Calcium homeostasis endoplasmic reticulum protein

Overview
NameCalcium homeostasis endoplasmic reticulum protein
Smed IDSMED30031338
Length (bp)2857
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium homeostasis endoplasmic reticulum protein (SMED30031338) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium homeostasis endoplasmic reticulum protein (SMED30031338) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium homeostasis endoplasmic reticulum protein (SMED30031338) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium homeostasis endoplasmic reticulum protein (SMED30031338) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031338

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031338SMESG000008465.1 SmedASXL_013606SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30031338SMESG000008465.1 SmedASXL_013606SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30031338SMESG000008465.1 dd_Smed_v4_4684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031338SMESG000008465.1 dd_Smed_v4_4684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031338SMESG000008465.1 dd_Smed_v4_4684_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Human
Match: CHERP (calcium homeostasis endoplasmic reticulum protein [Source:HGNC Symbol;Acc:HGNC:16930])

HSP 1 Score: 149.828 bits (377), Expect = 2.859e-36
Identity = 91/303 (30.03%), Postives = 153/303 (50.50%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSK-SSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            P+D E RNVID+LA FVA+NG EFE MT +KQ+ N  F FLFGG +  YY+ +L+ E+++             L  K  TP     +               +        +    S+ +L       L + +Q+L    +++ QE++   +      ++ K+ E  +   ++    ++++Q +I +CTKD I  GKN++  N  K     + +  +L   ++   + F  RLH+IY +ND+LH+C+RK    LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y    I+  ++
Sbjct:    7 PDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKLALEQQQ-------------LICKQQTPELEPAA------TMPPLPQPPLAPAAPIPPAQGAPSMDELIQQSQWNLQQQEQHL----LALRQEQVTAAVAHAVEQQMQKLLEETQ---LDMNEFDNLLQPIIDTCTKDAISAGKNWMFSN-AKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHCQRKQARELLAALQKVVVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQLQ 282          

HSP 2 Score: 87.0409 bits (214), Expect = 9.773e-17
Identity = 37/75 (49.33%), Postives = 54/75 (72.00%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFY 1707
            P++PY+ LPA +M   VKL   +Y+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF+
Sbjct:  643 PNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFF 717          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Human
Match: CHERP (calcium homeostasis endoplasmic reticulum protein [Source:HGNC Symbol;Acc:HGNC:16930])

HSP 1 Score: 137.887 bits (346), Expect = 1.967e-32
Identity = 90/314 (28.66%), Postives = 152/314 (48.41%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSK-SSQFNDRLHIIYFLNDLLHY-----------CKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            P+D E RNVID+LA FVA+NG EFE MT +KQ+ N  F FLFGG +  YY+ +L+ E+++             L  K  TP     +               +        +    S+ +L       L + +Q+L    +++ QE++   +      ++ K+ E  +   ++    ++++Q +I +CTKD I  GKN++  N  K     + +  +L   ++   + F  RLH+IY +ND+LH+            +RK    LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y    I+  ++
Sbjct:    7 PDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKLALEQQQ-------------LICKQQTPELEPAA------TMPPLPQPPLAPAAPIPPAQGAPSMDELIQQSQWNLQQQEQHL----LALRQEQVTAAVAHAVEQQMQKLLEETQ---LDMNEFDNLLQPIIDTCTKDAISAGKNWMFSN-AKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHWALTRGKSLPHSQRKQARELLAALQKVVVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQLQ 293          

HSP 2 Score: 87.0409 bits (214), Expect = 9.438e-17
Identity = 37/75 (49.33%), Postives = 54/75 (72.00%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFY 1707
            P++PY+ LPA +M   VKL   +Y+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF+
Sbjct:  654 PNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFF 728          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Celegans
Match: tag-65 (SR-related CTD associated factor 6 [Source:UniProtKB/TrEMBL;Acc:G5ED97])

HSP 1 Score: 63.929 bits (154), Expect = 3.987e-10
Identity = 47/179 (26.26%), Postives = 87/179 (48.60%), Query Frame = 1
Query:  463 KLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALIT-SCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVS-KSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSV-LLADEDGKNKL-NKVLSLWESNSYVKSEILNSMK 987
            K+ +S+QNL +    +++  M    + +  +   KI++     N+N E + S + A+ T  C+KD I   K ++ E  T D +  + I  +LL  V  ++S    RLHI+Y +ND   +C+RK     +  +   +  +Y+  + L +  +  NKL  K+L  WE   Y    +   ++
Sbjct:   60 KIIDSEQNLNAHRNGMDELLMAHLKSAIRTSETMKIEKMLSQNNLNVEDLNSYLDAMATPKCSKDLISQAKKWIFEYCTSD-QLREIILSFLLNKVKDEASGEYLRLHILYLINDWAFHCQRKKEENQMKMLARYVPKMYAYCIELSSSSELSNKLEGKLLGEWEGRQYFADSVFKQLR 237          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Celegans
Match: tag-65 (SR-related CTD associated factor 6 [Source:UniProtKB/TrEMBL;Acc:G5ED97])

