Pyruvate dehydrogenase E1 component subunit alpha

Overview
NamePyruvate dehydrogenase E1 component subunit alpha
Smed IDSMED30031345
Length (bp)1936
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pyruvate dehydrogenase E1 component subunit alpha (SMED30031345) t-SNE clustered cells

Violin plots show distribution of expression levels for Pyruvate dehydrogenase E1 component subunit alpha (SMED30031345) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pyruvate dehydrogenase E1 component subunit alpha (SMED30031345) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pyruvate dehydrogenase E1 component subunit alpha (SMED30031345) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031345

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031345SMESG000073271.1 dd_Smed_v4_1310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031345SMESG000073271.1 dd_Smed_v4_1310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031345SMESG000073271.1 dd_Smed_v4_1310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031345SMESG000073271.1 dd_Smed_v4_1310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031345SMESG000073271.1 dd_Smed_v4_1310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30031345SMESG000073271.1 dd_Smed_v4_1310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30031345SMESG000073271.1 dd_Smed_v4_1310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031345SMESG000073271.1 dd_Smed_v4_1310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031345SMESG000073271.1 dd_Smed_v4_1310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031345SMESG000073271.1 Contig39007newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031345SMESG000073271.1 Contig39007uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30031345SMESG000073271.1 SMESG000029463.1 OX_Smed_1.0.07524ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 3 cellSMED30031345SMESG000073271.1 dd_Smed_v6_1310_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031345SMESG000073271.1 dd_Smed_v4_1310_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Human
Match: PDHA2 (pyruvate dehydrogenase E1 alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:8807])

HSP 1 Score: 286.96 bits (733), Expect = 2.779e-90
Identity = 132/219 (60.27%), Postives = 168/219 (76.71%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   LY LE GP   T+ T+A+GL   + M  +RRME     LYK+K IRGFCHL  GQEA  VG+EA + P+D +ITSYR HG   TRG S+ SI+AEL G++ G ++GKGGSMHMY KN+YGGNGIVGAQ PLGAGIALA KYK ++ +C+TLYGDGAANQGQ+ EA+N+A LW LPC+FICENN +GMGTS +R++AS +YY RG++IPG+
Sbjct:   32 ATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRRGGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAALWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGL 250          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Human
Match: PDHA1 (pyruvate dehydrogenase E1 alpha 1 subunit [Source:HGNC Symbol;Acc:HGNC:8806])

HSP 1 Score: 282.337 bits (721), Expect = 1.919e-88
Identity = 137/219 (62.56%), Postives = 169/219 (77.17%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L++LE GP   T+ T+ DGL   + M  +RRME     LYK+K+IRGFCHL  GQEA  VG+EA + P D +IT+YR HGFT TRG S+  I+AEL G+K G ++GKGGSMHMY KN+YGGNGIVGAQVPLGAGIALA KY   + VC+TLYGDGAANQGQ+FEAYN+A LW LPCIFICENN +GMGTS +R++AS +YY RGD+IPG+
Sbjct:   34 ATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGL 252          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Human
Match: PDHA1 (pyruvate dehydrogenase E1 alpha 1 subunit [Source:HGNC Symbol;Acc:HGNC:8806])

HSP 1 Score: 282.337 bits (721), Expect = 5.795e-88
Identity = 137/219 (62.56%), Postives = 169/219 (77.17%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L++LE GP   T+ T+ DGL   + M  +RRME     LYK+K+IRGFCHL  GQEA  VG+EA + P D +IT+YR HGFT TRG S+  I+AEL G+K G ++GKGGSMHMY KN+YGGNGIVGAQVPLGAGIALA KY   + VC+TLYGDGAANQGQ+FEAYN+A LW LPCIFICENN +GMGTS +R++AS +YY RGD+IPG+
Sbjct:   72 ATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGL 290          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Human
Match: PDHA1 (pyruvate dehydrogenase E1 alpha 1 subunit [Source:HGNC Symbol;Acc:HGNC:8806])

HSP 1 Score: 275.404 bits (703), Expect = 8.835e-86
Identity = 137/226 (60.62%), Postives = 169/226 (74.78%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQ-------EAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L++LE GP   T+ T+ DGL   + M  +RRME     LYK+K+IRGFCHL  GQ       EA  VG+EA + P D +IT+YR HGFT TRG S+  I+AEL G+K G ++GKGGSMHMY KN+YGGNGIVGAQVPLGAGIALA KY   + VC+TLYGDGAANQGQ+FEAYN+A LW LPCIFICENN +GMGTS +R++AS +YY RGD+IPG+
Sbjct:   34 ATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQFLLPLTQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGL 259          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Human
Match: PDHA1 (pyruvate dehydrogenase E1 alpha 1 subunit [Source:HGNC Symbol;Acc:HGNC:8806])

HSP 1 Score: 219.935 bits (559), Expect = 3.610e-65
Identity = 113/219 (51.60%), Postives = 143/219 (65.30%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L++LE GP   T+ T+ DGL   + M  +RRME     LYK+K+IRGFCHL  GQEA  VG+EA + P D +IT+YR HGFT TRG S+  I+AEL G+K G ++GKGGSMHMY KN+YGGNGIVGAQ                               GQ+FEAYN+A LW LPCIFICENN +GMGTS +R++AS +YY RGD+IPG+
Sbjct:   34 ATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRKGGCAKGKGGSMHMYAKNFYGGNGIVGAQ-------------------------------GQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGL 221          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Celegans
Match: pdha-1 (Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P52899])

HSP 1 Score: 303.908 bits (777), Expect = 3.721e-97
Identity = 138/218 (63.30%), Postives = 170/218 (77.98%), Query Frame = 3
Query:  135 FLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            F  +P KL+KL++GP       + D L   + M  IRRME+  GNLYKEK IRGFCHL SGQEA AVG++AA+   D++IT+YRCHG+T   GA++  ++AEL G+  G   GKGGSMHMY KN+YGGNGIVGAQ PLGAG+ALA KY++   VC+TLYGDGAANQGQ+FEA N+AKLW+LP +F+CENN FGMGT+A+RSSAS  YYTRGDY+PGIW
Sbjct:   30 FHTKPCKLHKLDNGPNTSVTLNREDALKYYRDMQVIRRMESAAGNLYKEKKIRGFCHLYSGQEACAVGMKAAMTEGDAVITAYRCHGWTWLLGATVTEVLAELTGRVAGNVHGKGGSMHMYTKNFYGGNGIVGAQQPLGAGVALAMKYREQKNVCVTLYGDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGTTAERSSASTEYYTRGDYVPGIW 247          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Celegans
Match: pdha-1 (Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P52899])

HSP 1 Score: 303.908 bits (777), Expect = 3.721e-97
Identity = 138/218 (63.30%), Postives = 170/218 (77.98%), Query Frame = 3
Query:  135 FLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            F  +P KL+KL++GP       + D L   + M  IRRME+  GNLYKEK IRGFCHL SGQEA AVG++AA+   D++IT+YRCHG+T   GA++  ++AEL G+  G   GKGGSMHMY KN+YGGNGIVGAQ PLGAG+ALA KY++   VC+TLYGDGAANQGQ+FEA N+AKLW+LP +F+CENN FGMGT+A+RSSAS  YYTRGDY+PGIW
Sbjct:   30 FHTKPCKLHKLDNGPNTSVTLNREDALKYYRDMQVIRRMESAAGNLYKEKKIRGFCHLYSGQEACAVGMKAAMTEGDAVITAYRCHGWTWLLGATVTEVLAELTGRVAGNVHGKGGSMHMYTKNFYGGNGIVGAQQPLGAGVALAMKYREQKNVCVTLYGDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGTTAERSSASTEYYTRGDYVPGIW 247          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Celegans
Match: pdha-1 (Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P52899])

HSP 1 Score: 303.908 bits (777), Expect = 3.721e-97
Identity = 138/218 (63.30%), Postives = 170/218 (77.98%), Query Frame = 3
Query:  135 FLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            F  +P KL+KL++GP       + D L   + M  IRRME+  GNLYKEK IRGFCHL SGQEA AVG++AA+   D++IT+YRCHG+T   GA++  ++AEL G+  G   GKGGSMHMY KN+YGGNGIVGAQ PLGAG+ALA KY++   VC+TLYGDGAANQGQ+FEA N+AKLW+LP +F+CENN FGMGT+A+RSSAS  YYTRGDY+PGIW
Sbjct:   30 FHTKPCKLHKLDNGPNTSVTLNREDALKYYRDMQVIRRMESAAGNLYKEKKIRGFCHLYSGQEACAVGMKAAMTEGDAVITAYRCHGWTWLLGATVTEVLAELTGRVAGNVHGKGGSMHMYTKNFYGGNGIVGAQQPLGAGVALAMKYREQKNVCVTLYGDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGTTAERSSASTEYYTRGDYVPGIW 247          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Celegans
Match: pdha-1 (Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P52899])

HSP 1 Score: 303.908 bits (777), Expect = 6.360e-97
Identity = 138/218 (63.30%), Postives = 170/218 (77.98%), Query Frame = 3
Query:  135 FLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            F  +P KL+KL++GP       + D L   + M  IRRME+  GNLYKEK IRGFCHL SGQEA AVG++AA+   D++IT+YRCHG+T   GA++  ++AEL G+  G   GKGGSMHMY KN+YGGNGIVGAQ PLGAG+ALA KY++   VC+TLYGDGAANQGQ+FEA N+AKLW+LP +F+CENN FGMGT+A+RSSAS  YYTRGDY+PGIW
Sbjct:   47 FHTKPCKLHKLDNGPNTSVTLNREDALKYYRDMQVIRRMESAAGNLYKEKKIRGFCHLYSGQEACAVGMKAAMTEGDAVITAYRCHGWTWLLGATVTEVLAELTGRVAGNVHGKGGSMHMYTKNFYGGNGIVGAQQPLGAGVALAMKYREQKNVCVTLYGDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGTTAERSSASTEYYTRGDYVPGIW 264          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Celegans
Match: bckd-1A (2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O45924])

