIQT
Sbjct:  215 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPKKRQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 317          

HSP 2 Score: 58.5362 bits (140), Expect = 3.746e-9
Identity = 31/62 (50.00%), Postives = 39/62 (62.90%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPK-------RRLSA--SRR 670
            G ECVNC    T LWRR+G+G+ +CNACGLY K++   RP+   K       R+LSA  SRR
Sbjct:  268 GIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQTRNRKLSAKGSRR 329          
BLAST of GATA-binding factor 2 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 156.377 bits (394), Expect = 2.635e-42
Identity = 78/103 (75.73%), Postives = 84/103 (81.55%), Query Frame = 2
Query:  515 RECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            RECVNCG  NTPLWRRDG GNYLCNACGLY KMN   RPL+KPK+R +A +RTG  C NC T+TTTLWRRN  G PVCNACGLYFKLH V RP TMKK+GIQT
Sbjct:  287 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPKKRQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 389          

HSP 2 Score: 59.3066 bits (142), Expect = 2.923e-9
Identity = 31/62 (50.00%), Postives = 39/62 (62.90%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPK-------RRLSA--SRR 670
            G ECVNC    T LWRR+G+G+ +CNACGLY K++   RP+   K       R+LSA  SRR
Sbjct:  340 GIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQTRNRKLSAKGSRR 401          
BLAST of GATA-binding factor 2 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 150.984 bits (380), Expect = 7.020e-41
Identity = 78/104 (75.00%), Postives = 84/104 (80.77%), Query Frame = 2
Query:  515 RECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRR-LSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            RECVNCG  NTPLWRRDG GNYLCNACGLY KMN   RPL+KPK+R  +A +RTG  C NC T+TTTLWRRN  G PVCNACGLYFKLH V RP TMKK+GIQT
Sbjct:  215 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPKKRQQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 318          

HSP 2 Score: 58.9214 bits (141), Expect = 3.722e-9
Identity = 31/62 (50.00%), Postives = 39/62 (62.90%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPK-------RRLSA--SRR 670
            G ECVNC    T LWRR+G+G+ +CNACGLY K++   RP+   K       R+LSA  SRR
Sbjct:  269 GIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQTRNRKLSAKGSRR 330          
BLAST of GATA-binding factor 2 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 151.754 bits (382), Expect = 1.278e-40
Identity = 78/104 (75.00%), Postives = 84/104 (80.77%), Query Frame = 2
Query:  515 RECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRR-LSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            RECVNCG  NTPLWRRDG GNYLCNACGLY KMN   RPL+KPK+R  +A +RTG  C NC T+TTTLWRRN  G PVCNACGLYFKLH V RP TMKK+GIQT
Sbjct:  286 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPKKRQQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 389          

HSP 2 Score: 59.3066 bits (142), Expect = 2.923e-9
Identity = 31/62 (50.00%), Postives = 39/62 (62.90%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPK-------RRLSA--SRR 670
            G ECVNC    T LWRR+G+G+ +CNACGLY K++   RP+   K       R+LSA  SRR
Sbjct:  340 GIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQTRNRKLSAKGSRR 401          
BLAST of GATA-binding factor 2 vs. Ensembl Celegans
Match: elt-1 (Transcription factor elt-1 [Source:UniProtKB/Swiss-Prot;Acc:P28515])

HSP 1 Score: 151.754 bits (382), Expect = 1.285e-40
Identity = 78/104 (75.00%), Postives = 84/104 (80.77%), Query Frame = 2
Query:  515 RECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRR-LSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            RECVNCG  NTPLWRRDG GNYLCNACGLY KMN   RPL+KPK+R  +A +RTG  C NC T+TTTLWRRN  G PVCNACGLYFKLH V RP TMKK+GIQT
Sbjct:  287 RECVNCGVHNTPLWRRDGSGNYLCNACGLYFKMNHHARPLVKPKKRQQNAQKRTGIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQT 390          

HSP 2 Score: 59.3066 bits (142), Expect = 3.007e-9
Identity = 31/62 (50.00%), Postives = 39/62 (62.90%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPK-------RRLSA--SRR 670
            G ECVNC    T LWRR+G+G+ +CNACGLY K++   RP+   K       R+LSA  SRR
Sbjct:  341 GIECVNCRTNTTTLWRRNGEGHPVCNACGLYFKLHKVERPITMKKDGIQTRNRKLSAKGSRR 402          
BLAST of GATA-binding factor 2 vs. Ensembl Fly
Match: grn (gene:FBgn0001138 transcript:FBtr0081808)

HSP 1 Score: 168.318 bits (425), Expect = 1.244e-46
Identity = 86/110 (78.18%), Postives = 97/110 (88.18%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRL------SASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRL      SA++R GT C+NC T+TTTLWRRN++GEPVCNACGLY+KLH+V+RP TMKKEGIQT
Sbjct:  258 GRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQT 367          

HSP 2 Score: 55.8398 bits (133), Expect = 4.154e-8
Identity = 24/53 (45.28%), Postives = 29/53 (54.72%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G  +CNACGLY K++  NRPL   K  +    R
Sbjct:  318 GTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 370          
BLAST of GATA-binding factor 2 vs. Ensembl Fly
Match: pnr (gene:FBgn0003117 transcript:FBtr0335426)

HSP 1 Score: 169.088 bits (427), Expect = 1.707e-46
Identity = 79/104 (75.96%), Postives = 92/104 (88.46%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA++TPLWRRDG G+YLCNACGLY KMNG NRPLIKP +RL+A+RR G  C+NC T TTTLWRRN++GEPVCNACGLY+KLH V+RP  M+K+GIQT
Sbjct:  166 GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPSKRLTATRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQT 269          

HSP 2 Score: 60.077 bits (144), Expect = 2.065e-9
Identity = 26/53 (49.06%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NCG   T LWRR+  G  +CNACGLY K++G NRPL   K  +   +R
Sbjct:  220 GLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQTRKR 272          
BLAST of GATA-binding factor 2 vs. Ensembl Fly
Match: grn (gene:FBgn0001138 transcript:FBtr0300040)

HSP 1 Score: 170.244 bits (430), Expect = 4.790e-46
Identity = 86/110 (78.18%), Postives = 97/110 (88.18%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRL------SASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRL      SA++R GT C+NC T+TTTLWRRN++GEPVCNACGLY+KLH+V+RP TMKKEGIQT
Sbjct:  471 GRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQT 580          

HSP 2 Score: 56.225 bits (134), Expect = 4.190e-8
Identity = 24/53 (45.28%), Postives = 29/53 (54.72%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G  +CNACGLY K++  NRPL   K  +    R
Sbjct:  531 GTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 583          
BLAST of GATA-binding factor 2 vs. Ensembl Fly
Match: grn (gene:FBgn0001138 transcript:FBtr0330188)

HSP 1 Score: 169.859 bits (429), Expect = 6.645e-46
Identity = 86/110 (78.18%), Postives = 97/110 (88.18%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRL------SASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRL      SA++R GT C+NC T+TTTLWRRN++GEPVCNACGLY+KLH+V+RP TMKKEGIQT
Sbjct:  471 GRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLTLQSLQSAAKRAGTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQT 580          

HSP 2 Score: 56.225 bits (134), Expect = 4.077e-8
Identity = 24/53 (45.28%), Postives = 29/53 (54.72%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G  +CNACGLY K++  NRPL   K  +    R
Sbjct:  531 GTSCANCKTTTTTLWRRNASGEPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 583          
BLAST of GATA-binding factor 2 vs. Ensembl Fly
Match: pnr (gene:FBgn0003117 transcript:FBtr0335427)

HSP 1 Score: 163.31 bits (412), Expect = 9.934e-45
Identity = 79/107 (73.83%), Postives = 92/107 (85.98%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRL---SASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA++TPLWRRDG G+YLCNACGLY KMNG NRPLIKP +RL   +A+RR G  C+NC T TTTLWRRN++GEPVCNACGLY+KLH V+RP  M+K+GIQT
Sbjct:  114 GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPSKRLVSATATRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQT 220          