HSP 1 Score: 63.929 bits (154), Expect = 3.987e-10
Identity = 47/179 (26.26%), Postives = 87/179 (48.60%), Query Frame = 1
Query:  463 KLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALIT-SCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVS-KSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSV-LLADEDGKNKL-NKVLSLWESNSYVKSEILNSMK 987
            K+ +S+QNL +    +++  M    + +  +   KI++     N+N E + S + A+ T  C+KD I   K ++ E  T D +  + I  +LL  V  ++S    RLHI+Y +ND   +C+RK     +  +   +  +Y+  + L +  +  NKL  K+L  WE   Y    +   ++
Sbjct:   60 KIIDSEQNLNAHRNGMDELLMAHLKSAIRTSETMKIEKMLSQNNLNVEDLNSYLDAMATPKCSKDLISQAKKWIFEYCTSD-QLREIILSFLLNKVKDEASGEYLRLHILYLINDWAFHCQRKKEENQMKMLARYVPKMYAYCIELSSSSELSNKLEGKLLGEWEGRQYFADSVFKQLR 237          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Celegans
Match: tag-65 (SR-related CTD associated factor 6 [Source:UniProtKB/TrEMBL;Acc:G5ED97])

HSP 1 Score: 63.929 bits (154), Expect = 3.987e-10
Identity = 47/179 (26.26%), Postives = 87/179 (48.60%), Query Frame = 1
Query:  463 KLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALIT-SCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVS-KSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSV-LLADEDGKNKL-NKVLSLWESNSYVKSEILNSMK 987
            K+ +S+QNL +    +++  M    + +  +   KI++     N+N E + S + A+ T  C+KD I   K ++ E  T D +  + I  +LL  V  ++S    RLHI+Y +ND   +C+RK     +  +   +  +Y+  + L +  +  NKL  K+L  WE   Y    +   ++
Sbjct:   60 KIIDSEQNLNAHRNGMDELLMAHLKSAIRTSETMKIEKMLSQNNLNVEDLNSYLDAMATPKCSKDLISQAKKWIFEYCTSD-QLREIILSFLLNKVKDEASGEYLRLHILYLINDWAFHCQRKKEENQMKMLARYVPKMYAYCIELSSSSELSNKLEGKLLGEWEGRQYFADSVFKQLR 237          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Fly
Match: scaf6 (gene:FBgn0261872 transcript:FBtr0091474)

HSP 1 Score: 106.301 bits (264), Expect = 5.560e-23
Identity = 53/186 (28.49%), Postives = 110/186 (59.14%), Query Frame = 1
Query:  400 MDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLAN-VSKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNS 954
            +  +L ++KM    L+     ++ +S+ NL+++  ++  +K ++    +   +  + ++   +  I     + ++Q +I SCTKD+I  GKN+++++ T D+     + +YLL   +   S F  +LH+IY +ND+LH+C RK++  L N++E+V++ ++  + L+ + D + KL K+LSLWES +
Sbjct:  150 LTSQLEAIKMQQKSLRE----QIQQSEANLSAQHTALMNQKTKQIEDAIAAAQTAQQEQMAGEQGIVLRDFDGVLQPIIESCTKDSISAGKNWILQHST-DSAKINVVLQYLLKKALVNGSTFQQKLHLIYLVNDILHHCMRKNINDLKNSLENVVIPMFCSADLIGNPDQRQKLAKLLSLWESKA 330          

HSP 2 Score: 92.8189 bits (229), Expect = 7.518e-19
Identity = 40/85 (47.06%), Postives = 57/85 (67.06%), Query Frame = 1
Query: 1474 PERPSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAK 1728
            P+ P+ PY+ LPA +MV  ++L  ++Y+ +D   I+LP   P S+RL +  N FY  PSH+RPRD EGWEK  L+E+YK K  A+
Sbjct:  645 PQIPTAPYYDLPAGLMVPLIRLEDYNYKALDPADIRLPAPAPQSERLTNALNAFYSAPSHDRPRDNEGWEKLGLYEYYKVKNAAR 729          

HSP 3 Score: 81.6481 bits (200), Expect = 2.346e-15
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEER 255
            P D   RN+ID+LA FVA+NG EFE +TKQKQQ N  FEFL+GG +++YYQ+R++ E+
Sbjct:    6 PRDASLRNIIDKLAEFVARNGPEFEAITKQKQQNNPKFEFLYGGEFANYYQFRVAAEQ 63          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Fly
Match: scaf6 (gene:FBgn0261872 transcript:FBtr0345067)

HSP 1 Score: 85.5001 bits (210), Expect = 4.210e-18
Identity = 60/256 (23.44%), Postives = 112/256 (43.75%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKM-------------------------------------------------DNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKD 702
            P D   RN+ID+LA FVA+NG EFE +TKQKQQ N  FEFL+GG +++YYQ+R++ E+  +                                                 DN      +S    + +  P +NQ ++G                 +  +L ++KM    L+     ++ +S+ NL+++  ++  +K ++    +   +  + ++   +  I     + ++Q +I SCTKD+I  G   +++  +K+
Sbjct:    6 PRDASLRNIIDKLAEFVARNGPEFEAITKQKQQNNPKFEFLYGGEFANYYQFRVAAEQALLKQQAINQQLPPGAPSGHYMQHPPPMQQSQPPGLYPPPNQQPPHPPETAQDNMQQQTQHSWPPNSGNGGPPNNQQANGNPMAMN-----------LTSQLEAIKMQQKSLRE----QIQQSEANLSAQHTALMNQKTKQIEDAIAAAQTAQQEQMAGEQGIVLRDFDGVLQPIIESCTKDSISAGLWSMVQRFSKN 246          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Fly
Match: scaf6 (gene:FBgn0261872 transcript:FBtr0301554)