HSP 1 Score: 85.5001 bits (210), Expect = 1.916e-17
Identity = 54/174 (31.03%), Postives = 84/174 (48.28%), Query Frame = 3
Query:  210 GLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHM--YGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNG-VCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGT 722
             L M K M Q+  M+ +  +  ++  I  F   S G+E   VG  AAL P D I   YR  G  + RG ++ + + +  G    + +G+   MH     +N+   +  +  Q+P   G A A K +KDN  + +  +GDGAA++G    A+N A     P IF C NN + + T
Sbjct:   85 SLKMYKTMTQLNIMDRILYDSQRQGRI-SFYMTSFGEEGNHVGSAAALEPQDLIYGQYREAGVLLWRGYTMENFMNQCYGNADDLGKGRQMPMHFGTKERNFVTISSPLTTQLPQAVGSAYAFKQQKDNNRIAVVYFGDGAASEGDAHAAFNFAATLKCPIIFFCRNNGYAIST 257          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Fly
Match: CG7024 (gene:FBgn0029722 transcript:FBtr0070712)

HSP 1 Score: 300.056 bits (767), Expect = 2.032e-94
Identity = 135/217 (62.21%), Postives = 166/217 (76.50%), Query Frame = 3
Query:  138 LLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            L   +K Y LE+GP  +   ++ D L M  +M ++RR ETV GN YKE+ IRGFCHL +GQEAVAVG++  L   DS+IT+YRCH +T   G S++ I+AEL G +TG S GKGGSMHMY   +YGGNGIVGAQVPLGAGI LAH Y+KDNGV + LYGDGAANQGQ+FE++N+AKLW LPCIF+CENNH+GMGT  KR+SA   +Y RG YIPG+W
Sbjct:   39 LENTFKCYDLENGPTMDVELSREDALTMYTQMLELRRFETVAGNYYKERKIRGFCHLYNGQEAVAVGMKQRLRSCDSVITAYRCHAWTYLMGVSLYEIMAELFGVRTGCSRGKGGSMHMYSDKFYGGNGIVGAQVPLGAGIGLAHSYRKDNGVSVVLYGDGAANQGQIFESFNMAKLWCLPCIFVCENNHYGMGTHVKRASAMTEFYMRGQYIPGLW 255          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Fly
Match: Pdha (gene:FBgn0028325 transcript:FBtr0070708)

HSP 1 Score: 290.426 bits (742), Expect = 8.395e-92
Identity = 134/215 (62.33%), Postives = 168/215 (78.14%), Query Frame = 3
Query:  144 QPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            +P+KL++L+ GPA E   TK   L    +M  IRR+ET  GNLYKEK+IRGFCHL SGQEA AVG++AA+   D+II++YR HG+T   G S   ++AEL G + G + GKGGSMHMY  N+YGGNGIVGAQVPLGAG+ LA KYK + G+C+ LYGDGAANQGQVFEAYN+A LW LP IF+CENN++GMGTS++R+S + +YYTRGD +PGIW
Sbjct:   43 RPFKLHRLDEGPATEVKLTKDQALKYYTQMQTIRRLETAAGNLYKEKIIRGFCHLYSGQEACAVGMKAAMRDVDNIISAYRVHGWTYLMGVSPSGVLAELTGVQGGCARGKGGSMHMYAPNFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTSSERASCNTDYYTRGDALPGIW 257          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Fly
Match: Pdha (gene:FBgn0028325 transcript:FBtr0070709)

HSP 1 Score: 290.426 bits (742), Expect = 8.395e-92
Identity = 134/215 (62.33%), Postives = 168/215 (78.14%), Query Frame = 3
Query:  144 QPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            +P+KL++L+ GPA E   TK   L    +M  IRR+ET  GNLYKEK+IRGFCHL SGQEA AVG++AA+   D+II++YR HG+T   G S   ++AEL G + G + GKGGSMHMY  N+YGGNGIVGAQVPLGAG+ LA KYK + G+C+ LYGDGAANQGQVFEAYN+A LW LP IF+CENN++GMGTS++R+S + +YYTRGD +PGIW
Sbjct:   43 RPFKLHRLDEGPATEVKLTKDQALKYYTQMQTIRRLETAAGNLYKEKIIRGFCHLYSGQEACAVGMKAAMRDVDNIISAYRVHGWTYLMGVSPSGVLAELTGVQGGCARGKGGSMHMYAPNFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTSSERASCNTDYYTRGDALPGIW 257          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Fly
Match: Pdha (gene:FBgn0028325 transcript:FBtr0070711)

HSP 1 Score: 290.041 bits (741), Expect = 4.505e-91
Identity = 134/215 (62.33%), Postives = 168/215 (78.14%), Query Frame = 3
Query:  144 QPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            +P+KL++L+ GPA E   TK   L    +M  IRR+ET  GNLYKEK+IRGFCHL SGQEA AVG++AA+   D+II++YR HG+T   G S   ++AEL G + G + GKGGSMHMY  N+YGGNGIVGAQVPLGAG+ LA KYK + G+C+ LYGDGAANQGQVFEAYN+A LW LP IF+CENN++GMGTS++R+S + +YYTRGD +PGIW
Sbjct:   87 RPFKLHRLDEGPATEVKLTKDQALKYYTQMQTIRRLETAAGNLYKEKIIRGFCHLYSGQEACAVGMKAAMRDVDNIISAYRVHGWTYLMGVSPSGVLAELTGVQGGCARGKGGSMHMYAPNFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTSSERASCNTDYYTRGDALPGIW 301          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Fly
Match: Pdha (gene:FBgn0028325 transcript:FBtr0070710)

HSP 1 Score: 265.388 bits (677), Expect = 3.833e-83
Identity = 123/186 (66.13%), Postives = 151/186 (81.18%), Query Frame = 3
Query:  231 MFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            M  IRR+ET  GNLYKEK+IRGFCHL SGQEA AVG++AA+   D+II++YR HG+T   G S   ++AEL G + G + GKGGSMHMY  N+YGGNGIVGAQVPLGAG+ LA KYK + G+C+ LYGDGAANQGQVFEAYN+A LW LP IF+CENN++GMGTS++R+S + +YYTRGD +PGIW
Sbjct:    1 MQTIRRLETAAGNLYKEKIIRGFCHLYSGQEACAVGMKAAMRDVDNIISAYRVHGWTYLMGVSPSGVLAELTGVQGGCARGKGGSMHMYAPNFYGGNGIVGAQVPLGAGVGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTSSERASCNTDYYTRGDALPGIW 186          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Zebrafish
Match: pdha1b (pyruvate dehydrogenase E1 alpha 1 subunit b [Source:ZFIN;Acc:ZDB-GENE-040718-96])

HSP 1 Score: 300.442 bits (768), Expect = 8.363e-96
Identity = 134/219 (61.19%), Postives = 174/219 (79.45%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L++L+ GP+ +T+ T+ DGL   + M  +RRME     LYK+K+IRGFCHL  GQEA AVGIEA + P D +IT+YR HG+T TRG S+  I+AEL G++ GV++GKGGSMHMY KN+YGGNGIVGAQVPLGAG+ALA +Y+  N +C+TLYGDGAANQGQ+FE++N+A LW LPCIFICENN +GMGTS +R+SAS +YY RGD+IPG+
Sbjct:   22 ANFDIKRCDLHRLDEGPSVQTVLTREDGLKYYRMMQTMRRMELKADQLYKQKIIRGFCHLYDGQEACAVGIEAGIKPTDHLITAYRAHGYTYTRGVSVKEIMAELTGRRGGVAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGVALACQYQGKNEICVTLYGDGAANQGQIFESFNMAALWKLPCIFICENNKYGMGTSVERASASTDYYKRGDFIPGL 240          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Zebrafish
Match: pdha1b (pyruvate dehydrogenase E1 alpha 1 subunit b [Source:ZFIN;Acc:ZDB-GENE-040718-96])

HSP 1 Score: 300.827 bits (769), Expect = 1.106e-95
Identity = 134/219 (61.19%), Postives = 174/219 (79.45%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L++L+ GP+ +T+ T+ DGL   + M  +RRME     LYK+K+IRGFCHL  GQEA AVGIEA + P D +IT+YR HG+T TRG S+  I+AEL G++ GV++GKGGSMHMY KN+YGGNGIVGAQVPLGAG+ALA +Y+  N +C+TLYGDGAANQGQ+FE++N+A LW LPCIFICENN +GMGTS +R+SAS +YY RGD+IPG+
Sbjct:   44 ANFDIKRCDLHRLDEGPSVQTVLTREDGLKYYRMMQTMRRMELKADQLYKQKIIRGFCHLYDGQEACAVGIEAGIKPTDHLITAYRAHGYTYTRGVSVKEIMAELTGRRGGVAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGVALACQYQGKNEICVTLYGDGAANQGQIFESFNMAALWKLPCIFICENNKYGMGTSVERASASTDYYKRGDFIPGL 262          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Zebrafish
Match: pdha1b (pyruvate dehydrogenase E1 alpha 1 subunit b [Source:ZFIN;Acc:ZDB-GENE-040718-96])

HSP 1 Score: 300.442 bits (768), Expect = 1.176e-95
Identity = 134/219 (61.19%), Postives = 174/219 (79.45%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L++L+ GP+ +T+ T+ DGL   + M  +RRME     LYK+K+IRGFCHL  GQEA AVGIEA + P D +IT+YR HG+T TRG S+  I+AEL G++ GV++GKGGSMHMY KN+YGGNGIVGAQVPLGAG+ALA +Y+  N +C+TLYGDGAANQGQ+FE++N+A LW LPCIFICENN +GMGTS +R+SAS +YY RGD+IPG+
Sbjct:   37 ANFDIKRCDLHRLDEGPSVQTVLTREDGLKYYRMMQTMRRMELKADQLYKQKIIRGFCHLYDGQEACAVGIEAGIKPTDHLITAYRAHGYTYTRGVSVKEIMAELTGRRGGVAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGVALACQYQGKNEICVTLYGDGAANQGQIFESFNMAALWKLPCIFICENNKYGMGTSVERASASTDYYKRGDFIPGL 255          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Zebrafish
Match: pdha1b (pyruvate dehydrogenase E1 alpha 1 subunit b [Source:ZFIN;Acc:ZDB-GENE-040718-96])