HSP 2 Score: 59.6918 bits (143), Expect = 2.414e-9
Identity = 26/53 (49.06%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NCG   T LWRR+  G  +CNACGLY K++G NRPL   K  +   +R
Sbjct:  171 GLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMRKDGIQTRKR 223          
BLAST of GATA-binding factor 2 vs. Ensembl Zebrafish
Match: gata2b (GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040718-440])

HSP 1 Score: 178.333 bits (451), Expect = 1.194e-50
Identity = 101/129 (78.29%), Postives = 112/129 (86.82%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTXXXXXXXXXXXXXXEELDYFKSSNH 898
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLI+PKRRLSASRR GT C+NC T TTTLWRRN+NGEPVCNACGLY+KLH+V+RP TMKK+GIQTRNRK+S KSK+RR E    F S  H
Sbjct:  262 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKRRLSASRRAGTCCANCQTGTTTLWRRNANGEPVCNACGLYYKLHNVNRPLTMKKDGIQTRNRKMSGKSKKRRGEHFHQFDSCVH 390          
BLAST of GATA-binding factor 2 vs. Ensembl Zebrafish
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:30458])

HSP 1 Score: 178.333 bits (451), Expect = 1.243e-50
Identity = 99/150 (66.00%), Postives = 116/150 (77.33%), Query Frame = 2
Query:  374 SYFPSISNNDYASESGCNIFPNXXXXXXXXXXXXXXXXXXXXXXXXGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            ++ P  +   Y  + G  +FP S     S SS       K  SS+EGRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  207 AHHPIATYPSYVPDYGPGLFPPSSLIGGSSSSYGSKTRPKTRSSSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 356          
BLAST of GATA-binding factor 2 vs. Ensembl Zebrafish
Match: gata2a (GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-980526-260])

HSP 1 Score: 176.022 bits (445), Expect = 1.412e-49
Identity = 87/104 (83.65%), Postives = 96/104 (92.31%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN NG+PVCNACGLY+KLH+V+RP TMKKEGIQT
Sbjct:  268 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 371          
BLAST of GATA-binding factor 2 vs. Ensembl Zebrafish
Match: gata2a (GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-980526-260])

HSP 1 Score: 176.022 bits (445), Expect = 1.515e-49
Identity = 87/104 (83.65%), Postives = 96/104 (92.31%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN NG+PVCNACGLY+KLH+V+RP TMKKEGIQT
Sbjct:  272 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 375          
BLAST of GATA-binding factor 2 vs. Ensembl Zebrafish
Match: gata4 (GATA binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-980526-476])

HSP 1 Score: 169.088 bits (427), Expect = 5.487e-48
Identity = 83/104 (79.81%), Postives = 91/104 (87.50%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA++TPLWRRDG G+YLCNACGLY KMNG NRPL+KP+RRLSASRR G  C+NC T+TTTLWRRN+ GEPVCNACGLY KLH V RP  MKKEGIQT
Sbjct:  167 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLVKPQRRLSASRRVGLSCTNCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT 270          

HSP 2 Score: 56.225 bits (134), Expect = 3.138e-8
Identity = 24/53 (45.28%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+ +G  +CNACGLY K++G  RPL   K  +   +R
Sbjct:  221 GLSCTNCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKR 273          
BLAST of GATA-binding factor 2 vs. Ensembl Xenopus
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:448391])

HSP 1 Score: 177.178 bits (448), Expect = 4.900e-50
Identity = 86/104 (82.69%), Postives = 97/104 (93.27%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  254 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 357          

HSP 2 Score: 56.9954 bits (136), Expect = 3.322e-8
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  308 GTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR 360          
BLAST of GATA-binding factor 2 vs. Ensembl Xenopus
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:448391])

HSP 1 Score: 177.563 bits (449), Expect = 5.746e-50
Identity = 86/104 (82.69%), Postives = 97/104 (93.27%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  254 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 357          

HSP 2 Score: 57.3806 bits (137), Expect = 2.856e-8
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  308 GTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR 360          
BLAST of GATA-binding factor 2 vs. Ensembl Xenopus
Match: GATA2 (GATA binding protein 2 [Source:NCBI gene;Acc:100487142])

HSP 1 Score: 176.022 bits (445), Expect = 2.417e-49
Identity = 87/104 (83.65%), Postives = 96/104 (92.31%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA  TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+V+RP TMKKEGIQT
Sbjct:  274 GRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 377          
BLAST of GATA-binding factor 2 vs. Ensembl Xenopus
Match: mcm4 (minichromosome maintenance complex component 4 [Source:Xenbase;Acc:XB-GENE-1011481])

HSP 1 Score: 171.4 bits (433), Expect = 3.013e-48
Identity = 84/104 (80.77%), Postives = 92/104 (88.46%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA++TPLWRRDG G+YLCNACGLY KMNG NRPLIKP+RRLSASRR G  C+NC+T+TTTLWRRN+ GEPVCNACGLY KLH V RP  MKKEGIQT
Sbjct:  183 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT 286          
BLAST of GATA-binding factor 2 vs. Ensembl Xenopus
Match: gata5 (GATA binding protein 5 [Source:NCBI gene;Acc:496852])

HSP 1 Score: 164.851 bits (416), Expect = 7.517e-46
Identity = 83/104 (79.81%), Postives = 91/104 (87.50%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA++TPLWRRDG G+YLCNACGLY KMNG NRPLIKP++RLS+SRR G  C+NC+TSTTTLWRRNS GEPVCNACGLY KLH V RP  MKKE IQT
Sbjct:  181 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQKRLSSSRRAGLCCTNCHTSTTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQT 284          

HSP 2 Score: 56.6102 bits (135), Expect = 4.355e-8
Identity = 24/53 (45.28%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+ +G  +CNACGLY K++G  RPL   K  +   +R
Sbjct:  235 GLCCTNCHTSTTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKR 287          
BLAST of GATA-binding factor 2 vs. Ensembl Mouse
Match: Gata3 (GATA binding protein 3 [Source:MGI Symbol;Acc:MGI:95663])

HSP 1 Score: 177.563 bits (449), Expect = 3.533e-50
Identity = 86/104 (82.69%), Postives = 97/104 (93.27%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  260 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 363          

HSP 2 Score: 56.9954 bits (136), Expect = 2.856e-8
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  314 GTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR 366          
BLAST of GATA-binding factor 2 vs. Ensembl Mouse
Match: Gata2 (GATA binding protein 2 [Source:MGI Symbol;Acc:MGI:95662])

HSP 1 Score: 175.252 bits (443), Expect = 4.457e-49
Identity = 87/104 (83.65%), Postives = 96/104 (92.31%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA  TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+V+RP TMKKEGIQT
Sbjct:  292 GRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 395          

HSP 2 Score: 54.299 bits (129), Expect = 1.721e-7
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  346 GTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 398          
BLAST of GATA-binding factor 2 vs. Ensembl Mouse
Match: Gata2 (GATA binding protein 2 [Source:MGI Symbol;Acc:MGI:95662])

HSP 1 Score: 175.252 bits (443), Expect = 4.457e-49
Identity = 87/104 (83.65%), Postives = 96/104 (92.31%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA  TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+V+RP TMKKEGIQT
Sbjct:  292 GRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 395          

HSP 2 Score: 54.299 bits (129), Expect = 1.721e-7
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  346 GTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 398          
BLAST of GATA-binding factor 2 vs. Ensembl Mouse
Match: Gata4 (GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:95664])

HSP 1 Score: 167.933 bits (424), Expect = 6.575e-49
Identity = 83/104 (79.81%), Postives = 91/104 (87.50%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA++TPLWRRDG G+YLCNACGLY KMNG NRPLIKP+RRLSASRR G  C+NC T+TTTLWRRN+ GEPVCNACGLY KLH V RP  M+KEGIQT
Sbjct:    8 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 111          