HSP 1 Score: 83.1889 bits (204), Expect = 7.486e-18
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEER 255
            P D   RN+ID+LA FVA+NG EFE +TKQKQQ N  FEFL+GG +++YYQ+R++ E+
Sbjct:    6 PRDASLRNIIDKLAEFVARNGPEFEAITKQKQQNNPKFEFLYGGEFANYYQFRVAAEQ 63          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Fly
Match: Sf3a1 (gene:FBgn0266917 transcript:FBtr0083374)

HSP 1 Score: 56.225 bits (134), Expect = 1.304e-7
Identity = 27/59 (45.76%), Postives = 39/59 (66.10%), Query Frame = 1
Query:   94 EHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGG-AYSDYYQYRLSEERRKMD 267
            E RN++D+ A+FVA+NG EFE   +Q + GN  F FL GG  Y  YY+++++E R   D
Sbjct:   34 EVRNIVDKTASFVARNGPEFEARIRQNELGNPKFNFLNGGDPYHAYYRHKVNEFREGND 92          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Zebrafish
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:ZFIN;Acc:ZDB-GENE-040407-1])

HSP 1 Score: 157.532 bits (397), Expect = 7.159e-39
Identity = 96/307 (31.27%), Postives = 164/307 (53.42%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-----SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            PED E RNVID+LA FVA+NG EFE MT +KQ+ N+ F FLFGG +  YY+Y+L+ E+++    +   +N E + N    P +            D      ++      + +   S+ +L       L + +Q+L    +S+ QE++   ++     ++ K+     +  ++   +++++Q +I +CTKD I  GKN++  N     KT Q  CE + +++     +  + F  RLH+IY  ND+LH+C+RK+   LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y     +  ++
Sbjct:    7 PEDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNAKFSFLFGGEFFGYYKYKLAIEQQQHSGTHDDEYNMEVISN---IPGNE---------AADVSATMAILGP--PAIPAAAPSMEELIQQSQWNLQQQEQHL----LSLRQEQITAAISLAMEQQMQKL---LVETQLDMNELDNLLQPIIDTCTKDAISAGKNWMFGNA----KTPQH-CELMASHLRNRITADEAHFELRLHLIYLTNDVLHHCQRKNQKDLLAALQKVVVPIYCTSFLSVEEDKQQKITRLLQLWEKNGYFDDVTIQQLQ 287          

HSP 2 Score: 94.7449 bits (234), Expect = 2.752e-19
Identity = 41/82 (50.00%), Postives = 58/82 (70.73%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAK 1728
            P++PY+ LPA +M   VKL   DY+P+D   I+LP   PPS RL+     FY PPSH+RPR++EGWE++ L+EF++AK  A+
Sbjct:  626 PNVPYFDLPAGLMAPLVKLEDHDYKPLDPKDIRLPPPMPPSDRLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRAR 707          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Zebrafish
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:ZFIN;Acc:ZDB-GENE-040407-1])

HSP 1 Score: 157.532 bits (397), Expect = 7.589e-39
Identity = 96/307 (31.27%), Postives = 164/307 (53.42%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-----SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            PED E RNVID+LA FVA+NG EFE MT +KQ+ N+ F FLFGG +  YY+Y+L+ E+++    +   +N E + N    P +            D      ++      + +   S+ +L       L + +Q+L    +S+ QE++   ++     ++ K+     +  ++   +++++Q +I +CTKD I  GKN++  N     KT Q  CE + +++     +  + F  RLH+IY  ND+LH+C+RK+   LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y     +  ++
Sbjct:    7 PEDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNAKFSFLFGGEFFGYYKYKLAIEQQQHSGTHDDEYNMEVISN---IPGNE---------AADVSATMAILGP--PAIPAAAPSMEELIQQSQWNLQQQEQHL----LSLRQEQITAAISLAMEQQMQKL---LVETQLDMNELDNLLQPIIDTCTKDAISAGKNWMFGNA----KTPQH-CELMASHLRNRITADEAHFELRLHLIYLTNDVLHHCQRKNQKDLLAALQKVVVPIYCTSFLSVEEDKQQKITRLLQLWEKNGYFDDVTIQQLQ 287          

HSP 2 Score: 94.7449 bits (234), Expect = 2.703e-19
Identity = 41/82 (50.00%), Postives = 58/82 (70.73%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAK 1728
            P++PY+ LPA +M   VKL   DY+P+D   I+LP   PPS RL+     FY PPSH+RPR++EGWE++ L+EF++AK  A+
Sbjct:  625 PNVPYFDLPAGLMAPLVKLEDHDYKPLDPKDIRLPPPMPPSDRLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRAR 706          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Zebrafish
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:ZFIN;Acc:ZDB-GENE-040407-1])