HSP 1 Score: 300.442 bits (768), Expect = 1.176e-95
Identity = 134/219 (61.19%), Postives = 174/219 (79.45%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L++L+ GP+ +T+ T+ DGL   + M  +RRME     LYK+K+IRGFCHL  GQEA AVGIEA + P D +IT+YR HG+T TRG S+  I+AEL G++ GV++GKGGSMHMY KN+YGGNGIVGAQVPLGAG+ALA +Y+  N +C+TLYGDGAANQGQ+FE++N+A LW LPCIFICENN +GMGTS +R+SAS +YY RGD+IPG+
Sbjct:   37 ANFDIKRCDLHRLDEGPSVQTVLTREDGLKYYRMMQTMRRMELKADQLYKQKIIRGFCHLYDGQEACAVGIEAGIKPTDHLITAYRAHGYTYTRGVSVKEIMAELTGRRGGVAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGVALACQYQGKNEICVTLYGDGAANQGQIFESFNMAALWKLPCIFICENNKYGMGTSVERASASTDYYKRGDFIPGL 255          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Zebrafish
Match: pdha1a (pyruvate dehydrogenase E1 alpha 1 subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-2719])

HSP 1 Score: 290.041 bits (741), Expect = 1.483e-91
Identity = 130/219 (59.36%), Postives = 172/219 (78.54%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   ++KLE GPA + + T+ +GL   + M  +RRME     LYK+K+IRGFCHL  GQEA AVGIEA +  +D +IT+YR HG+T+TRG ++  I+AEL G++ G+++GKGGSMHMY K++YGGNGIVGAQVPLGAG+ALA KY+  N +C+ LYGDGAANQGQ+FE YN+A LW LPCIFICENN +GMGTS +R++AS +YY RGD+IPG+
Sbjct:   37 ATFDIKKCDVHKLEEGPAVQAVLTREEGLQYYRTMQTMRRMELKADQLYKQKIIRGFCHLYDGQEACAVGIEAGINLSDHLITAYRAHGYTLTRGGTVREIMAELTGRRGGIAKGKGGSMHMYTKHFYGGNGIVGAQVPLGAGVALACKYQGKNELCVCLYGDGAANQGQIFETYNMASLWKLPCIFICENNKYGMGTSVERAAASTDYYKRGDFIPGL 255          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Xenopus
Match: igkv1or2-118 (immunoglobulin kappa variable 1/OR2-118 (pseudogene) [Source:Xenbase;Acc:XB-GENE-5827947])

HSP 1 Score: 289.656 bits (740), Expect = 1.335e-91
Identity = 130/219 (59.36%), Postives = 167/219 (76.26%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   +++LE GP  + + T+  GL   + M  IRRME     LYK+K+IRGFCHL  GQEA  VG+EAA+ P D +IT+YR HG++ TRG S+  I+AEL G++ G ++GKGGSMHMY KN+YGGNGIVGAQVPLGAGIALA K+   + +C+ LYGDGAANQGQ+FE YN+A LW LPCIFICENN +GMGTS +R++AS +YY RGDYIPG+
Sbjct:   18 ATFDIKKCDVHRLEEGPPTQAVLTREQGLQYYRTMQTIRRMELKSDQLYKQKIIRGFCHLYDGQEACCVGLEAAINPTDHLITAYRAHGYSYTRGVSVKEILAELTGRRGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKFFGKDEICVALYGDGAANQGQIFETYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDYIPGL 236          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Xenopus
Match: igkv1or2-118 (immunoglobulin kappa variable 1/OR2-118 (pseudogene) [Source:Xenbase;Acc:XB-GENE-5827947])

HSP 1 Score: 289.271 bits (739), Expect = 1.468e-91
Identity = 132/220 (60.00%), Postives = 167/220 (75.91%), Query Frame = 3
Query:  144 QPYK------LYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            QP+K      +++LE GP  + + T+  GL   + M  IRRME     LYK+K+IRGFCHL  GQEA  VG+EAA+ P D +IT+YR HG++ TRG S+  I+AEL G++ G ++GKGGSMHMY KN+YGGNGIVGAQVPLGAGIALA K+   + +C+ LYGDGAANQGQ+FE YN+A LW LPCIFICENN +GMGTS +R++AS +YY RGDYIPG+
Sbjct:    3 QPFKGEKKCDVHRLEEGPPTQAVLTREQGLQYYRTMQTIRRMELKSDQLYKQKIIRGFCHLYDGQEACCVGLEAAINPTDHLITAYRAHGYSYTRGVSVKEILAELTGRRGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKFFGKDEICVALYGDGAANQGQIFETYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDYIPGL 222          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Xenopus
Match: igkv1or2-118 (immunoglobulin kappa variable 1/OR2-118 (pseudogene) [Source:Xenbase;Acc:XB-GENE-5827947])

HSP 1 Score: 289.656 bits (740), Expect = 2.810e-91
Identity = 130/219 (59.36%), Postives = 167/219 (76.26%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   +++LE GP  + + T+  GL   + M  IRRME     LYK+K+IRGFCHL  GQEA  VG+EAA+ P D +IT+YR HG++ TRG S+  I+AEL G++ G ++GKGGSMHMY KN+YGGNGIVGAQVPLGAGIALA K+   + +C+ LYGDGAANQGQ+FE YN+A LW LPCIFICENN +GMGTS +R++AS +YY RGDYIPG+
Sbjct:   39 ATFDIKKCDVHRLEEGPPTQAVLTREQGLQYYRTMQTIRRMELKSDQLYKQKIIRGFCHLYDGQEACCVGLEAAINPTDHLITAYRAHGYSYTRGVSVKEILAELTGRRGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKFFGKDEICVALYGDGAANQGQIFETYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDYIPGL 257          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Xenopus
Match: igkv1or2-118 (immunoglobulin kappa variable 1/OR2-118 (pseudogene) [Source:Xenbase;Acc:XB-GENE-5827947])

HSP 1 Score: 288.115 bits (736), Expect = 4.218e-91
Identity = 129/210 (61.43%), Postives = 163/210 (77.62%), Query Frame = 3
Query:  156 LYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            +++LE GP  + + T+  GL   + M  IRRME     LYK+K+IRGFCHL  GQEA  VG+EAA+ P D +IT+YR HG++ TRG S+  I+AEL G++ G ++GKGGSMHMY KN+YGGNGIVGAQVPLGAGIALA K+   + +C+ LYGDGAANQGQ+FE YN+A LW LPCIFICENN +GMGTS +R++AS +YY RGDYIPG+
Sbjct:   15 VHRLEEGPPTQAVLTREQGLQYYRTMQTIRRMELKSDQLYKQKIIRGFCHLYDGQEACCVGLEAAINPTDHLITAYRAHGYSYTRGVSVKEILAELTGRRGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKFFGKDEICVALYGDGAANQGQIFETYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDYIPGL 224          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Xenopus
Match: igkv1or2-118 (immunoglobulin kappa variable 1/OR2-118 (pseudogene) [Source:Xenbase;Acc:XB-GENE-5827947])

HSP 1 Score: 288.115 bits (736), Expect = 4.989e-91
Identity = 129/210 (61.43%), Postives = 163/210 (77.62%), Query Frame = 3
Query:  156 LYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            +++LE GP  + + T+  GL   + M  IRRME     LYK+K+IRGFCHL  GQEA  VG+EAA+ P D +IT+YR HG++ TRG S+  I+AEL G++ G ++GKGGSMHMY KN+YGGNGIVGAQVPLGAGIALA K+   + +C+ LYGDGAANQGQ+FE YN+A LW LPCIFICENN +GMGTS +R++AS +YY RGDYIPG+
Sbjct:   19 VHRLEEGPPTQAVLTREQGLQYYRTMQTIRRMELKSDQLYKQKIIRGFCHLYDGQEACCVGLEAAINPTDHLITAYRAHGYSYTRGVSVKEILAELTGRRGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKFFGKDEICVALYGDGAANQGQIFETYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDYIPGL 228          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Mouse
Match: Pdha1 (pyruvate dehydrogenase E1 alpha 1 [Source:MGI Symbol;Acc:MGI:97532])

HSP 1 Score: 297.745 bits (761), Expect = 1.391e-94
Identity = 135/219 (61.64%), Postives = 169/219 (77.17%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L++LE GP   T+ T+ DGL   + M  +RRME     LYK+K+IRGFCHL  GQEA  VG+EA + P D +IT+YR HGFT TRG  + +I+AEL G++ G ++GKGGSMHMY KN+YGGNGIVGAQVPLGAGIALA KY   + VC+TLYGDGAANQGQ+FEAYN+A LW LPCIFICENN +GMGTS +R++AS +YY RGD+IPG+
Sbjct:   34 ATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLPVRAILAELTGRRGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGL 252          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Mouse
Match: Pdha2 (pyruvate dehydrogenase E1 alpha 2 [Source:MGI Symbol;Acc:MGI:97533])