HSP 2 Score: 57.3806 bits (137), Expect = 6.874e-9
Identity = 24/53 (45.28%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+ +G  +CNACGLY K++G  RPL   K  +   +R
Sbjct:   62 GLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKR 114          
BLAST of GATA-binding factor 2 vs. Ensembl Mouse
Match: Gata4 (GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:95664])

HSP 1 Score: 168.703 bits (426), Expect = 6.100e-47
Identity = 83/104 (79.81%), Postives = 91/104 (87.50%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA++TPLWRRDG G+YLCNACGLY KMNG NRPLIKP+RRLSASRR G  C+NC T+TTTLWRRN+ GEPVCNACGLY KLH V RP  M+KEGIQT
Sbjct:  213 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQT 316          

HSP 2 Score: 57.7658 bits (138), Expect = 1.534e-8
Identity = 24/53 (45.28%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+ +G  +CNACGLY K++G  RPL   K  +   +R
Sbjct:  267 GLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKR 319          
BLAST of GATA-binding factor 2 vs. UniProt/SwissProt
Match: sp|Q91428|GATA3_DANRE (Transcription factor GATA-3 OS=Danio rerio OX=7955 GN=gata3 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 9.380e-50
Identity = 99/150 (66.00%), Postives = 116/150 (77.33%), Query Frame = 2
Query:  374 SYFPSISNNDYASESGCNIFPNXXXXXXXXXXXXXXXXXXXXXXXXGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            ++ P  +   Y  + G  +FP S     S SS       K  SS+EGRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  207 AHHPIATYPSYVPDYGPGLFPPSSLIGGSSSSYGSKTRPKTRSSSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 356          
BLAST of GATA-binding factor 2 vs. UniProt/SwissProt
Match: sp|P23825|GATA3_CHICK (GATA-binding factor 3 OS=Gallus gallus OX=9031 GN=GATA3 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.927e-49
Identity = 86/104 (82.69%), Postives = 97/104 (93.27%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  261 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 364          

HSP 2 Score: 57.3806 bits (137), Expect = 1.497e-7
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  315 GTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR 367          
BLAST of GATA-binding factor 2 vs. UniProt/SwissProt
Match: sp|P23773|GATA3_XENLA (GATA-binding factor 3 OS=Xenopus laevis OX=8355 GN=gata3 PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 2.461e-49
Identity = 86/104 (82.69%), Postives = 97/104 (93.27%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  253 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 356          

HSP 2 Score: 56.9954 bits (136), Expect = 1.604e-7
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  307 GTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR 359          
BLAST of GATA-binding factor 2 vs. UniProt/SwissProt
Match: sp|P23772|GATA3_MOUSE (Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus OX=10090 GN=Gata3 PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.471e-49
Identity = 86/104 (82.69%), Postives = 97/104 (93.27%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  260 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 363          

HSP 2 Score: 56.9954 bits (136), Expect = 1.998e-7
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  314 GTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR 366          
BLAST of GATA-binding factor 2 vs. UniProt/SwissProt
Match: sp|P23771|GATA3_HUMAN (Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens OX=9606 GN=GATA3 PE=1 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 3.305e-49
Identity = 86/104 (82.69%), Postives = 97/104 (93.27%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  260 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 363          

HSP 2 Score: 56.6102 bits (135), Expect = 2.221e-7
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  314 GTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR 366          
BLAST of GATA-binding factor 2 vs. TrEMBL
Match: F1CDE3 (GATA123b (Fragment) OS=Schmidtea polychroa OX=50054 PE=2 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 9.075e-127
Identity = 234/239 (97.91%), Postives = 236/239 (98.74%), Query Frame = 2
Query:  536 AVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTXXXXXXXXXXXXXXEELDYFKSSNHLQCFSTPFNHPGAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFXXXXXXXXXXXXXXXRETNLMHSTNHMMQSSHHPSTLPVAGGGAXXXXXXXXXXPNLSTAYLGQGMC 1252
            AVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNRKVSHKSKRRRSEELDYFKSSNHLQCFSTPFNHPGAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFNSLNSHNIHSSV+S RE NLMHSTNHMMQSSHHP+TLPVAGGG HFNHFNSNSSPNLSTAYLGQGMC
Sbjct:    1 AVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNRKVSHKSKRRRSEELDYFKSSNHLQCFSTPFNHPGAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFNSLNSHNIHSSVTSAREANLMHSTNHMMQSSHHPTTLPVAGGGGHFNHFNSNSSPNLSTAYLGQGMC 239          
BLAST of GATA-binding factor 2 vs. TrEMBL
Match: A0A3G8G7P2 (Transcription factor GATA1/2/3b OS=Schmidtea mediterranea OX=79327 GN=gata1 PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 8.957e-101
Identity = 204/208 (98.08%), Postives = 206/208 (99.04%), Query Frame = 2
Query:  293 MFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNXXXXXXXXXXXXXXXXXXXXXXXXGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTXXXXXXXXXXXXXXEELDYFKSSNHLQCFST 916
            MFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNSESQSNSFSSTTKFKSSKKSSSNEGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNRKVSHKSKRRRSEELDYFKSSNHL  F++
Sbjct:    1 MFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNSESQSNSFSSTTKFKSSKKSSSNEGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNRKVSHKSKRRRSEELDYFKSSNHLHVFNS 208          
BLAST of GATA-binding factor 2 vs. TrEMBL
Match: I2DBA4 (GATA binding protein 1/2/3 (Fragment) OS=Branchiostoma lanceolatum OX=7740 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 5.767e-51
Identity = 113/196 (57.65%), Postives = 139/196 (70.92%), Query Frame = 2
Query:  380 FPSISNNDYASESGCNIFPNXXXXXXXXXXXXXXXXXXXXXXXXGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTX-XXXXXXXXXXXXXEELDYFKSSNHLQCF------STPFNHPGAGMS 946
            +P+  ++D+AS  G    P   S  N    T+  K   K SS EGRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN NG+PVCNACGLY+KLH+V+RP TMKK+GIQTR  +  +   ++ + +EL+  KS + L  F      S PF+  GA +S
Sbjct:   75 YPAYVSSDFAS--GLGFHPGVLSTHNPLPPTSVAKPKTKRSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTQCANCKTTTTTLWRRNQNGDPVCNACGLYYKLHAVNRPLTMKKDGIQTRNRKVSNKSKRKGKQDELNLMKSDDKLTAFTSMPVNSPPFSDCGASLS 268          
BLAST of GATA-binding factor 2 vs. TrEMBL
Match: C5HZ33 (Transcription factor GATA123s OS=Branchiostoma floridae OX=7739 GN=GATA123s PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 2.246e-50
Identity = 119/220 (54.09%), Postives = 150/220 (68.18%), Query Frame = 2
Query:  380 FPSISNNDYASESGCNIFPNXXXXXXXXXXXXXXXXXXXXXXXXGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTX-XXXXXXXXXXXXXEELDYFKSSNHLQCF------STPFNHPGAGMSPDSFPQSIQSPYMSSYFQNNQILS 1018
            +P+  ++D+AS  G    P   S  N    T+  K   K SS EGRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN NG+PVCNACGLY+KLH+V+RP TMKK+GIQTR  +  +   K+ + +EL+  KS + L  F      S PF+  GA +S  + P      Y+ S + N+ ++S
Sbjct:   95 YPAYVSSDFAS--GLGFHPGVLSTHNPLPPTSVAKPKTKRSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTQCANCKTTTTTLWRRNQNGDPVCNACGLYYKLHAVNRPLTMKKDGIQTRNRKVSNKSKKKGKQDELNLMKSDDKLTAFTSMPVNSPPFSDCGASLS-ATMPHMS---YVPSNYTNHHMMS 308          
BLAST of GATA-binding factor 2 vs. TrEMBL
Match: V9LAD0 (GATA-binding factor 3 (Fragment) OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.222e-49
Identity = 99/150 (66.00%), Postives = 113/150 (75.33%), Query Frame = 2
Query:  374 SYFPSISNNDYASESGCNIFPNXXXXXXXXXXXXXXXXXXXXXXXXGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            ++ P  S   Y SE G  +FP       S          K  SS EGRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:   90 AHHPLASYPPYVSEYGAGLFPPGSLLGASPPGFPSKARPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 239          
BLAST of GATA-binding factor 2 vs. Ensembl Cavefish
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:103042823])