HSP 1 Score: 151.754 bits (382), Expect = 5.208e-37
Identity = 95/307 (30.94%), Postives = 161/307 (52.44%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-----SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            PED E RNVID+LA FVA+NG EFE MT +KQ+ N+ F FLFGG +  YY+Y+L+ E++++         S    N++   S+     G                     + +   S+ +L       L + +Q+L    +S+ QE++   ++     ++ K+     +  ++   +++++Q +I +CTKD I  GKN++  N     KT Q  CE + +++     +  + F  RLH+IY  ND+LH+C+RK+   LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y     +  ++
Sbjct:    7 PEDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNAKFSFLFGGEFFGYYKYKLAIEQQQL--------ISNIPGNEAADVSATMAILG------------------PPAIPAAAPSMEELIQQSQWNLQQQEQHL----LSLRQEQITAAISLAMEQQMQKL---LVETQLDMNELDNLLQPIIDTCTKDAISAGKNWMFGNA----KTPQH-CELMASHLRNRITADEAHFELRLHLIYLTNDVLHHCQRKNQKDLLAALQKVVVPIYCTSFLSVEEDKQQKITRLLQLWEKNGYFDDVTIQQLQ 275          

HSP 2 Score: 94.7449 bits (234), Expect = 3.018e-19
Identity = 41/82 (50.00%), Postives = 58/82 (70.73%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAK 1728
            P++PY+ LPA +M   VKL   DY+P+D   I+LP   PPS RL+     FY PPSH+RPR++EGWE++ L+EF++AK  A+
Sbjct:  614 PNVPYFDLPAGLMAPLVKLEDHDYKPLDPKDIRLPPPMPPSDRLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRAR 695          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Zebrafish
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:ZFIN;Acc:ZDB-GENE-040407-1])

HSP 1 Score: 129.413 bits (324), Expect = 5.819e-33
Identity = 89/287 (31.01%), Postives = 151/287 (52.61%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-----SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNK 927
            PED E RNVID+LA FVA+NG EFE MT +KQ+ N+ F FLFGG +  YY+Y+L+ E++++         S    N++   S+     G                     + +   S+ +L       L + +Q+L    +S+ QE++   ++     ++ K+     +  ++   +++++Q +I +CTKD I  GKN++  N     KT Q  CE + +++     +  + F  RLH+IY  ND+LH+C+RK+   LL A++ V+V IY  S L  +ED + K+ +
Sbjct:    7 PEDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNAKFSFLFGGEFFGYYKYKLAIEQQQLI--------SNIPGNEAADVSATMAILG------------------PPAIPAAAPSMEELIQQSQWNLQQQEQHL----LSLRQEQITAAISLAMEQQMQKL---LVETQLDMNELDNLLQPIIDTCTKDAISAGKNWMFGNA----KTPQH-CELMASHLRNRITADEAHFELRLHLIYLTNDVLHHCQRKNQKDLLAALQKVVVPIYCTSFLSVEEDKQQKITR 255          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Zebrafish
Match: sf3a1 (splicing factor 3a, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030616-156])

HSP 1 Score: 48.1358 bits (113), Expect = 8.578e-6
Identity = 24/58 (41.38%), Postives = 36/58 (62.07%), Query Frame = 1
Query:   79 YPEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFL-FGGAYSDYYQYRLSE 249
            YP   E RN++D+ A+FVA+NG EFE   +Q +  N  F FL     Y  YY+++++E
Sbjct:   35 YPPP-EVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPSDPYHAYYRHKVNE 91          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Xenopus
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:NCBI gene;Acc:496512])

HSP 1 Score: 148.673 bits (374), Expect = 5.169e-36
Identity = 89/293 (30.38%), Postives = 157/293 (53.58%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSY 957
            PED E RNVID+LA FVA+NG EFE MT +KQ+ N  F FLFGG + +YY+ +L+ E++++     +   ++ +E K+  P+    +     T     Q    I+++ ++                            + +S+ QE++   +      ++ K++E  +   ++    ++++Q +I +CTKD I  GKN++  N  K  +  + +  +L   + ++ ++F  RLH+IY +ND+LH+C+RK    LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y
Sbjct:    7 PEDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYNYYKCKLAMEQQQL-----LCKQAQDMEPKAQIPTIPPPALPLPPTLVPPPQGAPPIDDLIQQSQWNFQQ------------------QEQQLLSLRQEQVTAAVAHAVEQQMQKLREETQ---LDMTEFDNLLQPIIDTCTKDAISGGKNWMFSN-AKSPQHCELMAGHLRNRITAEGARFELRLHLIYLINDVLHHCQRKQARDLLAALQKVVVPIYCTSFLAVEEDKQQKIARLLQLWEKNGY 272          

HSP 2 Score: 87.0409 bits (214), Expect = 8.513e-17
Identity = 37/75 (49.33%), Postives = 54/75 (72.00%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFY 1707
            P++PY+ LPA +M   VKL   +Y+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF+
Sbjct:  652 PNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFF 726          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Xenopus
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:NCBI gene;Acc:496512])

HSP 1 Score: 147.517 bits (371), Expect = 1.507e-35
Identity = 92/293 (31.40%), Postives = 161/293 (54.95%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSY 957
            PED E RNVID+LA FVA+NG EFE MT +KQ+ N  F FLFGG + +YY+ +L+ E++++     +   ++ +E K+  P+    +     T     Q    I+++      ++ S  + Q      L+  Q+ +T+      +++M+            K++E  +   ++    ++++Q +I +CTKD I  GKN++  N  K  +  + +  +L   + ++ ++F  RLH+IY +ND+LH+C+RK    LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y
Sbjct:    7 PEDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYNYYKCKLAMEQQQL-----LCKQAQDMEPKAQIPTIPPPALPLPPTLVPPPQGAPPIDDL------IQQSQWNFQQQEQQLLSLRQEQVTAAVAHAVEQQMQ------------KLREETQ---LDMTEFDNLLQPIIDTCTKDAISGGKNWMFSN-AKSPQHCELMAGHLRNRITAEGARFELRLHLIYLINDVLHHCQRKQARDLLAALQKVVVPIYCTSFLAVEEDKQQKIARLLQLWEKNGY 272          