HSP 1 Score: 269.24 bits (687), Expect = 1.089e-83
Identity = 134/210 (63.81%), Postives = 162/210 (77.14%), Query Frame = 3
Query:  156 LYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            LY+LE GP   T+ T+A+ L   + M  IRRME     LYK+K IRGFCHL  GQEA  VG+EA + P D +ITSYR HGF  TRG S+ SI+AEL G+K G ++GKGGSMHMYGKN+YGGNGIVGAQVPLGAG+A A KY K+  VC+ LYGDGAANQGQVFEAYN++ LW LPC+FICENN +GMGTS +RS+AS +Y+ +G  IPG+
Sbjct:   44 LYRLEEGPPTSTVLTRAEALKYYRTMQVIRRMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPTDHVITSYRAHGFCYTRGLSVKSILAELTGRKGGCAKGKGGSMHMYGKNFYGGNGIVGAQVPLGAGVAFACKYLKNGQVCLALYGDGAANQGQVFEAYNMSALWKLPCVFICENNLYGMGTSNERSAASTDYHKKGFIIPGL 253          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Mouse
Match: Bckdha (branched chain ketoacid dehydrogenase E1, alpha polypeptide [Source:MGI Symbol;Acc:MGI:107701])

HSP 1 Score: 62.3882 bits (150), Expect = 8.990e-10
Identity = 46/185 (24.86%), Postives = 80/185 (43.24%), Query Frame = 3
Query:  177 PANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYG---KNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGT 722
            P+ +    + + L   + M  +  M+ +     ++  I  F   + G+E   VG  AAL   D +   YR  G  M R   +   +++  G      +G+   +H YG   +++   +  +  Q+P   G A A K    N + I  +G+GAA++G     +N A     P IF C NN + + T
Sbjct:   92 PSEDPHLPQEEVLKFYRSMTLLNTMDRILYESQRQGRI-SFYMTNYGEEGTHVGSAAALERTDLVFGQYREAGVLMYRDYPLELFMSQCYGNVNDPGKGRQMPVH-YGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRIVICYFGEGAASEGDAHAGFNFAATLECPIIFFCRNNGYAIST 274          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. UniProt/SwissProt
Match: sp|P52899|ODPA_CAEEL (Probable pyruvate dehydrogenase E1 component subunit alpha, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=T05H10.6 PE=3 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 4.733e-96
Identity = 138/218 (63.30%), Postives = 170/218 (77.98%), Query Frame = 3
Query:  135 FLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            F  +P KL+KL++GP       + D L   + M  IRRME+  GNLYKEK IRGFCHL SGQEA AVG++AA+   D++IT+YRCHG+T   GA++  ++AEL G+  G   GKGGSMHMY KN+YGGNGIVGAQ PLGAG+ALA KY++   VC+TLYGDGAANQGQ+FEA N+AKLW+LP +F+CENN FGMGT+A+RSSAS  YYTRGDY+PGIW
Sbjct:   30 FHTKPCKLHKLDNGPNTSVTLNREDALKYYRDMQVIRRMESAAGNLYKEKKIRGFCHLYSGQEACAVGMKAAMTEGDAVITAYRCHGWTWLLGATVTEVLAELTGRVAGNVHGKGGSMHMYTKNFYGGNGIVGAQQPLGAGVALAMKYREQKNVCVTLYGDGAANQGQLFEATNMAKLWDLPVLFVCENNGFGMGTTAERSSASTEYYTRGDYVPGIW 247          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. UniProt/SwissProt
Match: sp|A7MB35|ODPA_BOVIN (Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Bos taurus OX=9913 GN=PDHA1 PE=2 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 4.232e-94
Identity = 136/219 (62.10%), Postives = 169/219 (77.17%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L++LE GP   T+ T+ DGL   + M  +RRME     LYK+K+IRGFCHL  GQEA  VG+EA + P D +IT+YR HGFT TRG S+  I+AEL G++ G ++GKGGSMHMY KN+YGGNGIVGAQVPLGAGIALA KY   + VC+TLYGDGAANQGQ+FEAYN+A LW LPCIFICENN +GMGTS +R++AS +YY RGD+IPG+
Sbjct:   34 ATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLSVREILAELTGRRGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGL 252          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. UniProt/SwissProt
Match: sp|P26268|ODPT_ASCSU (Pyruvate dehydrogenase E1 component subunit alpha type II, mitochondrial (Fragment) OS=Ascaris suum OX=6253 PE=2 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 7.211e-94
Identity = 137/220 (62.27%), Postives = 168/220 (76.36%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            + F  +P+KL+KL+SGP      TK D L    +M  IRRMET  GNLYKEK +RGFCHL SGQEA AVG++AA+ P D+ IT+YRCHG+T   G+ +  ++ EL G+ TG   GKGGSMHMYG+N+YGGNGIVGAQ PLG GIA A KYKK   VCITL+GDGA NQGQ++E+ N+AKLW LP +++CENN +GMGTSA RSSAS +YYTRGDY+PG W
Sbjct:   25 ATFQAKPFKLHKLDSGPDVNMHVTKEDALRYYTQMQTIRRMETAAGNLYKEKKVRGFCHLYSGQEACAVGMKAAMEPGDAAITAYRCHGWTYLSGSPVAKVLCELTGRITGNVYGKGGSMHMYGENFYGGNGIVGAQQPLGTGIAFAMKYKKQKNVCITLFGDGATNQGQLYESMNMAKLWELPVLYVCENNGYGMGTSAARSSASTDYYTRGDYVPGFW 244          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. UniProt/SwissProt
Match: sp|P35486|ODPA_MOUSE (Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus OX=10090 GN=Pdha1 PE=1 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 9.733e-94
Identity = 135/219 (61.64%), Postives = 169/219 (77.17%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L++LE GP   T+ T+ DGL   + M  +RRME     LYK+K+IRGFCHL  GQEA  VG+EA + P D +IT+YR HGFT TRG  + +I+AEL G++ G ++GKGGSMHMY KN+YGGNGIVGAQVPLGAGIALA KY   + VC+TLYGDGAANQGQ+FEAYN+A LW LPCIFICENN +GMGTS +R++AS +YY RGD+IPG+
Sbjct:   34 ATFEIKKCDLHRLEEGPPVTTVLTREDGLKYYRMMQTVRRMELKADQLYKQKIIRGFCHLCDGQEACCVGLEAGINPTDHLITAYRAHGFTFTRGLPVRAILAELTGRRGGCAKGKGGSMHMYAKNFYGGNGIVGAQVPLGAGIALACKYNGKDEVCLTLYGDGAANQGQIFEAYNMAALWKLPCIFICENNRYGMGTSVERAAASTDYYKRGDFIPGL 252          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. UniProt/SwissProt
Match: sp|P26267|ODPA_ASCSU (Pyruvate dehydrogenase E1 component subunit alpha type I, mitochondrial OS=Ascaris suum OX=6253 PE=1 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 2.935e-93
Identity = 133/220 (60.45%), Postives = 171/220 (77.73%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            + F  +P+KL+KL+SGP      TK D ++   +M  IRRME+  GNLYKEK +RGFCHL SGQEA AVG +AA+   D+ +T+YRCHG+T   G+S+  ++ EL G+ TG   GKGGSMHMYG+N+YGGNGIVGAQ PLG GIA A KY+K+  VCIT++GDGA NQGQ+FE+ N+AKLW+LP +++CENN +GMGT+A RSSAS +YYTRGDY+PGIW
Sbjct:   30 ATFQTKPFKLHKLDSGPDINVHVTKEDAVHYYTQMLTIRRMESAAGNLYKEKKVRGFCHLYSGQEACAVGTKAAMDAGDAAVTAYRCHGWTYLSGSSVAKVLCELTGRITGNVYGKGGSMHMYGENFYGGNGIVGAQQPLGTGIAFAMKYRKEKNVCITMFGDGATNQGQLFESMNMAKLWDLPVLYVCENNGYGMGTAAARSSASTDYYTRGDYVPGIW 249          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. TrEMBL
Match: A0A504YAI3 (Pyruvate dehydrogenase E1 component subunit alpha OS=Fasciola gigantica OX=46835 GN=FGIG_02061 PE=4 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 2.966e-109
Identity = 155/220 (70.45%), Postives = 187/220 (85.00%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            ++F L  YKL+KL+S P+N T CT+ D L  L ++ +IRRMET  GN+YKEK IRGFCHLSSGQEAVAVGIEAAL P D+IIT+YRCHGFTMTRG ++HS++AEL GK+TGVS GKGGSMHM+GK+++GGNGIVGAQVPLG GIAL  K+  D  V +TL+GDGAANQGQVFEA+N+AKLWNLP IF+CENN +GMGT+  R+SA+ +YYTRGDYIPGIW
Sbjct:   33 AQFDLTEYKLFKLDSPPSNRTECTRDDALLYLNELLRIRRMETTAGNMYKEKQIRGFCHLSSGQEAVAVGIEAALSPGDTIITAYRCHGFTMTRGVAVHSVLAELAGKRTGVSAGKGGSMHMFGKDFFGGNGIVGAQVPLGVGIALRMKHHGDRTVSVTLFGDGAANQGQVFEAFNMAKLWNLPVIFVCENNKYGMGTAVHRASANTDYYTRGDYIPGIW 252          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. TrEMBL
Match: A0A4E0R790 (Pyruvate dehydrogenase E1 component subunit alpha OS=Fasciola hepatica OX=6192 GN=D915_004660 PE=4 SV=1)