HSP 1 Score: 179.104 bits (453), Expect = 5.477e-51
Identity = 100/149 (67.11%), Postives = 115/149 (77.18%), Query Frame = 2
Query:  377 YFPSISNNDYASESGCNIFPNXXXXXXXXXXXXXXXXXXXXXXXXGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            + P  +   Y S+ G  IFP S     S SS       K  S +EGRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  210 HHPIATYPSYVSDYGPGIFPPSSLIGGSSSSYGSKTRPKTRSCSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 358          
BLAST of GATA-binding factor 2 vs. Ensembl Cavefish
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:103042823])

HSP 1 Score: 179.104 bits (453), Expect = 5.898e-51
Identity = 100/149 (67.11%), Postives = 115/149 (77.18%), Query Frame = 2
Query:  377 YFPSISNNDYASESGCNIFPNXXXXXXXXXXXXXXXXXXXXXXXXGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            + P  +   Y S+ G  IFP S     S SS       K  S +EGRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  212 HHPIATYPSYVSDYGPGIFPPSSLIGGSSSSYGSKTRPKTRSCSEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQT 360          
BLAST of GATA-binding factor 2 vs. Ensembl Cavefish
Match: gata2a (GATA-binding factor 2-like [Source:NCBI gene;Acc:103037830])

HSP 1 Score: 177.563 bits (449), Expect = 4.176e-50
Identity = 88/104 (84.62%), Postives = 96/104 (92.31%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN NG+PVCNACGLYFKLH+V+RP TMKKEGIQT
Sbjct:  282 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYFKLHNVNRPLTMKKEGIQT 385          
BLAST of GATA-binding factor 2 vs. Ensembl Cavefish
Match: gata2b (GATA-binding factor 2 [Source:NCBI gene;Acc:103039425])

HSP 1 Score: 173.711 bits (439), Expect = 9.467e-50
Identity = 86/104 (82.69%), Postives = 97/104 (93.27%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLI+PKRRLSA+RR GT C+NC+T TTTLWRRN+NGEPVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:  194 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKRRLSAARRAGTCCANCHTGTTTLWRRNANGEPVCNACGLYYKLHNMNRPLTMKKEGIQT 297          

HSP 2 Score: 53.1434 bits (126), Expect = 2.495e-7
Identity = 24/53 (45.28%), Postives = 29/53 (54.72%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G  +CNACGLY K++  NRPL   K  +    R
Sbjct:  248 GTCCANCHTGTTTLWRRNANGEPVCNACGLYYKLHNMNRPLTMKKEGIQTRNR 300          
BLAST of GATA-binding factor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000017595.2 (GATA-binding factor 1-B-like [Source:NCBI gene;Acc:103031807])

HSP 1 Score: 171.785 bits (434), Expect = 2.788e-48
Identity = 85/104 (81.73%), Postives = 93/104 (89.42%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
             RECVNCGA  TPLWRRDG G+YLCNACGLY KMNGQNRPLI+PK+RL  S+R GT C+NC TSTTTLWRRN+NGEPVCNACGLYFKLH+V+RP TMKKEGIQT
Sbjct:  239 ARECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKKRLVVSKRAGTQCANCQTSTTTLWRRNANGEPVCNACGLYFKLHNVNRPLTMKKEGIQT 342          

HSP 2 Score: 55.8398 bits (133), Expect = 5.196e-8
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G +C NC    T LWRR+  G  +CNACGLY K++  NRPL   K  +    R
Sbjct:  293 GTQCANCQTSTTTLWRRNANGEPVCNACGLYFKLHNVNRPLTMKKEGIQTRNR 345          
BLAST of GATA-binding factor 2 vs. Ensembl Sea Lamprey
Match: gata2b (GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040718-440])

HSP 1 Score: 174.866 bits (442), Expect = 3.813e-53
Identity = 88/104 (84.62%), Postives = 96/104 (92.31%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSASRR GT C+NC T+TTTLWRRN NGEPVCNACGLY+KLH+V+RP +MKKEGIQT
Sbjct:   59 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSASRRAGTACANCQTTTTTLWRRNPNGEPVCNACGLYYKLHNVNRPMSMKKEGIQT 162          

HSP 2 Score: 50.0618 bits (118), Expect = 1.437e-7
Identity = 23/53 (43.40%), Postives = 29/53 (54.72%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G  +CNACGLY K++  NRP+   K  +    R
Sbjct:  113 GTACANCQTTTTTLWRRNPNGEPVCNACGLYYKLHNVNRPMSMKKEGIQTRNR 165          
BLAST of GATA-binding factor 2 vs. Ensembl Sea Lamprey
Match: gata2b (GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040718-440])

HSP 1 Score: 176.407 bits (446), Expect = 6.417e-53
Identity = 88/104 (84.62%), Postives = 96/104 (92.31%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSASRR GT C+NC T+TTTLWRRN NGEPVCNACGLY+KLH+V+RP +MKKEGIQT
Sbjct:   27 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSASRRAGTACANCQTTTTTLWRRNPNGEPVCNACGLYYKLHNVNRPMSMKKEGIQT 130          
BLAST of GATA-binding factor 2 vs. Ensembl Sea Lamprey
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:30458])

HSP 1 Score: 171.785 bits (434), Expect = 8.934e-52
Identity = 84/104 (80.77%), Postives = 96/104 (92.31%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+ TTLWRRN++G+PVCNACGLY+KLH+++RP TMKKEGIQT
Sbjct:    2 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTITTLWRRNASGDPVCNACGLYYKLHNINRPLTMKKEGIQT 105          

HSP 2 Score: 53.1434 bits (126), Expect = 1.432e-8
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:   56 GTSCANCQTTITTLWRRNASGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNR 108          
BLAST of GATA-binding factor 2 vs. Ensembl Sea Lamprey
Match: gata4 (GATA binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-980526-476])

HSP 1 Score: 137.117 bits (344), Expect = 2.377e-39
Identity = 75/104 (72.12%), Postives = 84/104 (80.77%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA++TPLWRRDG G+YLCNACGLY KMNG NRPLIKP+RR+S SRR G  CSNC TSTTTLWRRN+ GEP   ACG+   +  V RP  MKK+GIQT
Sbjct:   13 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYNKMNGINRPLIKPQRRMSGSRRVGLSCSNCQTSTTTLWRRNAEGEPGYIACGIIV-IEGVPRPLAMKKDGIQT 115          
BLAST of GATA-binding factor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000698.1 (pep scaffold:Pmarinus_7.0:GL479144:20133:30389:-1 gene:ENSPMAG00000000635.1 transcript:ENSPMAT00000000698.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 3.191e-8
Identity = 22/41 (53.66%), Postives = 28/41 (68.29%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPL 634
            G  CVNC    T LWR++  G Y+CNACGLY+K++   RPL
Sbjct:    7 GLFCVNCLTTTTTLWRKNAGGVYVCNACGLYEKLHSAPRPL 47          

HSP 2 Score: 47.7506 bits (112), Expect = 2.917e-6
Identity = 20/33 (60.61%), Postives = 25/33 (75.76%), Query Frame = 2
Query:  713 LWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKE 811
            LWR+N+ G  VCNACGLY KLHS  RP ++ K+
Sbjct:   20 LWRKNAGGVYVCNACGLYEKLHSAPRPLSIIKQ 52          
BLAST of GATA-binding factor 2 vs. Ensembl Yeast
Match: GLN3 (Transcriptional activator of genes regulated by nitrogen catabolite repression; localization and activity regulated by quality of nitrogen source and Ure2p [Source:SGD;Acc:S000000842])