HSP 2 Score: 87.4261 bits (215), Expect = 7.834e-17
Identity = 37/75 (49.33%), Postives = 54/75 (72.00%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFY 1707
            P++PY+ LPA +M   VKL   +Y+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF+
Sbjct:  652 PNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFF 726          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Xenopus
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:NCBI gene;Acc:496512])

HSP 1 Score: 141.354 bits (355), Expect = 1.282e-33
Identity = 89/289 (30.80%), Postives = 158/289 (54.67%), Query Frame = 1
Query:   94 EHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSY 957
            E RNVID+LA FVA+NG EFE MT +KQ+ N  F FLFGG + +YY+ +L+ E++++     +   ++ +E K+  P+    +     T     Q    I+++      ++ S  + Q      L+  Q+ +T+      +++M+            K++E  +   ++    ++++Q +I +CTKD I  GKN++  N  K  +  + +  +L   + ++ ++F  RLH+IY +ND+LH+C+RK    LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y
Sbjct:    8 ELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYNYYKCKLAMEQQQL-----LCKQAQDMEPKAQIPTIPPPALPLPPTLVPPPQGAPPIDDL------IQQSQWNFQQQEQQLLSLRQEQVTAAVAHAVEQQMQ------------KLREETQ---LDMTEFDNLLQPIIDTCTKDAISGGKNWMFSN-AKSPQHCELMAGHLRNRITAEGARFELRLHLIYLINDVLHHCQRKQARDLLAALQKVVVPIYCTSFLAVEEDKQQKIARLLQLWEKNGY 269          

HSP 2 Score: 87.8113 bits (216), Expect = 5.801e-17
Identity = 37/75 (49.33%), Postives = 54/75 (72.00%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFY 1707
            P++PY+ LPA +M   VKL   +Y+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF+
Sbjct:  622 PNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFF 696          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Xenopus
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:NCBI gene;Acc:496512])

HSP 1 Score: 141.354 bits (355), Expect = 1.357e-33
Identity = 89/289 (30.80%), Postives = 158/289 (54.67%), Query Frame = 1
Query:   94 EHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSY 957
            E RNVID+LA FVA+NG EFE MT +KQ+ N  F FLFGG + +YY+ +L+ E++++     +   ++ +E K+  P+    +     T     Q    I+++      ++ S  + Q      L+  Q+ +T+      +++M+            K++E  +   ++    ++++Q +I +CTKD I  GKN++  N  K  +  + +  +L   + ++ ++F  RLH+IY +ND+LH+C+RK    LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y
Sbjct:    8 ELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYNYYKCKLAMEQQQL-----LCKQAQDMEPKAQIPTIPPPALPLPPTLVPPPQGAPPIDDL------IQQSQWNFQQQEQQLLSLRQEQVTAAVAHAVEQQMQ------------KLREETQ---LDMTEFDNLLQPIIDTCTKDAISGGKNWMFSN-AKSPQHCELMAGHLRNRITAEGARFELRLHLIYLINDVLHHCQRKQARDLLAALQKVVVPIYCTSFLAVEEDKQQKIARLLQLWEKNGY 269          

HSP 2 Score: 87.4261 bits (215), Expect = 7.063e-17
Identity = 37/75 (49.33%), Postives = 54/75 (72.00%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFY 1707
            P++PY+ LPA +M   VKL   +Y+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF+
Sbjct:  649 PNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFF 723          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Xenopus
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:NCBI gene;Acc:496512])

HSP 1 Score: 139.813 bits (351), Expect = 3.157e-33
Identity = 90/291 (30.93%), Postives = 159/291 (54.64%), Query Frame = 1
Query:   94 EHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENH--MNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSY 957
            E RNVID+LA FVA+NG EFE MT +KQ+ N  F FLFGG + +YY+ +L+ E+++    +H  +   ++ +E K+  P+    +     T     Q    I+++      ++ S  + Q      L+  Q+ +T+      +++M+            K++E  +   ++    ++++Q +I +CTKD I  GKN++  N  K  +  + +  +L   + ++ ++F  RLH+IY +ND+LH+C+RK    LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y
Sbjct:    8 ELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYNYYKCKLAMEQQQYICFSHTVLCKQAQDMEPKAQIPTIPPPALPLPPTLVPPPQGAPPIDDL------IQQSQWNFQQQEQQLLSLRQEQVTAAVAHAVEQQMQ------------KLREETQ---LDMTEFDNLLQPIIDTCTKDAISGGKNWMFSN-AKSPQHCELMAGHLRNRITAEGARFELRLHLIYLINDVLHHCQRKQARDLLAALQKVVVPIYCTSFLAVEEDKQQKIARLLQLWEKNGY 276          