HSP 1 Score: 343.584 bits (880), Expect = 4.560e-109
Identity = 154/220 (70.00%), Postives = 187/220 (85.00%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            ++F L  YKL+KL+S P+N T CT+ D L  L ++ +IRRMET  GN+YKEK IRGFCHLSSGQEAVAVGIEAAL P D+I+T+YRCHGFTMTRG ++HSI+AEL GK+TGVS GKGGSMHM+GK+++GGNGIVGAQVPLG GIAL  K+  D  V +TL+GDGAANQGQVFEA+N+AKLWNLP +F+CENN +GMGT+  R+SA+ +YYTRGDYIPGIW
Sbjct:   33 AQFDLTEYKLFKLDSPPSNRTECTRDDALLYLNELLRIRRMETTAGNMYKEKQIRGFCHLSSGQEAVAVGIEAALSPGDTIVTAYRCHGFTMTRGVAVHSILAELAGKRTGVSAGKGGSMHMFGKDFFGGNGIVGAQVPLGVGIALRMKHHGDRTVSVTLFGDGAANQGQVFEAFNMAKLWNLPVVFVCENNKYGMGTAVHRASANTDYYTRGDYIPGIW 252          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. TrEMBL
Match: A0A095A1X8 (Pyruvate dehydrogenase E1 component subunit alpha OS=Schistosoma haematobium OX=6185 GN=MS3_09290 PE=4 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 1.148e-107
Identity = 156/220 (70.91%), Postives = 186/220 (84.55%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            +KF L  YK +KL+S PANET C++ D L  L+ + +IRRMET  GN+YKEKLIRGFCHL SGQEAVAVGIEAAL P D+IIT+YRCHGFTMTRG  +H+I+AEL G++TG ++G GGSMH+Y K++YGGNGIVGAQVPLG GIAL  K++ +  V +TLYGDGAANQGQVFEA+NIAKLWNLP IFICENN +GMGTS +RSSA+ NYYTRGDYIPG+W
Sbjct:   33 AKFSLSDYKSFKLDSTPANETECSRDDALRYLESLHRIRRMETALGNMYKEKLIRGFCHLYSGQEAVAVGIEAALQPGDTIITAYRCHGFTMTRGVPVHNIVAELAGRRTGCTKGLGGSMHLYAKDFYGGNGIVGAQVPLGVGIALRMKHRGEKFVSVTLYGDGAANQGQVFEAFNIAKLWNLPVIFICENNKYGMGTSVQRSSANTNYYTRGDYIPGLW 252          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. TrEMBL
Match: G4VT40 (Pyruvate dehydrogenase E1 component subunit alpha OS=Schistosoma mansoni OX=6183 GN=Smp_079920 PE=4 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 2.120e-107
Identity = 157/220 (71.36%), Postives = 186/220 (84.55%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            +KF L  YK +KL+S PANET C++ D L  L+ + +IRRMET  GN+YKEKLIRGFCHL SGQEAVAVGIEAAL P D+IIT+YRCHGFTMTRG  IH+I+AEL G+KTG ++G GGSMH+Y K++YGGNGIVGAQVPLG GIAL  K++ +  V +TLYGDGAANQGQVFEA+NIAKLWNLP IFICENN +GMGTS +RSSA+ +YYTRGDYIPG+W
Sbjct:   33 AKFSLSDYKSFKLDSTPANETECSRDDALRYLESLHRIRRMETALGNMYKEKLIRGFCHLYSGQEAVAVGIEAALQPGDTIITAYRCHGFTMTRGVPIHNIVAELAGRKTGCTKGLGGSMHLYAKDFYGGNGIVGAQVPLGVGIALRMKHRGEKFVSVTLYGDGAANQGQVFEAFNIAKLWNLPVIFICENNKYGMGTSVQRSSANTSYYTRGDYIPGLW 252          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. TrEMBL
Match: A0A4Z2DRJ9 (Pyruvate dehydrogenase E1 component subunit alpha type II OS=Schistosoma japonicum OX=6182 GN=EWB00_009469 PE=4 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 2.344e-107
Identity = 155/221 (70.14%), Postives = 183/221 (82.81%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIWD 791
            ++F L  YK++KL++ PA ET CT+ D L  L+ +  IRRMET  GNLYKEK IRGFCHL SGQEAVAVGIEAAL P D+IIT+YRCHGFTMTRG  +H I+AEL GKKTG ++G GGSMH+Y K++YGGNGIVGAQVPLG GIAL  KY+ +  V +TLYGDGAANQGQVFEA+N+AKLWNLP IFICENN +GMGTS  R+SA+ NYYTRGDYIPG+W+
Sbjct:   32 ARFTLSDYKVFKLDTTPAQETECTRDDALKYLETLHCIRRMETALGNLYKEKHIRGFCHLYSGQEAVAVGIEAALQPGDTIITAYRCHGFTMTRGVPVHDIVAELAGKKTGCTKGVGGSMHLYAKDFYGGNGIVGAQVPLGVGIALRMKYRGEKSVSVTLYGDGAANQGQVFEAFNMAKLWNLPVIFICENNKYGMGTSVDRASANTNYYTRGDYIPGLWE 252          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Cavefish
Match: pdha1a (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like [Source:NCBI gene;Acc:103026590])

HSP 1 Score: 290.041 bits (741), Expect = 9.225e-92
Identity = 131/219 (59.82%), Postives = 170/219 (77.63%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L+KLE GP  + + T+ +GL   + M  +RRME     LYK+K+IRGFCHL  GQEA AVGIEA +   D +IT+YR HG+T+TRG ++  I+AEL G++ G+++GKGGSMHMY KN+YGGNGIVGAQVPLGAG+ALA KY+  N +C+ LYGDGAANQGQ+FE YN+A LW LPCIFICENN +GMGTS +R++AS +YY RGD+IPG+
Sbjct:   37 ATFDIKKCDLHKLEDGPPLQAVLTREEGLKYYRTMQVMRRMELKADQLYKQKIIRGFCHLYDGQEACAVGIEAGINLTDHLITAYRAHGYTLTRGGTVREIMAELTGRRGGIAKGKGGSMHMYTKNFYGGNGIVGAQVPLGAGVALACKYQGKNELCVCLYGDGAANQGQIFETYNMASLWKLPCIFICENNKYGMGTSVERAAASTDYYKRGDFIPGL 255          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Cavefish
Match: pdha1a (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like [Source:NCBI gene;Acc:103026590])

HSP 1 Score: 290.426 bits (742), Expect = 1.061e-91
Identity = 131/219 (59.82%), Postives = 170/219 (77.63%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L+KLE GP  + + T+ +GL   + M  +RRME     LYK+K+IRGFCHL  GQEA AVGIEA +   D +IT+YR HG+T+TRG ++  I+AEL G++ G+++GKGGSMHMY KN+YGGNGIVGAQVPLGAG+ALA KY+  N +C+ LYGDGAANQGQ+FE YN+A LW LPCIFICENN +GMGTS +R++AS +YY RGD+IPG+
Sbjct:   44 ATFDIKKCDLHKLEDGPPLQAVLTREEGLKYYRTMQVMRRMELKADQLYKQKIIRGFCHLYDGQEACAVGIEAGINLTDHLITAYRAHGYTLTRGGTVREIMAELTGRRGGIAKGKGGSMHMYTKNFYGGNGIVGAQVPLGAGVALACKYQGKNELCVCLYGDGAANQGQIFETYNMASLWKLPCIFICENNKYGMGTSVERAAASTDYYKRGDFIPGL 262          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Cavefish
Match: pdha1b (pyruvate dehydrogenase E1 alpha 1 subunit b [Source:ZFIN;Acc:ZDB-GENE-040718-96])

HSP 1 Score: 276.559 bits (706), Expect = 9.230e-87
Identity = 134/219 (61.19%), Postives = 173/219 (79.00%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L++L+ GP ++ + T+  GL   + M  +RRME     LYK+K+IRGFCHL  GQEA A+GIEA + P D +IT+YR HG+T TRG S+  I+AEL G+K GV++GKGGSMHMY K++YGGNGIVGAQVPLGAG+ALA +YK +N VC+TLYGDGAANQGQ+FEA+N+A LW LPCIFICENN +GMGTS +R+SAS +YY RGD+IPG+
Sbjct:   19 ASFDVKKCDLHRLDQGPPSQAVMTREQGLKYYRVMQTMRRMELKADQLYKQKIIRGFCHLYDGQEACAMGIEAGINPTDHLITAYRAHGYTYTRGVSVKEILAELTGRKGGVAKGKGGSMHMYAKHFYGGNGIVGAQVPLGAGVALACQYKGNNEVCVTLYGDGAANQGQIFEAFNMASLWKLPCIFICENNKYGMGTSVERASASTDYYKRGDFIPGL 237          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Cavefish
Match: pdha1b (pyruvate dehydrogenase E1 alpha 1 subunit b [Source:ZFIN;Acc:ZDB-GENE-040718-96])

HSP 1 Score: 276.944 bits (707), Expect = 1.346e-86
Identity = 134/219 (61.19%), Postives = 173/219 (79.00%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L++L+ GP ++ + T+  GL   + M  +RRME     LYK+K+IRGFCHL  GQEA A+GIEA + P D +IT+YR HG+T TRG S+  I+AEL G+K GV++GKGGSMHMY K++YGGNGIVGAQVPLGAG+ALA +YK +N VC+TLYGDGAANQGQ+FEA+N+A LW LPCIFICENN +GMGTS +R+SAS +YY RGD+IPG+
Sbjct:   43 ASFDVKKCDLHRLDQGPPSQAVMTREQGLKYYRVMQTMRRMELKADQLYKQKIIRGFCHLYDGQEACAMGIEAGINPTDHLITAYRAHGYTYTRGVSVKEILAELTGRKGGVAKGKGGSMHMYAKHFYGGNGIVGAQVPLGAGVALACQYKGNNEVCVTLYGDGAANQGQIFEAFNMASLWKLPCIFICENNKYGMGTSVERASASTDYYKRGDFIPGL 261          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Cavefish
Match: pdha1a (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial-like [Source:NCBI gene;Acc:103026590])

HSP 1 Score: 229.18 bits (583), Expect = 5.097e-69
Identity = 109/219 (49.77%), Postives = 144/219 (65.75%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L+KLE GP  + + T+ +GL   + M  +RRME     LYK+K+IRGFCHL  GQEA AVGIEA +   D +IT+YR HG+T+TRG ++  I+AEL G++ G+++GKGGSMHMY KN+YGGNGIVGAQ                               GQ+FE YN+A LW LPCIFICENN +GMGTS +R++AS +YY RGD+IPG+
Sbjct:   27 ATFDIKKCDLHKLEDGPPLQAVLTREEGLKYYRTMQVMRRMELKADQLYKQKIIRGFCHLYDGQEACAVGIEAGINLTDHLITAYRAHGYTLTRGGTVREIMAELTGRRGGIAKGKGGSMHMYTKNFYGGNGIVGAQ-------------------------------GQIFETYNMASLWKLPCIFICENNKYGMGTSVERAAASTDYYKRGDFIPGL 214          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Sea Lamprey
Match: bckdha (branched chain keto acid dehydrogenase E1 subunit alpha [Source:ZFIN;Acc:ZDB-GENE-050522-376])