HSP 1 Score: 65.0846 bits (157), Expect = 9.467e-12
Identity = 29/54 (53.70%), Postives = 37/54 (68.52%), Query Frame = 2
Query:  518 ECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPL-IKP---KRRLSASR 667
            +C NC    TPLWRR  +GN LCNACGL+QK++G  RPL +K    K+R+S  R
Sbjct:  305 QCFNCKTFKTPLWRRSPEGNTLCNACGLFQKLHGTMRPLSLKSDVIKKRISKKR 358          

HSP 2 Score: 47.3654 bits (111), Expect = 3.725e-6
Identity = 18/36 (50.00%), Postives = 25/36 (69.44%), Query Frame = 2
Query:  713 LWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQ 820
            LWRR+  G  +CNACGL+ KLH   RP ++K + I+
Sbjct:  316 LWRRSPEGNTLCNACGLFQKLHGTMRPLSLKSDVIK 351          
BLAST of GATA-binding factor 2 vs. Ensembl Yeast
Match: DAL80 (Negative regulator of genes in multiple nitrogen degradation pathways; expression is regulated by nitrogen levels and by Gln3p; member of the GATA-binding family, forms homodimers and heterodimers with Gzf3p; DAL80 has a paralog, GZF3, that arose from the whole genome duplication [Source:SGD;Acc:S000001742])

HSP 1 Score: 61.6178 bits (148), Expect = 3.842e-11
Identity = 23/38 (60.53%), Postives = 28/38 (73.68%), Query Frame = 2
Query:  521 CVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPL 634
            C NC  V TPLWRRD  G  LCNACGL+ K++G+ RP+
Sbjct:   31 CQNCFTVKTPLWRRDEHGTVLCNACGLFLKLHGEPRPI 68          

HSP 2 Score: 48.521 bits (114), Expect = 7.156e-7
Identity = 18/37 (48.65%), Postives = 27/37 (72.97%), Query Frame = 2
Query:  713 LWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            LWRR+ +G  +CNACGL+ KLH   RP ++K + I++
Sbjct:   41 LWRRDEHGTVLCNACGLFLKLHGEPRPISLKTDTIKS 77          
BLAST of GATA-binding factor 2 vs. Ensembl Yeast
Match: GAT1 (Transcriptional activator of nitrogen catabolite repression genes; contains a GATA-1-type zinc finger DNA-binding motif; activity and localization regulated by nitrogen limitation and Ure2p; different translational starts produce two major and two minor isoforms that are differentially regulated and localized [Source:SGD;Acc:S000001873])

HSP 1 Score: 58.151 bits (139), Expect = 1.421e-9
Identity = 26/55 (47.27%), Postives = 36/55 (65.45%), Query Frame = 2
Query:  518 ECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPL-----IKPKRRLSASR 667
            +C NC    TPLWR+D +G  LCNACGL+ K++G  RPL     I  KR+ S+++
Sbjct:  309 KCSNCTTSTTPLWRKDPKGLPLCNACGLFLKLHGVTRPLSLKTDIIKKRQRSSTK 363          

HSP 2 Score: 53.1434 bits (126), Expect = 4.488e-8
Identity = 19/36 (52.78%), Postives = 28/36 (77.78%), Query Frame = 2
Query:  713 LWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQ 820
            LWR++  G P+CNACGL+ KLH V+RP ++K + I+
Sbjct:  320 LWRKDPKGLPLCNACGLFLKLHGVTRPLSLKTDIIK 355          
BLAST of GATA-binding factor 2 vs. Ensembl Yeast
Match: GZF3 (GATA zinc finger protein; negatively regulates nitrogen catabolic gene expression by competing with Gat1p for GATA site binding; function requires a repressive carbon source; dimerizes with Dal80p and binds to Tor1p; GZF3 has a paralog, DAL80, that arose from the whole genome duplication [Source:SGD;Acc:S000003646])

HSP 1 Score: 58.151 bits (139), Expect = 1.432e-9
Identity = 22/38 (57.89%), Postives = 27/38 (71.05%), Query Frame = 2
Query:  521 CVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPL 634
            C NC    TPLWRRD  G  LCNACGL+ K++G+ RP+
Sbjct:  131 CKNCLTSTTPLWRRDEHGAMLCNACGLFLKLHGKPRPI 168          

HSP 2 Score: 48.9062 bits (115), Expect = 1.065e-6
Identity = 18/37 (48.65%), Postives = 27/37 (72.97%), Query Frame = 2
Query:  713 LWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            LWRR+ +G  +CNACGL+ KLH   RP ++K + I++
Sbjct:  141 LWRRDEHGAMLCNACGLFLKLHGKPRPISLKTDVIKS 177          
BLAST of GATA-binding factor 2 vs. Ensembl Nematostella
Match: GATA (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY2])

HSP 1 Score: 167.548 bits (423), Expect = 3.471e-47
Identity = 82/104 (78.85%), Postives = 95/104 (91.35%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNG +RPLIKPKRRLSA+RR GT C+NC+T+ TTLWRRN NG+PVCNACGLY+KLH+V+RP +MKK+GIQT
Sbjct:  215 GRECVNCGATSTPLWRRDGSGHYLCNACGLYHKMNGSSRPLIKPKRRLSAARRAGTSCANCHTTQTTLWRRNQNGDPVCNACGLYWKLHAVNRPLSMKKDGIQT 318          
BLAST of GATA-binding factor 2 vs. Ensembl Medaka
Match: gata3 (GATA binding protein 3 [Source:NCBI gene;Acc:100049296])

HSP 1 Score: 178.333 bits (451), Expect = 1.290e-50
Identity = 87/104 (83.65%), Postives = 97/104 (93.27%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN+NG+PVCNACGLYFKLH+++RP TMKKEGIQT
Sbjct:  255 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYFKLHNINRPLTMKKEGIQT 358          
BLAST of GATA-binding factor 2 vs. Ensembl Medaka
Match: gata2a (GATA-binding factor 2 [Source:NCBI gene;Acc:101161391])

HSP 1 Score: 177.563 bits (449), Expect = 3.187e-50
Identity = 88/104 (84.62%), Postives = 96/104 (92.31%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRDG G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN NG+PVCNACGLYFKLH+V+RP TMKKEGIQT
Sbjct:  272 GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNGNGDPVCNACGLYFKLHNVNRPLTMKKEGIQT 375          

HSP 2 Score: 57.3806 bits (137), Expect = 1.752e-8
Identity = 25/53 (47.17%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+G G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  326 GTCCANCQTTTTTLWRRNGNGDPVCNACGLYFKLHNVNRPLTMKKEGIQTRNR 378          
BLAST of GATA-binding factor 2 vs. Ensembl Medaka
Match: gata-1 (hematopietic transcription factor GATA-1 [Source:NCBI gene;Acc:100125425])

HSP 1 Score: 171.785 bits (434), Expect = 2.192e-48
Identity = 85/104 (81.73%), Postives = 94/104 (90.38%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
             RECVNCGA  TPLWRRDG G+YLCNACGLY KMNGQNRPLI+PK+RL  S+R GT C+NC+TSTTTLWRRN+NGEPVCNACGLYFKLH+V+RP TMKKEGIQT
Sbjct:  235 ARECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCANCHTSTTTLWRRNANGEPVCNACGLYFKLHNVNRPLTMKKEGIQT 338          

HSP 2 Score: 56.225 bits (134), Expect = 3.611e-8
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G +C NC    T LWRR+  G  +CNACGLY K++  NRPL   K  +    R
Sbjct:  289 GTQCANCHTSTTTLWRRNANGEPVCNACGLYFKLHNVNRPLTMKKEGIQTRNR 341          
BLAST of GATA-binding factor 2 vs. Ensembl Medaka
Match: gata2 (GATA binding protein 2 [Source:NCBI gene;Acc:100125427])