HSP 2 Score: 87.8113 bits (216), Expect = 5.949e-17
Identity = 37/75 (49.33%), Postives = 54/75 (72.00%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFY 1707
            P++PY+ LPA +M   VKL   +Y+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF+
Sbjct:  625 PNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFF 699          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Mouse
Match: Cherp (calcium homeostasis endoplasmic reticulum protein [Source:MGI Symbol;Acc:MGI:106417])

HSP 1 Score: 147.132 bits (370), Expect = 1.742e-35
Identity = 94/303 (31.02%), Postives = 151/303 (49.83%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSK-SSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            P+D E RNVID+LA FVA+NG EFE MT +KQ+ N  F FLFGG +  YY+ +L+ E++++         +  LE  S  P   Q         T           MD+ L          Q  H   L + Q  +T+      +++M++ L               ++  ++    ++++Q +I +CTKD I  GKN++  N  K     + +  +L   ++   + F  RLH+IY +ND+LH+C+RK    LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y    I+  ++
Sbjct:    7 PDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKLALEQQQLI----CKQQAPELEPTSAMPPLPQPP----LAPTASLTPAQGTPSMDE-LIQQSQWSLQQQEQHLLALRQEQ--VTTAVAHAVEQQMQKLL---------------EETQLDMSEFDNLLQPIIDTCTKDAISAGKNWMFSN-AKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHCQRKQARELLAALQKVVVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQLQ 282          

HSP 2 Score: 87.4261 bits (215), Expect = 5.944e-17
Identity = 37/75 (49.33%), Postives = 54/75 (72.00%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFY 1707
            P++PY+ LPA +M   VKL   +Y+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF+
Sbjct:  652 PNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFF 726          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Mouse
Match: Cherp (calcium homeostasis endoplasmic reticulum protein [Source:MGI Symbol;Acc:MGI:106417])

HSP 1 Score: 134.42 bits (337), Expect = 1.504e-31
Identity = 93/314 (29.62%), Postives = 150/314 (47.77%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSK-SSQFNDRLHIIYFLNDLLH-----------YCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            P+D E RNVID+LA FVA+NG EFE MT +KQ+ N  F FLFGG +  YY+ +L+ E++++         +  LE  S  P   Q         T           MD+ L          Q  H   L + Q  +T+      +++M++ L               ++  ++    ++++Q +I +CTKD I  GKN++  N  K     + +  +L   ++   + F  RLH+IY +ND+LH           + +RK    LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y    I+  ++
Sbjct:    7 PDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKLALEQQQLI----CKQQAPELEPTSAMPPLPQPP----LAPTASLTPAQGTPSMDE-LIQQSQWSLQQQEQHLLALRQEQ--VTTAVAHAVEQQMQKLL---------------EETQLDMSEFDNLLQPIIDTCTKDAISAGKNWMFSN-AKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHWALTRGRSLPHSQRKQARELLAALQKVVVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQLQ 293          

HSP 2 Score: 87.4261 bits (215), Expect = 5.836e-17
Identity = 37/75 (49.33%), Postives = 54/75 (72.00%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFY 1707
            P++PY+ LPA +M   VKL   +Y+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF+
Sbjct:  663 PNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFF 737          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. UniProt/SwissProt
Match: sp|Q8IWX8|CHERP_HUMAN (Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3)

HSP 1 Score: 149.828 bits (377), Expect = 1.373e-35
Identity = 91/303 (30.03%), Postives = 153/303 (50.50%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSK-SSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            P+D E RNVID+LA FVA+NG EFE MT +KQ+ N  F FLFGG +  YY+ +L+ E+++             L  K  TP     +               +        +    S+ +L       L + +Q+L    +++ QE++   +      ++ K+ E  +   ++    ++++Q +I +CTKD I  GKN++  N  K     + +  +L   ++   + F  RLH+IY +ND+LH+C+RK    LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y    I+  ++
Sbjct:    7 PDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKLALEQQQ-------------LICKQQTPELEPAA------TMPPLPQPPLAPAAPIPPAQGAPSMDELIQQSQWNLQQQEQHL----LALRQEQVTAAVAHAVEQQMQKLLEETQ---LDMNEFDNLLQPIIDTCTKDAISAGKNWMFSN-AKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHCQRKQARELLAALQKVVVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQLQ 282          

HSP 2 Score: 87.0409 bits (214), Expect = 4.693e-16
Identity = 37/75 (49.33%), Postives = 54/75 (72.00%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFY 1707
            P++PY+ LPA +M   VKL   +Y+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF+
Sbjct:  643 PNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFF 717          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. UniProt/SwissProt
Match: sp|Q8CGZ0|CHERP_MOUSE (Calcium homeostasis endoplasmic reticulum protein OS=Mus musculus OX=10090 GN=Cherp PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.213e-34
Identity = 94/303 (31.02%), Postives = 151/303 (49.83%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSK-SSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            P+D E RNVID+LA FVA+NG EFE MT +KQ+ N  F FLFGG +  YY+ +L+ E++++         +  LE  S  P   Q         T           MD+ L          Q  H   L + Q  +T+      +++M++ L               ++  ++    ++++Q +I +CTKD I  GKN++  N  K     + +  +L   ++   + F  RLH+IY +ND+LH+C+RK    LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y    I+  ++
Sbjct:    7 PDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKLALEQQQLI----CKQQAPELEPTSAMPPLPQPP----LAPTASLTPAQGTPSMDE-LIQQSQWSLQQQEQHLLALRQEQ--VTTAVAHAVEQQMQKLL---------------EETQLDMSEFDNLLQPIIDTCTKDAISAGKNWMFSN-AKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHCQRKQARELLAALQKVVVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQLQ 282          