HSP 1 Score: 69.3218 bits (168), Expect = 7.017e-13
Identity = 51/191 (26.70%), Postives = 83/191 (43.46%), Query Frame = 3
Query:  174 GPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKN---YYGGNGIVGAQVPLG---AGIALAHKYKKDNG--VCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGT 722
             P  +    K   L M KKM  +  M+ +     ++  I  F   + G+E   +G  AAL P D +   YR  G  M R   +   +++  G      +G+   +H YG N   +   +  +  Q+P     A +  A+ YK+ N   V I  +G+GAA++G     +N +     P IF C NN + + T
Sbjct:   44 NPKEDPKLDKETVLKMYKKMTLLNTMDRILYESQRQGRI-SFYMTNYGEEGTHMGSAAALEPHDLVFGQYREAGVLMWRDFPLDMFMSQCYGNVDDPGKGRQMPVH-YGSNELNFVTISSPLATQIPQARTHAAVGAAYAYKRANNDRVVICYFGEGAASEGDAHAGFNFSATLECPVIFFCRNNGYAIST 232          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Yeast
Match: PDA1 (E1 alpha subunit of the pyruvate dehydrogenase (PDH) complex; catalyzes the direct oxidative decarboxylation of pyruvate to acetyl-CoA; phosphorylated; regulated by glucose; PDH complex is concentrated in spots within the mitochondrial matrix, often near the ERMES complex and near peroxisomes [Source:SGD;Acc:S000000980])

HSP 1 Score: 287.345 bits (734), Expect = 3.103e-91
Identity = 137/220 (62.27%), Postives = 165/220 (75.00%), Query Frame = 3
Query:  126 FSKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            F  ++L+P  L       + ET  +KA  L M K M  IRRME  C  LYK K IRGFCHLS GQEA+AVGIE A+   DSIITSYRCHGFT  RGAS+ +++AELMG++ GVS GKGGSMH+Y   +YGGNGIVGAQVPLGAG+A AH+YK ++    TLYGDGA+NQGQVFE++N+AKLWNLP +F CENN +GMGT+A RSSA   Y+ RG YIPG+
Sbjct:   62 FESYMLEPPDL-------SYET--SKATLLQMYKDMVIIRRMEMACDALYKAKKIRGFCHLSVGQEAIAVGIENAITKLDSIITSYRCHGFTFMRGASVKAVLAELMGRRAGVSYGKGGSMHLYAPGFYGGNGIVGAQVPLGAGLAFAHQYKNEDACSFTLYGDGASNQGQVFESFNMAKLWNLPVVFCCENNKYGMGTAASRSSAMTEYFKRGQYIPGL 272          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Nematostella
Match: EDO33561 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRY1])

HSP 1 Score: 305.834 bits (782), Expect = 3.751e-98
Identity = 138/219 (63.01%), Postives = 174/219 (79.45%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            ++F L+ Y L+K+  GP  + + T+ +GL   ++M  +RRMET   NLYK K+IRGFCHL SGQEA  VG+EA++   DS+IT+YRCHG+T  RG S   ++ EL G+KTG ++GKGGSMHMYG  YYGGNGIVGAQVPLGAGIALAHK + +  +C+TLYGDGAANQGQ+FE YN+AKLWNLPCIFICENN +GMGTS +R++A+  YY+RGDYIPGI
Sbjct:   37 AEFDLREYTLHKITDGPPGKAVMTREEGLTYYRQMQIVRRMETAASNLYKSKVIRGFCHLYSGQEACCVGMEASIDKNDSVITAYRCHGWTYMRGRSAREVLCELTGRKTGCTQGKGGSMHMYGHEYYGGNGIVGAQVPLGAGIALAHKLRGNGRICLTLYGDGAANQGQLFETYNMAKLWNLPCIFICENNGYGMGTSVERAAATTEYYSRGDYIPGI 255          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Nematostella
Match: EDO43057 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV6])

HSP 1 Score: 73.9442 bits (180), Expect = 5.453e-14
Identity = 51/176 (28.98%), Postives = 84/176 (47.73%), Query Frame = 3
Query:  213 LNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGK--NYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLY-GDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAK 731
            ++M KKM  +  M+ +     ++  I  F   + G+EA   G  AAL   D I+  YR  G  M RG ++   + +    +    +G+   +H   K  N+   +  +  Q+P  +G A A K ++  G C+  Y GDGAA++G    A+N A   + P IF C NN + + T  +
Sbjct:  101 VDMYKKMTLLNTMDRILYESQRQGRI-SFYMTNYGEEATHFGSAAALEMEDLIMGQYREAGVLMWRGFTLADFMNQCYANQHDAGKGRQMPVHYGSKELNFVTISSTLATQMPQASGAAYALK-RQGKGNCVMCYFGDGAASEGDAHSAFNFAATLDAPVIFFCRNNGYAISTPTR 274          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Medaka
Match: pdha1a (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:NCBI gene;Acc:101165911])

HSP 1 Score: 285.419 bits (729), Expect = 5.504e-90
Identity = 130/219 (59.36%), Postives = 170/219 (77.63%), Query Frame = 3
Query:  129 SKFLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            + F ++   L+KL+  PA E + T+ +GL     M  IRRME     LYK+K+IRGFCHL  GQEA AVGIEA++  +D +IT+YR HG+T TRG ++  I+AEL G++ G+++GKGGSMHMY KN+YGGNGIVGAQVPLGAG+ALA KY+ +N +C+ LYGDGAANQGQ+FE YN+A LW LP IFICENN +GMGTS +R++AS +YY RG++IPG+
Sbjct:   34 ATFEIKKCDLHKLDEAPATEVVMTREEGLKYYHIMQTIRRMELKADQLYKQKIIRGFCHLYDGQEACAVGIEASINMSDHLITAYRAHGYTYTRGGTVKKIMAELTGRRGGIAKGKGGSMHMYCKNFYGGNGIVGAQVPLGAGVALACKYQGNNELCVCLYGDGAANQGQIFETYNMASLWKLPVIFICENNRYGMGTSVERAAASTDYYKRGEFIPGL 252          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Medaka
Match: pdha1a (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:NCBI gene;Acc:101165911])

HSP 1 Score: 283.108 bits (723), Expect = 4.508e-89
Identity = 129/210 (61.43%), Postives = 166/210 (79.05%), Query Frame = 3
Query:  156 LYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            L+KL+  PA E + T+ +GL     M  IRRME     LYK+K+IRGFCHL  GQEA AVGIEA++  +D +IT+YR HG+T TRG ++  I+AEL G++ G+++GKGGSMHMY KN+YGGNGIVGAQVPLGAG+ALA KY+ +N +C+ LYGDGAANQGQ+FE YN+A LW LP IFICENN +GMGTS +R++AS +YY RG++IPG+
Sbjct:   39 LHKLDEAPATEVVMTREEGLKYYHIMQTIRRMELKADQLYKQKIIRGFCHLYDGQEACAVGIEASINMSDHLITAYRAHGYTYTRGGTVKKIMAELTGRRGGIAKGKGGSMHMYCKNFYGGNGIVGAQVPLGAGVALACKYQGNNELCVCLYGDGAANQGQIFETYNMASLWKLPVIFICENNRYGMGTSVERAAASTDYYKRGEFIPGL 248          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000003224.2 (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:NCBI gene;Acc:101174054])

HSP 1 Score: 264.233 bits (674), Expect = 2.062e-81
Identity = 130/217 (59.91%), Postives = 165/217 (76.04%), Query Frame = 3
Query:  135 FLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            F ++   L++LE GP      T+  GL     M  +RRME     LYK+K+IRGFCHL  GQEA A GIEAA+  +D +IT+YR HGFT TRG S+  I+AEL G+K GV++GKGGSMHMY  ++YGGNGIVGAQVP+GAGIALA  Y+ +N +C+TLYGDGAANQGQ+FE +N+A LW LPCIFICENN +GMGT+ +R++AS +YY RGD+IPG+
Sbjct:   72 FDIKKCDLHRLEEGPPLRAELTREQGLQYYHTMQTVRRMELKADQLYKQKIIRGFCHLYDGQEACAAGIEAAINLSDHLITAYRAHGFTYTRGVSVKEILAELTGRKGGVAKGKGGSMHMYAPHFYGGNGIVGAQVPVGAGIALACSYQGNNQLCVTLYGDGAANQGQIFETFNMAALWKLPCIFICENNKYGMGTAVERAAASTDYYKRGDFIPGL 288          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000041277.1 (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:NCBI gene;Acc:101174054])

HSP 1 Score: 263.077 bits (671), Expect = 2.070e-81
Identity = 130/217 (59.91%), Postives = 165/217 (76.04%), Query Frame = 3
Query:  135 FLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            F ++   L++LE GP      T+  GL     M  +RRME     LYK+K+IRGFCHL  GQEA A GIEAA+  +D +IT+YR HGFT TRG S+  I+AEL G+K GV++GKGGSMHMY  ++YGGNGIVGAQVP+GAGIALA  Y+ +N +C+TLYGDGAANQGQ+FE +N+A LW LPCIFICENN +GMGT+ +R++AS +YY RGD+IPG+
Sbjct:   39 FDIKKCDLHRLEEGPPLRAELTREQGLQYYHTMQTVRRMELKADQLYKQKIIRGFCHLYDGQEACAAGIEAAINLSDHLITAYRAHGFTYTRGVSVKEILAELTGRKGGVAKGKGGSMHMYAPHFYGGNGIVGAQVPVGAGIALACSYQGNNQLCVTLYGDGAANQGQIFETFNMAALWKLPCIFICENNKYGMGTAVERAAASTDYYKRGDFIPGL 255          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000029291.1 (pyruvate dehydrogenase E1 component subunit alpha, mitochondrial [Source:NCBI gene;Acc:101174054])