HSP 1 Score: 172.555 bits (436), Expect = 2.412e-48
Identity = 85/104 (81.73%), Postives = 96/104 (92.31%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA +TPLWRRD  G+YLCNACGLY KMNGQNRPLIKPKRRLSA+RR GT C+NC T+TTTLWRRN++G+PVCNACGLY+KLH+V+RP TMKKEGIQT
Sbjct:  272 GRECVNCGATSTPLWRRDSTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNASGDPVCNACGLYYKLHNVNRPLTMKKEGIQT 375          

HSP 2 Score: 55.8398 bits (133), Expect = 4.821e-8
Identity = 24/53 (45.28%), Postives = 30/53 (56.60%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+  G+ +CNACGLY K++  NRPL   K  +    R
Sbjct:  326 GTCCANCQTTTTTLWRRNASGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNR 378          
BLAST of GATA-binding factor 2 vs. Ensembl Medaka
Match: gata4 (GATA binding protein 4 [Source:NCBI gene;Acc:100125520])

HSP 1 Score: 167.162 bits (422), Expect = 6.047e-47
Identity = 83/104 (79.81%), Postives = 92/104 (88.46%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA++TPLWRRDG G+YLCNACGLY KMNG NRPLIKP+RRLSASRR G  C+NC+T+TTTLWRRN+ GEPVCNACGLY KLH V RP  MKK+GIQT
Sbjct:  183 GRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCTNCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKDGIQT 286          

HSP 2 Score: 55.0694 bits (131), Expect = 6.808e-8
Identity = 24/53 (45.28%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C NC    T LWRR+ +G  +CNACGLY K++G  RPL   K  +   +R
Sbjct:  237 GLSCTNCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKDGIQTRKR 289          
BLAST of GATA-binding factor 2 vs. Planmine SMEST
Match: SMESG000028503.1 (SMESG000028503.1)

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 401/401 (100.00%), Postives = 401/401 (100.00%), Query Frame = 2
Query:   50 SKFDETKSTLKTDLISKHSSSKDTVSTNETSLVSNNSPRDXXXXXXXXXXXXXXXXXYYDHSLEQFPDNSSNYIQSLVSSGMFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNXXXXXXXXXXXXXXXXXXXXXXXXGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTXXXXXXXXXXXXXXEELDYFKSSNHLQCFSTPFNHPGAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFXXXXXXXXXXXXXXXRETNLMHSTNHMMQSSHHPSTLPVAGGGAXXXXXXXXXXPNLSTAYLGQGMC 1252
            SKFDETKSTLKTDLISKHSSSKDTVSTNETSLVSNNSPRDKSNSKSDINNSNSKLSNYYDHSLEQFPDNSSNYIQSLVSSGMFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNSESQSNSFSSTTKFKSSKKSSSNEGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNRKVSHKSKRRRSEELDYFKSSNHLQCFSTPFNHPGAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFNSLNSHNIHSSVSSVRETNLMHSTNHMMQSSHHPSTLPVAGGGAHFNHFNSNSSPNLSTAYLGQGMC
Sbjct:  213 SKFDETKSTLKTDLISKHSSSKDTVSTNETSLVSNNSPRDKSNSKSDINNSNSKLSNYYDHSLEQFPDNSSNYIQSLVSSGMFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNSESQSNSFSSTTKFKSSKKSSSNEGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNRKVSHKSKRRRSEELDYFKSSNHLQCFSTPFNHPGAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFNSLNSHNIHSSVSSVRETNLMHSTNHMMQSSHHPSTLPVAGGGAHFNHFNSNSSPNLSTAYLGQGMC 613          
BLAST of GATA-binding factor 2 vs. Planmine SMEST
Match: SMESG000028503.1 (SMESG000028503.1)

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 401/401 (100.00%), Postives = 401/401 (100.00%), Query Frame = 2
Query:   50 SKFDETKSTLKTDLISKHSSSKDTVSTNETSLVSNNSPRDXXXXXXXXXXXXXXXXXYYDHSLEQFPDNSSNYIQSLVSSGMFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNXXXXXXXXXXXXXXXXXXXXXXXXGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTXXXXXXXXXXXXXXEELDYFKSSNHLQCFSTPFNHPGAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFXXXXXXXXXXXXXXXRETNLMHSTNHMMQSSHHPSTLPVAGGGAXXXXXXXXXXPNLSTAYLGQGMC 1252
            SKFDETKSTLKTDLISKHSSSKDTVSTNETSLVSNNSPRDKSNSKSDINNSNSKLSNYYDHSLEQFPDNSSNYIQSLVSSGMFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNSESQSNSFSSTTKFKSSKKSSSNEGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNRKVSHKSKRRRSEELDYFKSSNHLQCFSTPFNHPGAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFNSLNSHNIHSSVSSVRETNLMHSTNHMMQSSHHPSTLPVAGGGAHFNHFNSNSSPNLSTAYLGQGMC
Sbjct:  215 SKFDETKSTLKTDLISKHSSSKDTVSTNETSLVSNNSPRDKSNSKSDINNSNSKLSNYYDHSLEQFPDNSSNYIQSLVSSGMFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNSESQSNSFSSTTKFKSSKKSSSNEGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNRKVSHKSKRRRSEELDYFKSSNHLQCFSTPFNHPGAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFNSLNSHNIHSSVSSVRETNLMHSTNHMMQSSHHPSTLPVAGGGAHFNHFNSNSSPNLSTAYLGQGMC 615          
BLAST of GATA-binding factor 2 vs. Planmine SMEST
Match: SMESG000028503.1 (SMESG000028503.1)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 369/401 (92.02%), Postives = 370/401 (92.27%), Query Frame = 2
Query:   50 SKFDETKSTLKTDLISKHSSSKDTVSTNETSLVSNNSPRDXXXXXXXXXXXXXXXXXYYDHSLEQFPDNSSNYIQSLVSSGMFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNXXXXXXXXXXXXXXXXXXXXXXXXGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTXXXXXXXXXXXXXXEELDYFKSSNHLQCFSTPFNHPGAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFXXXXXXXXXXXXXXXRETNLMHSTNHMMQSSHHPSTLPVAGGGAXXXXXXXXXXPNLSTAYLGQGMC 1252
            SKFDETKSTLKTDLISKHSSSKDTVSTNETSLVSNNSPRDKSNSKSDINNSNSKLSNYYDHSLEQFPDNSSNYIQSLVSSGMFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNSESQSNSFSSTTKFKSSKKSSSNEGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNRK                             +H  AGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFNSLNSHNIHSSVSSVRETNLMHSTNHMMQSSHHPSTLPVAGGGAHFNHFNSNSSPNLSTAYLGQGMC
Sbjct:  213 SKFDETKSTLKTDLISKHSSSKDTVSTNETSLVSNNSPRDKSNSKSDINNSNSKLSNYYDHSLEQFPDNSSNYIQSLVSSGMFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNSESQSNSFSSTTKFKSSKKSSSNEGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNRK----------------------------VSHKSAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFNSLNSHNIHSSVSSVRETNLMHSTNHMMQSSHHPSTLPVAGGGAHFNHFNSNSSPNLSTAYLGQGMC 585          
BLAST of GATA-binding factor 2 vs. Planmine SMEST
Match: SMESG000028503.1 (SMESG000028503.1)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 369/401 (92.02%), Postives = 370/401 (92.27%), Query Frame = 2
Query:   50 SKFDETKSTLKTDLISKHSSSKDTVSTNETSLVSNNSPRDXXXXXXXXXXXXXXXXXYYDHSLEQFPDNSSNYIQSLVSSGMFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNXXXXXXXXXXXXXXXXXXXXXXXXGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTXXXXXXXXXXXXXXEELDYFKSSNHLQCFSTPFNHPGAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFXXXXXXXXXXXXXXXRETNLMHSTNHMMQSSHHPSTLPVAGGGAXXXXXXXXXXPNLSTAYLGQGMC 1252
            SKFDETKSTLKTDLISKHSSSKDTVSTNETSLVSNNSPRDKSNSKSDINNSNSKLSNYYDHSLEQFPDNSSNYIQSLVSSGMFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNSESQSNSFSSTTKFKSSKKSSSNEGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNRK                             +H  AGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFNSLNSHNIHSSVSSVRETNLMHSTNHMMQSSHHPSTLPVAGGGAHFNHFNSNSSPNLSTAYLGQGMC
Sbjct:  215 SKFDETKSTLKTDLISKHSSSKDTVSTNETSLVSNNSPRDKSNSKSDINNSNSKLSNYYDHSLEQFPDNSSNYIQSLVSSGMFRANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNSESQSNSFSSTTKFKSSKKSSSNEGRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQTRNRK----------------------------VSHKSAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMFNSLNSHNIHSSVSSVRETNLMHSTNHMMQSSHHPSTLPVAGGGAHFNHFNSNSSPNLSTAYLGQGMC 587          
BLAST of GATA-binding factor 2 vs. Planmine SMEST
Match: SMESG000079514.1 (SMESG000079514.1)