HSP 2 Score: 87.4261 bits (215), Expect = 4.152e-16
Identity = 37/75 (49.33%), Postives = 54/75 (72.00%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFY 1707
            P++PY+ LPA +M   VKL   +Y+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF+
Sbjct:  652 PNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFF 726          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. UniProt/SwissProt
Match: sp|Q94C11|SUGP1_ARATH (SURP and G-patch domain-containing protein 1-like protein OS=Arabidopsis thaliana OX=3702 GN=At3g52120 PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 8.350e-7
Identity = 28/61 (45.90%), Postives = 41/61 (67.21%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSD--YYQYRLSEERR 258
            P D   + V D+LA+FVAK+G  FE +T+QK  G++ F+FLF    +D  YY +RL+EE +
Sbjct:  134 PSDPTVKKVADKLASFVAKHGRPFEHITRQKNPGDTPFKFLFDENCADYKYYVFRLAEEEK 194          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. TrEMBL
Match: A0A5E4M4X9 (CID domain,RNA polymerase II-binding domain,G-patch domain,ENTH/VHS,SWAP/Surp OS=Cinara cedri OX=506608 GN=CINCED_3A014895 PE=4 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 8.203e-64
Identity = 175/597 (29.31%), Postives = 298/597 (49.92%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERR--KMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWES-NSYVKSEILNSMKLVNDNPKPHVDEWLDRETTIIKREEDEVTIVNSLIPVEESISRILSDAKMKLSN--LEANHNQLKYELKIEEENLQLEIYQLEREIKMAEVEVRKAPREPI------------QREY-----QDYQETDYSLQLMQNYDM-------------------------SFQMPDITRPPPGFAICEMPGLTPEPQFVPPIIQQLEVEMRPERPSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAK 1728
            PED E R +ID+LA FVA+NG EFE MTK KQ+ N  FEFLFGG + DYY ++++ E+   K ++   M H +      + T S+ Q +      Q   + N N   +    + +L+       +    ++ +++QN  S+ + + Q++       +   +   I        ++   + S+++ +I  CTKD I NGK+++++  T   +  + I +YLL  V   +++F+ +LH+IY +ND +H+C RKS  VL  ++ES+IV ++  +++ A+ED K+KLNK+L+LWE+ N Y    I+  +K    NP   + E+   ++ ++++  + V  +N ++       R    + +   N  +++  NQ +   + ++    L I   + +I        + P  P+            QR Y       YQ+ D   Q MQN                            S ++PD++RPPP F              +PPI  Q +       PS+PY+ LPA +MV  +KL +  Y+P+D + I+LP   PP++RL++    FY PP H  PRD++GWEK  L+E+YKAK  +K
Sbjct:    7 PEDHELRTIIDKLAVFVARNGPEFEQMTKTKQKDNPKFEFLFGGRHFDYYLFKVTTEQAILKQNSVREMAHTAV----ANNTVSTQQLNMAAAAAQ---WLNLNQANDCQSTIVTLESLNNQQSNLQQ-QIAQAEQNFNSQLMILAQQQQVATEDKILSEQREWINSEAAANELSLIELSSVLEPIIKGCTKDAIANGKSWIMKQ-TASQRKVEVISQYLLMEVMDPNAEFSKQLHLIYLVNDTVHHCIRKSEKVLKTSLESIIVPMFCSAMMRANEDQKSKLNKLLTLWETKNHYFPETIMERLK----NPDRSMTEY---KSDLLEKHREAVHQLNMMMNSTLQSYRSQHQSFLAHCNNQIQSIENQKRSLEQQKQRVTPLSIPPAQDDINRQHYNEGRLPSPPLYQNNMSGYMQSDQRNYPHQTENGYQQDDPYGQSMQNCMQQPPIYNRPPPPFNQPPPNIHLQPPPSMELPDLSRPPPNFIQNNF--------SLPPI--QPDTSSDDLLPSLPYYELPAGLMVPLIKLEESSYKPLDPDTIRLPPPAPPTERLLEAVKAFYMPPGHFAPRDSDGWEKLGLYEYYKAKNSSK 577          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. TrEMBL
Match: A0A2S2P2P7 (Calcium homeostasis endoplasmic reticulum protein OS=Schizaphis graminum OX=13262 GN=Cherp PE=4 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 3.040e-62
Identity = 179/595 (30.08%), Postives = 305/595 (51.26%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWES-NSYVKSEILNSMKLVNDNPKPHVDEWLDRETTIIKREEDEVTIVNSLIPVEESISRILSDAKMKLSN----LEANHNQLKYELKIEEENLQLEIYQLEREIKMAEVEVRKAPREP---------IQREYQD--------YQETDYSLQLMQNYDMSFQMPDI----------------TRPPPGFAICEMPGLT-PEPQFV------PPIIQQLEVEMRPERPSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAK 1728