HSP 1 Score: 263.077 bits (671), Expect = 3.012e-81
Identity = 130/217 (59.91%), Postives = 165/217 (76.04%), Query Frame = 3
Query:  135 FLLQPYKLYKLESGPANETICTKADGLNMLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGI 785
            F ++   L++LE GP      T+  GL     M  +RRME     LYK+K+IRGFCHL  GQEA A GIEAA+  +D +IT+YR HGFT TRG S+  I+AEL G+K GV++GKGGSMHMY  ++YGGNGIVGAQVP+GAGIALA  Y+ +N +C+TLYGDGAANQGQ+FE +N+A LW LPCIFICENN +GMGT+ +R++AS +YY RGD+IPG+
Sbjct:   46 FDIKKCDLHRLEEGPPLRAELTREQGLQYYHTMQTVRRMELKADQLYKQKIIRGFCHLYDGQEACAAGIEAAINLSDHLITAYRAHGFTYTRGVSVKEILAELTGRKGGVAKGKGGSMHMYAPHFYGGNGIVGAQVPVGAGIALACSYQGNNQLCVTLYGDGAANQGQIFETFNMAALWKLPCIFICENNKYGMGTAVERAAASTDYYKRGDFIPGL 262          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Planmine SMEST
Match: SMESG000073271.1 (SMESG000073271.1)

HSP 1 Score: 397.127 bits (1019), Expect = 2.704e-134
Identity = 190/190 (100.00%), Postives = 190/190 (100.00%), Query Frame = 3
Query:  219 MLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            MLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW
Sbjct:    1 MLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 190          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Planmine SMEST
Match: SMESG000073271.1 (SMESG000073271.1)

HSP 1 Score: 389.423 bits (999), Expect = 1.834e-131
Identity = 186/186 (100.00%), Postives = 186/186 (100.00%), Query Frame = 3
Query:  231 MFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            MFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW
Sbjct:    1 MFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 186          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Planmine SMEST
Match: SMESG000073271.1 (SMESG000073271.1)

HSP 1 Score: 375.555 bits (963), Expect = 4.785e-126
Identity = 180/180 (100.00%), Postives = 180/180 (100.00%), Query Frame = 3
Query:  249 METVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 788
            METVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW
Sbjct:    1 METVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADSIITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGGNGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKLWNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIW 180          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Planmine SMEST
Match: SMESG000009535.1 (SMESG000009535.1)

HSP 1 Score: 369.007 bits (946), Expect = 4.745e-121
Identity = 218/297 (73.40%), Postives = 244/297 (82.15%), Query Frame = 1
Query:  817 GLPKIPRLSPSIVAVRNQYDELKREYATLHAKYERVKGTWAPPNVIKLLRQKIERLTRARDELITESRIQRLLIKEQSTALRRAFTDVELRALVPGSVRASQLEIISAHHLPVTDILPSLPVSNPLISEVRAPSAMPVTSQQPTGVVETPTINAT----XXXXXXXXXXXXXXXLFRGAGTSEISCQIXXXXXXXXXXXXXXXXXXILYAPDVIFRSPARSIHINLIDKDPESFPVTHILDGLGLEVEDIAVLTGEVPNSSLAQEVAGPSTRREEAQFLDPPPYRPRKRKHFPTDID 1695
            GLP+IPRLSPSIVAVR+QY+EL+R+Y  LHAKYERVKGTWA P+VIK LRQKIERLTRARDEL+TESRIQRLLI+EQSTALRRAFTD+ELR LVPG+VRASQLEII AHH+PV  ILPSLPVSNP  SE RAP+A PV SQ PTG VETPTI+ T     R   R  RRRREEEL +G  TSE+S Q  D PPPYEEFEFP+ DPDI YAP+V+FRSP  SIHINL+D+DP  FPVT +LDGLGL  E+IA+L GEVP    +QEVAGPSTR EE +   PPPYRP KRK+FPTDID
Sbjct:   43 GLPRIPRLSPSIVAVRHQYEELQRKYDALHAKYERVKGTWASPDVIKSLRQKIERLTRARDELVTESRIQRLLIREQSTALRRAFTDIELRTLVPGNVRASQLEIIPAHHIPVMGILPSLPVSNPSTSEARAPAATPVVSQPPTGAVETPTISTTRRRPNRNRRRRDRRRREEELSQGVETSELSRQTGDPPPPYEEFEFPDLDPDICYAPNVVFRSPVPSIHINLVDEDPNPFPVTQVLDGLGLGTEEIAILMGEVPQIVSSQEVAGPSTRGEENRPTSPPPYRPMKRKYFPTDID 339          
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Planmine SMEST
Match: SMESG000020958.1 (SMESG000020958.1)