HSP 1 Score: 161.384 bits (407), Expect = 1.935e-44
Identity = 78/104 (75.00%), Postives = 88/104 (84.62%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRRXXXXXXXXXXXXXXLWRRNSNGEPVCNACGLYFKLHSVSRPPTMKKEGIQT 823
            GRECVNCGA  TPLWRRDG G+YLCNACGLY KMNG NRPLIKPKRRLS++R+ GT C NC T+ TTLWRRN  G+ VCNACGLY+KLH +SRP +MKK+ IQT
Sbjct:  207 GRECVNCGATQTPLWRRDGTGHYLCNACGLYHKMNGTNRPLIKPKRRLSSARKVGTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQT 310          

HSP 2 Score: 58.9214 bits (141), Expect = 4.095e-9
Identity = 24/53 (45.28%), Postives = 34/53 (64.15%), Query Frame = 2
Query:  512 GRECVNCGAVNTPLWRRDGQGNYLCNACGLYQKMNGQNRPLIKPKRRLSASRR 670
            G  C+NCG  +T LWRR+ QG+ +CNACGLY K++  +RP+   K  +    R
Sbjct:  261 GTTCINCGTNHTTLWRRNQQGDSVCNACGLYYKLHHISRPISMKKDLIQTRNR 313          
The following BLAST results are available for this feature:
BLAST of GATA-binding factor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GATA36.812e-5082.69GATA binding protein 3 [Source:HGNC Symbol;Acc:HGN... [more]
GATA36.881e-5082.69GATA binding protein 3 [Source:HGNC Symbol;Acc:HGN... [more]
GATA26.492e-4983.65GATA binding protein 2 [Source:HGNC Symbol;Acc:HGN... [more]
GATA26.492e-4983.65GATA binding protein 2 [Source:HGNC Symbol;Acc:HGN... [more]
GATA47.671e-4979.81GATA binding protein 4 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of GATA-binding factor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elt-11.299e-4275.73Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-12.635e-4275.73Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-17.020e-4175.00Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-11.278e-4075.00Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
elt-11.285e-4075.00Transcription factor elt-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of GATA-binding factor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grn1.244e-4678.18gene:FBgn0001138 transcript:FBtr0081808[more]
pnr1.707e-4675.96gene:FBgn0003117 transcript:FBtr0335426[more]
grn4.790e-4678.18gene:FBgn0001138 transcript:FBtr0300040[more]
grn6.645e-4678.18gene:FBgn0001138 transcript:FBtr0330188[more]
pnr9.934e-4573.83gene:FBgn0003117 transcript:FBtr0335427[more]
back to top
BLAST of GATA-binding factor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata2b1.194e-5078.29GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata31.243e-5066.00GATA binding protein 3 [Source:NCBI gene;Acc:30458... [more]
gata2a1.412e-4983.65GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata2a1.515e-4983.65GATA binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata45.487e-4879.81GATA binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-9... [more]
back to top
BLAST of GATA-binding factor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata34.900e-5082.69GATA binding protein 3 [Source:NCBI gene;Acc:44839... [more]
gata35.746e-5082.69GATA binding protein 3 [Source:NCBI gene;Acc:44839... [more]
GATA22.417e-4983.65GATA binding protein 2 [Source:NCBI gene;Acc:10048... [more]
mcm43.013e-4880.77minichromosome maintenance complex component 4 [So... [more]
gata57.517e-4679.81GATA binding protein 5 [Source:NCBI gene;Acc:49685... [more]
back to top
BLAST of GATA-binding factor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gata33.533e-5082.69GATA binding protein 3 [Source:MGI Symbol;Acc:MGI:... [more]
Gata24.457e-4983.65GATA binding protein 2 [Source:MGI Symbol;Acc:MGI:... [more]
Gata24.457e-4983.65GATA binding protein 2 [Source:MGI Symbol;Acc:MGI:... [more]
Gata46.575e-4979.81GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
Gata46.100e-4779.81GATA binding protein 4 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of GATA-binding factor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91428|GATA3_DANRE9.380e-5066.00Transcription factor GATA-3 OS=Danio rerio OX=7955... [more]
sp|P23825|GATA3_CHICK1.927e-4982.69GATA-binding factor 3 OS=Gallus gallus OX=9031 GN=... [more]
sp|P23773|GATA3_XENLA2.461e-4982.69GATA-binding factor 3 OS=Xenopus laevis OX=8355 GN... [more]
sp|P23772|GATA3_MOUSE2.471e-4982.69Trans-acting T-cell-specific transcription factor ... [more]
sp|P23771|GATA3_HUMAN3.305e-4982.69Trans-acting T-cell-specific transcription factor ... [more]
back to top
BLAST of GATA-binding factor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F1CDE39.075e-12797.91GATA123b (Fragment) OS=Schmidtea polychroa OX=5005... [more]
A0A3G8G7P28.957e-10198.08Transcription factor GATA1/2/3b OS=Schmidtea medit... [more]
I2DBA45.767e-5157.65GATA binding protein 1/2/3 (Fragment) OS=Branchios... [more]
C5HZ332.246e-5054.09Transcription factor GATA123s OS=Branchiostoma flo... [more]
V9LAD01.222e-4966.00GATA-binding factor 3 (Fragment) OS=Callorhinchus ... [more]
back to top
BLAST of GATA-binding factor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata35.477e-5167.11GATA binding protein 3 [Source:NCBI gene;Acc:10304... [more]
gata35.898e-5167.11GATA binding protein 3 [Source:NCBI gene;Acc:10304... [more]
gata2a4.176e-5084.62GATA-binding factor 2-like [Source:NCBI gene;Acc:1... [more]
gata2b9.467e-5082.69GATA-binding factor 2 [Source:NCBI gene;Acc:103039... [more]
ENSAMXT00000017595.22.788e-4881.73GATA-binding factor 1-B-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of GATA-binding factor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata2b3.813e-5384.62GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata2b6.417e-5384.62GATA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-... [more]
gata38.934e-5280.77GATA binding protein 3 [Source:NCBI gene;Acc:30458... [more]
gata42.377e-3972.12GATA binding protein 4 [Source:ZFIN;Acc:ZDB-GENE-9... [more]
ENSPMAT00000000698.13.191e-853.66pep scaffold:Pmarinus_7.0:GL479144:20133:30389:-1 ... [more]
back to top
BLAST of GATA-binding factor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
GLN39.467e-1253.70Transcriptional activator of genes regulated by ni... [more]
DAL803.842e-1160.53Negative regulator of genes in multiple nitrogen d... [more]
GAT11.421e-947.27Transcriptional activator of nitrogen catabolite r... [more]
GZF31.432e-957.89GATA zinc finger protein; negatively regulates nit... [more]
back to top
BLAST of GATA-binding factor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
GATA3.471e-4778.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GATA-binding factor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gata31.290e-5083.65GATA binding protein 3 [Source:NCBI gene;Acc:10004... [more]
gata2a3.187e-5084.62GATA-binding factor 2 [Source:NCBI gene;Acc:101161... [more]
gata-12.192e-4881.73hematopietic transcription factor GATA-1 [Source:N... [more]
gata22.412e-4881.73GATA binding protein 2 [Source:NCBI gene;Acc:10012... [more]
gata46.047e-4779.81GATA binding protein 4 [Source:NCBI gene;Acc:10012... [more]
back to top
BLAST of GATA-binding factor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028503.10.000e+0100.00SMESG000028503.1[more]
SMESG000028503.10.000e+0100.00SMESG000028503.1[more]
SMESG000028503.10.000e+092.02SMESG000028503.1[more]
SMESG000028503.10.000e+092.02SMESG000028503.1[more]
SMESG000079514.11.935e-4475.00SMESG000079514.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031351 ID=SMED30031351|Name=GATA-binding factor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1350bp
AATCCAACAATTACACCAGCAACTACAACAGCAACAGCAACAGCAACATT
CCAAATTCGATGAAACCAAATCGACACTTAAAACCGATTTGATTTCTAAA
CATTCCTCATCAAAGGACACTGTCTCAACGAATGAGACGTCTTTGGTGTC
CAACAACTCTCCAAGAGACAAATCGAATTCGAAATCAGATATTAACAATT
CCAATTCAAAACTGTCGAATTATTACGATCATTCATTGGAGCAATTTCCC
GACAACAGTAGCAATTATATCCAATCATTAGTAAGCTCAGGAATGTTTCG
AGCGAACGTTTCTAAAGAGACCACTCCGAATTTATCAATGAGATGTCTCC
AGTCGAATTACATGAATCACGGCTCGTACTTTCCATCAATTTCCAACAAC
GATTATGCCAGTGAATCTGGTTGTAACATTTTCCCAAATTCCGAATCCCA
AAGCAATTCATTTAGTTCGACAACTAAATTCAAATCATCGAAGAAAAGTA
GTTCAAACGAAGGCCGCGAATGTGTTAATTGTGGAGCGGTCAATACACCA
CTTTGGAGACGAGACGGTCAAGGAAATTATCTTTGTAACGCTTGTGGACT
GTATCAGAAAATGAATGGACAAAATCGACCATTAATTAAGCCCAAACGAA
GATTGTCAGCCTCTCGTCGGACCGGTACGATCTGTTCAAATTGCAATACA
TCGACAACAACATTATGGAGAAGAAATAGCAACGGAGAACCAGTTTGTAA
TGCCTGTGGACTTTACTTCAAATTGCATAGCGTCAGCCGGCCACCAACAA
TGAAAAAAGAGGGAATTCAAACAAGAAATCGAAAAGTGTCTCACAAAAGT
AAACGTCGACGATCTGAAGAATTGGATTACTTCAAATCGTCAAATCATTT
ACAATGTTTTTCAACTCCTTTTAATCATCCAGGTGCCGGAATGTCTCCCG
ACAGTTTTCCACAGTCTATCCAGTCGCCGTACATGAGTTCATATTTTCAA
AATAACCAAATACTGTCGGACAATAATCCACAAAACCCTTTGGCTATGTT
CAATAGTTTAAATTCACACAATATTCATTCATCCGTCAGTAGTGTTCGGG
AAACGAACTTAATGCACTCAACGAATCATATGATGCAATCCTCACATCAT
CCTTCAACTTTGCCAGTGGCCGGAGGAGGTGCACATTTTAATCATTTCAA
TTCCAATTCCTCTCCCAATTTATCAACTGCTTATCTTGGACAAGGAATGT
GTTAAAATTCCCTTTCCATTTCCAACACGATCACCCGAGAAATTGTACTT
AAAATTGTCATGTATATAGATTTATCATTTTTTTTATCGCTGATCAGAAT
back to top

protein sequence of SMED30031351-orf-1

>SMED30031351-orf-1 ID=SMED30031351-orf-1|Name=SMED30031351-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=418bp
IQQLHQQLQQQQQQQHSKFDETKSTLKTDLISKHSSSKDTVSTNETSLVS
NNSPRDKSNSKSDINNSNSKLSNYYDHSLEQFPDNSSNYIQSLVSSGMFR
ANVSKETTPNLSMRCLQSNYMNHGSYFPSISNNDYASESGCNIFPNSESQ
SNSFSSTTKFKSSKKSSSNEGRECVNCGAVNTPLWRRDGQGNYLCNACGL
YQKMNGQNRPLIKPKRRLSASRRTGTICSNCNTSTTTLWRRNSNGEPVCN
ACGLYFKLHSVSRPPTMKKEGIQTRNRKVSHKSKRRRSEELDYFKSSNHL
QCFSTPFNHPGAGMSPDSFPQSIQSPYMSSYFQNNQILSDNNPQNPLAMF
NSLNSHNIHSSVSSVRETNLMHSTNHMMQSSHHPSTLPVAGGGAHFNHFN
SNSSPNLSTAYLGQGMC*
back to top
Aliases
The feature 'GATA-binding factor 2' has the following synonyms
Synonym
Spol-GATA123b
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0030097hemopoiesis
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
GO:0008284positive regulation of cell proliferation
GO:0008543fibroblast growth factor receptor signaling pathway
GO:0021514ventral spinal cord interneuron differentiation
GO:0031101fin regeneration
GO:0042246tissue regeneration
GO:0043049otic placode formation
GO:0045582positive regulation of T cell differentiation
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0048702embryonic neurocranium morphogenesis
GO:0050769positive regulation of neurogenesis
GO:0060788ectodermal placode formation
GO:0061026cardiac muscle tissue regeneration
GO:0071696ectodermal placode development
GO:2001224positive regulation of neuron migration
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000061enteric musculature
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR016374TF_GATA-2/3
IPR039355Transcription_factor_GATA
IPR000679Znf_GATA
IPR013088Znf_NHR/GATA
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
GO:0000976transcription regulatory region sequence-specific DNA binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085RNA polymerase II transcription factor binding
GO:0001228transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003677DNA binding
GO:0003682chromatin binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005667transcription factor complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000679Zinc finger, GATA-typePRINTSPR00619GATAZNFINGERcoord: 169..186
score: 69.79
coord: 187..204
score: 69.44
IPR000679Zinc finger, GATA-typeSMARTSM00401GATA_3coord: 167..217
e-value: 7.1E-20
score: 82.0
coord: 221..271
e-value: 3.4E-20
score: 83.1
IPR000679Zinc finger, GATA-typePFAMPF00320GATAcoord: 173..206
e-value: 1.1E-14
score: 53.7
coord: 227..259
e-value: 3.2E-15
score: 55.4
IPR000679Zinc finger, GATA-typePROSITEPS00344GATA_ZN_FINGER_1coord: 227..251
IPR000679Zinc finger, GATA-typePROSITEPS00344GATA_ZN_FINGER_1coord: 173..197
IPR000679Zinc finger, GATA-typePROSITEPS50114GATA_ZN_FINGER_2coord: 221..274
score: 26.93
IPR000679Zinc finger, GATA-typePROSITEPS50114GATA_ZN_FINGER_2coord: 167..221
score: 28.051
IPR000679Zinc finger, GATA-typeCDDcd00202ZnF_GATAcoord: 172..223
e-value: 6.02152E-17
score: 72.4054
IPR000679Zinc finger, GATA-typeCDDcd00202ZnF_GATAcoord: 226..277
e-value: 4.84226E-18
score: 75.487
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 166..216
e-value: 1.4E-26
score: 93.6
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 217..277
e-value: 2.5E-30
score: 105.7
IPR016374Transcription factor, GATA-2/3PIRSFPIRSF003027Txn_fact_GATA-1/2/3coord: 2..365
e-value: 5.0E-87
score: 290.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..66
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 34..66
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 265..287
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..18
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 19..33
NoneNo IPR availablePANTHERPTHR10071:SF315GATA-BINDING FACTOR Ccoord: 63..377
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 219..279
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 165..217
IPR039355Transcription factor GATAPANTHERPTHR10071TRANSCRIPTION FACTOR GATA FAMILY MEMBERcoord: 63..377