HSP 1 Score: 307.76 bits (787), Expect = 2.306e-91
Identity = 200/319 (62.70%), Postives = 232/319 (72.73%), Query Frame = 1
Query:  754 TTPEEIIFQEYGMNNNNSETNGLPKIPRLSPSIVAVRNQYDELKREYATLHAKYERVKGTWAPPNVIKLLRQKIERLTRARDELITESRIQRLLIKEQSTALRRAFTDVELRALVPGSVRASQLEIISAHHLPVTDILPSLPVSNPLISEVRAPSAMPVTSQQPTGVVETPTINATXXXXXXXXXXXXXXXL----FRGAGTSEISCQIXXXXXXXXXXXXXXXXXXILYAPDVIFRSPARSIHINLIDKDPESFPVTHILDGLGLEVEDIAVLTGEVPNSSLAQEVAGPSTRREEAQFLDPPPYRPRKRKHFPTDIDG 1698
            +TP ++   +   NN++S   GLPKIPRL PSIVAVR+QY+ELK+++  L AKY+R+KGTWAPP+ IK+LR+KIERLTRARDELITESR QRLLIKEQSTALRRAFTD EL+A VPGS+RASQL+II A+HLP  ++  S  VS   I E  +    P+ SQ   G  E+  I  TRRRPNRNRRRR           G   +E  C I   PPPY+EFEFPEFDPDILYAPDV FRSPARSIHINLID+D ES P  H LD LGL +EDIAVLTGEVP + + QE+AGPSTRREE Q   PPPYRP K  HF   I G
Sbjct:  886 STPRQLREDQVMNNNHDSGLTGLPKIPRLPPSIVAVRHQYEELKQKHEMLQAKYDRIKGTWAPPDAIKVLRRKIERLTRARDELITESRAQRLLIKEQSTALRRAFTDTELQACVPGSIRASQLDIIPAYHLPTANVSSSPSVSRNPIPETPSLPVEPIVSQPSIGNAESAAITRTRRRPNRNRRRRERRRRVEEDLTGLELTEAPCPISGPPPPYQEFEFPEFDPDILYAPDVTFRSPARSIHINLIDEDLESSPAIHTLDRLGLGIEDIAVLTGEVPTAIVTQEIAGPSTRREENQLSSPPPYRPMKNVHFVETIWG 1204          
The following BLAST results are available for this feature:
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDHA22.779e-9060.27pyruvate dehydrogenase E1 alpha 2 subunit [Source:... [more]
PDHA11.919e-8862.56pyruvate dehydrogenase E1 alpha 1 subunit [Source:... [more]
PDHA15.795e-8862.56pyruvate dehydrogenase E1 alpha 1 subunit [Source:... [more]
PDHA18.835e-8660.62pyruvate dehydrogenase E1 alpha 1 subunit [Source:... [more]
PDHA13.610e-6551.60pyruvate dehydrogenase E1 alpha 1 subunit [Source:... [more]
back to top
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdha-13.721e-9763.30Probable pyruvate dehydrogenase E1 component subun... [more]
pdha-13.721e-9763.30Probable pyruvate dehydrogenase E1 component subun... [more]
pdha-13.721e-9763.30Probable pyruvate dehydrogenase E1 component subun... [more]
pdha-16.360e-9763.30Probable pyruvate dehydrogenase E1 component subun... [more]
bckd-1A1.916e-1731.032-oxoisovalerate dehydrogenase subunit alpha, mito... [more]
back to top
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG70242.032e-9462.21gene:FBgn0029722 transcript:FBtr0070712[more]
Pdha8.395e-9262.33gene:FBgn0028325 transcript:FBtr0070708[more]
Pdha8.395e-9262.33gene:FBgn0028325 transcript:FBtr0070709[more]
Pdha4.505e-9162.33gene:FBgn0028325 transcript:FBtr0070711[more]
Pdha3.833e-8366.13gene:FBgn0028325 transcript:FBtr0070710[more]
back to top
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdha1b8.363e-9661.19pyruvate dehydrogenase E1 alpha 1 subunit b [Sourc... [more]
pdha1b1.106e-9561.19pyruvate dehydrogenase E1 alpha 1 subunit b [Sourc... [more]
pdha1b1.176e-9561.19pyruvate dehydrogenase E1 alpha 1 subunit b [Sourc... [more]
pdha1b1.176e-9561.19pyruvate dehydrogenase E1 alpha 1 subunit b [Sourc... [more]
pdha1a1.483e-9159.36pyruvate dehydrogenase E1 alpha 1 subunit a [Sourc... [more]
back to top
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igkv1or2-1181.335e-9159.36immunoglobulin kappa variable 1/OR2-118 (pseudogen... [more]
igkv1or2-1181.468e-9160.00immunoglobulin kappa variable 1/OR2-118 (pseudogen... [more]
igkv1or2-1182.810e-9159.36immunoglobulin kappa variable 1/OR2-118 (pseudogen... [more]
igkv1or2-1184.218e-9161.43immunoglobulin kappa variable 1/OR2-118 (pseudogen... [more]
igkv1or2-1184.989e-9161.43immunoglobulin kappa variable 1/OR2-118 (pseudogen... [more]
back to top
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Pdha11.391e-9461.64pyruvate dehydrogenase E1 alpha 1 [Source:MGI Symb... [more]
Pdha21.089e-8363.81pyruvate dehydrogenase E1 alpha 2 [Source:MGI Symb... [more]
Bckdha8.990e-1024.86branched chain ketoacid dehydrogenase E1, alpha po... [more]
back to top
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P52899|ODPA_CAEEL4.733e-9663.30Probable pyruvate dehydrogenase E1 component subun... [more]
sp|A7MB35|ODPA_BOVIN4.232e-9462.10Pyruvate dehydrogenase E1 component subunit alpha,... [more]
sp|P26268|ODPT_ASCSU7.211e-9462.27Pyruvate dehydrogenase E1 component subunit alpha ... [more]
sp|P35486|ODPA_MOUSE9.733e-9461.64Pyruvate dehydrogenase E1 component subunit alpha,... [more]
sp|P26267|ODPA_ASCSU2.935e-9360.45Pyruvate dehydrogenase E1 component subunit alpha ... [more]
back to top
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YAI32.966e-10970.45Pyruvate dehydrogenase E1 component subunit alpha ... [more]
A0A4E0R7904.560e-10970.00Pyruvate dehydrogenase E1 component subunit alpha ... [more]
A0A095A1X81.148e-10770.91Pyruvate dehydrogenase E1 component subunit alpha ... [more]
G4VT402.120e-10771.36Pyruvate dehydrogenase E1 component subunit alpha ... [more]
A0A4Z2DRJ92.344e-10770.14Pyruvate dehydrogenase E1 component subunit alpha ... [more]
back to top
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdha1a9.225e-9259.82pyruvate dehydrogenase E1 component subunit alpha,... [more]
pdha1a1.061e-9159.82pyruvate dehydrogenase E1 component subunit alpha,... [more]
pdha1b9.230e-8761.19pyruvate dehydrogenase E1 alpha 1 subunit b [Sourc... [more]
pdha1b1.346e-8661.19pyruvate dehydrogenase E1 alpha 1 subunit b [Sourc... [more]
pdha1a5.097e-6949.77pyruvate dehydrogenase E1 component subunit alpha,... [more]
back to top
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bckdha7.017e-1326.70branched chain keto acid dehydrogenase E1 subunit ... [more]
back to top
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PDA13.103e-9162.27E1 alpha subunit of the pyruvate dehydrogenase (PD... [more]
back to top
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO335613.751e-9863.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430575.453e-1428.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdha1a5.504e-9059.36pyruvate dehydrogenase E1 component subunit alpha,... [more]
pdha1a4.508e-8961.43pyruvate dehydrogenase E1 component subunit alpha,... [more]
ENSORLT00000003224.22.062e-8159.91pyruvate dehydrogenase E1 component subunit alpha,... [more]
ENSORLT00000041277.12.070e-8159.91pyruvate dehydrogenase E1 component subunit alpha,... [more]
ENSORLT00000029291.13.012e-8159.91pyruvate dehydrogenase E1 component subunit alpha,... [more]
back to top
BLAST of Pyruvate dehydrogenase E1 component subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073271.12.704e-134100.00SMESG000073271.1[more]
SMESG000073271.11.834e-131100.00SMESG000073271.1[more]
SMESG000073271.14.785e-126100.00SMESG000073271.1[more]
SMESG000009535.14.745e-12173.40SMESG000009535.1[more]
SMESG000020958.12.306e-9162.70SMESG000020958.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031345 ID=SMED30031345|Name=Pyruvate dehydrogenase E1 component subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1936bp
TGAATTATATAAATTATTTACCTACAAAAGGTTGTTAATAATTTTAGTTA
CGATATGATAAAATCAATGGGATTTTTTAATAAATTATTACAAATAATTT
CATCAAAATCTAGAAATTATTCAGATTCAGCAAATTTTTGCTTCAACCAT
ATAAATTATACAAATTGGAATCAGGCCCAGCTAATGAAACAATATGTACA
AAAGCTGATGGACTTAACATGCTTAAGAAAATGTTTCAAATTAGGCGCAT
GGAAACTGTTTGTGGGAATTTATATAAAGAGAAGTTGATACGTGGGTTTT
GTCATTTGTCGTCTGGTCAAGAAGCTGTAGCAGTTGGAATTGAAGCAGCC
CTAATTCCAGCTGATTCTATAATTACATCATATCGTTGCCATGGATTTAC
CATGACACGGGGAGCTTCAATCCATTCAATAATAGCTGAACTAATGGGGA
AAAAAACTGGAGTTAGCGAAGGTAAAGGTGGAAGCATGCATATGTATGGG
AAAAATTACTATGGTGGCAATGGAATTGTCGGTGCACAGGTTCCACTTGG
GGCAGGAATAGCATTAGCTCATAAATACAAAAAAGACAATGGAGTTTGTA
TTACACTCTACGGTGATGGAGCAGCAAATCAAGGACAAGTTTTCGAAGCA
TACAACATAGCTAAATTATGGAATTTACCTTGCATATTTATTTGCGAAAA
TAATCATTTTGGAATGGGTACGAGCGCTAAAAGATCATCTGCAAGTGTTA
ATTACTACACCAGAGGAGATTATATTCCAGGAATATGGGATGAATAACAA
TAATTCCGAAACGAATGGTCTACCGAAAATACCCCGACTCTCACCCTCAA
TCGTGGCCGTTCGCAACCAATACGACGAACTTAAACGGGAATATGCGACA
CTCCACGCGAAATATGAACGTGTAAAGGGCACTTGGGCCCCGCCAAATGT
CATCAAATTACTGAGGCAGAAGATAGAACGGCTCACTCGGGCACGAGATG
AGCTGATCACGGAATCTCGCATTCAGCGCCTGCTTATCAAAGAGCAGTCG
ACCGCATTACGACGTGCGTTTACGGACGTTGAGCTCCGGGCTCTCGTCCC
GGGGAGTGTCAGAGCCAGTCAACTGGAGATAATTTCGGCTCATCATCTCC
CTGTCACTGATATTCTCCCATCCCTCCCTGTCTCTAATCCGCTAATTTCA
GAGGTCCGAGCTCCCTCAGCAATGCCAGTAACTTCTCAACAGCCAACCGG
GGTCGTGGAGACCCCCACAATAAATGCCACTCGTAGGCGACCGAATCGGA
ACCGTCGACGTCGTCGGGAGGAAGAGCTCTTCCGAGGAGCAGGAACCTCC
GAAATTTCTTGCCAAATTGAAGATCTACCACCCCCTTATGAGGAGTTTGA
ATTTCCGGAATTCGACCCGGATATCCTCTATGCTCCTGATGTAATATTCC
GATCACCGGCCAGATCTATTCACATAAATTTGATCGACAAGGATCCGGAA
TCTTTCCCGGTCACCCACATCCTCGATGGGCTTGGGCTCGAAGTGGAAGA
TATCGCCGTTCTTACGGGCGAAGTGCCTAATTCTAGCCTGGCACAAGAAG
TCGCAGGTCCCTCAACCAGAAGAGAAGAGGCTCAATTCTTAGATCCTCCA
CCATATAGACCGAGGAAACGAAAACATTTTCCCACCGACATCGATGGAGA
CGATCAATGAGAATCCGAATTAGTGTGTGATGCAAATAGAACGTCGGAGT
GGAAATTCTTTCCCATTAGAAACTTGATATGACTAAATTTTGCACAACAT
TTTGTTTCATTGCTGGGATGAATCCGATGGTTAATAATATGGTGTTTCTT
TTGTCTTCGTTTTATTTTCTTGCGTTGGGATGGCTAAATAAATGGGTTTA
TAAGCGGCGTAGTGGGATTAAGTGGATTAAACTGTG
back to top

protein sequence of SMED30031345-orf-1

>SMED30031345-orf-1 ID=SMED30031345-orf-1|Name=SMED30031345-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=193bp
MLKKMFQIRRMETVCGNLYKEKLIRGFCHLSSGQEAVAVGIEAALIPADS
IITSYRCHGFTMTRGASIHSIIAELMGKKTGVSEGKGGSMHMYGKNYYGG
NGIVGAQVPLGAGIALAHKYKKDNGVCITLYGDGAANQGQVFEAYNIAKL
WNLPCIFICENNHFGMGTSAKRSSASVNYYTRGDYIPGIWDE*
back to top

protein sequence of SMED30031345-orf-2

>SMED30031345-orf-2 ID=SMED30031345-orf-2|Name=SMED30031345-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=307bp
MNNNNSETNGLPKIPRLSPSIVAVRNQYDELKREYATLHAKYERVKGTWA
PPNVIKLLRQKIERLTRARDELITESRIQRLLIKEQSTALRRAFTDVELR
ALVPGSVRASQLEIISAHHLPVTDILPSLPVSNPLISEVRAPSAMPVTSQ
QPTGVVETPTINATRRRPNRNRRRRREEELFRGAGTSEISCQIEDLPPPY
EEFEFPEFDPDILYAPDVIFRSPARSIHINLIDKDPESFPVTHILDGLGL
EVEDIAVLTGEVPNSSLAQEVAGPSTRREEAQFLDPPPYRPRKRKHFPTD
IDGDDQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029061THDP-binding
IPR001017DH_E1
Vocabulary: molecular function
TermDefinition
GO:0016624oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
GO:0004739pyruvate dehydrogenase (acetyl-transferring) activity
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0006086acetyl-CoA biosynthetic process from pyruvate
GO:0055114oxidation-reduction process
Vocabulary: cellular component
TermDefinition
GO:0043231intracellular membrane-bounded organelle