            PED E R +ID+LA FVA+NG +FE MTK KQ+ N  FEFLFGG Y DYY  ++S E+  ++  +        + N S   S+ Q +      Q   + N N   +    + +++ SL   Q+    ++ +++QN  S+ + + Q++       +   +   I       +++   + S+++ +I  CTKD I NGK+++++  T   +    I +YLL  V   +++F+ +LH+IY +ND +H+C RKS  +L  ++ES+IV ++  +++ A+ED K+KL+K+L+LWE+ N Y    I+  +K    NP   + E+   ++ ++++  D V  +N ++    ++    S  +  L++    +++  NQ +   + ++    L I   + +         + P  P         +Q + Q+        YQ+ D+  Q MQN     Q P I                 +PPP     E+P L+ P P F+      PP+  Q ++      PS+PY+ LPA +MV  VKL   +Y+P+D + I+LP   PP+ RL+D    FY PP H  PRD++GWEK  L+E+YKAK  AK
Sbjct:    7 PEDQELRTIIDKLAVFVARNGPDFEQMTKTKQKDNPKFEFLFGGRYFDYYLRKVSTEQSILNQNSVREIAQAAVANNSV--STQQLNMAAAAAQ---WLNLNQTNDCQSSVVTME-SLNAQQANLQQQIAQAEQNFNSQLMILAQQQQVATEDKILSEQREYINSEAAANDLSLVELSSVLEPIIKGCTKDAIANGKSWIMKQ-TASERKVDVITQYLLMEVMDPNAEFSKQLHLIYLVNDTVHHCIRKSEKILKTSLESIIVPMFCSAMMRANEDQKSKLSKLLTLWETKNHYFPETIMERLK----NPDRSMVEY---KSNLLEKYRDAVNQLNMIM--NSTLQNYRSQHQSFLAHCNNQIQSIENQKRSLEQQKQRVTPLSIPPAQDDTNRQHFNEGRLPSPPSYQNNMSGYMQADQQNYPHQTDNGYQQDDHYGQPMQN--CMQQPPSIYNRPPPPFNQPPPNIHLQPPPSM---ELPDLSRPPPNFIQNNFPLPPV--QPDITPDDLLPSLPYYELPAGLMVPLVKLEDSNYKPLDPDTIRLPPPAPPTDRLLDAVKAFYMPPGHFAPRDSDGWEKLGLYEYYKAKHSAK 578          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. TrEMBL
Match: A0A1L8DTZ1 (Putative calcium homeostasis endoplasmic reticulum protein OS=Nyssomyia neivai OX=330878 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 3.636e-62
Identity = 163/554 (29.42%), Postives = 282/554 (50.90%), Query Frame = 1
Query:   94 EHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEE--MDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSKS-SQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNS-YVKSEILNSMKLVNDNPKPHVDEWLDRETTIIKREED----EVTIVNSLIPVEESISRILSDAKMKLSNLEANHNQLKYELKIEEENL-QLEIYQLEREIKMAEVEVRKAPREPIQREYQDYQETDYSLQLMQNYDMSFQMPDITRPPPGFAICEMPGLTPEPQFVPPIIQQLEVEMRPERPSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAK 1728
            E   +I++LA FVA+NG +FE M K KQ  N  F FLFGG Y  YY++R++ E+ +M     M ++ E ++         Q   G D  Q  +  +   + +  +  +L +L M     QS    ++ +S+QNL+++  ++ Q++       V   +   I+       I  +  E I+  ++ SCTKD+I  GKN+++++ T D      I +YLL     S ++F+ +LH+IY +ND+LH+C RK+   L   +E+V++ ++  + LLA+E    KL K+LSLWES + +    +++ +K    +P+  + E+  R    +K         V   N+    ++     ++ A  +++++EA    L+  ++   E       YQ  R      +       E     + D Q   + L        +FQ+PD+++PPP              Q  P +++++E      +PS+PY+ LPA ++V  ++L  + Y+P+D + IQLPQ  PPS+RL+     FY  PSH+RPRD EGWEK  L+E+YK K  ++
Sbjct:   18 EETRLINKLAEFVARNGPDFEAMIKSKQIDNPRFRFLFGGEYFGYYKHRVATEQARM---KLMQNDGELMQPDYRM----QSGPGGDMQQL-WMNDAPPVNQNSIGVQLKTLNMQ----QSTLRNQIRQSEQNLSAQHTALVQQQQTYVDEAVRKAQKEYIETQADVTGIVLKEFEEILMPIVESCTKDSISAGKNWILQH-TGDTAKCNVILQYLLQKALVSDTEFSHKLHLIYLVNDVLHHCIRKNATELKQCLENVVIPMFCSAQLLANESQMAKLTKLLSLWESKANFFDVCVISKLK----SPQSSLQEY--RTNLHVKHASVVSSLNVASKNAFDNYQQQHHAFVAHATQQIASIEAQKQTLEQTMRQHPEPYYDNNDYQNSRVPPPPSLVPPTYHEESTDDAHVD-QGGGFGLP-----PPNFQLPDLSKPPPNLN-----------QPTPKVVEKVE----DLKPSVPYFDLPAGLIVPLIRLEDYSYKPLDPSLIQLPQPAPPSERLLGAVEAFYSLPSHDRPRDGEGWEKLGLYEYYKVKNQSR 531          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. TrEMBL
Match: A0A0L7R008 (Calcium homeostasis endoplasmic reticulum protein (Fragment) OS=Habropoda laboriosa OX=597456 GN=WH47_12492 PE=4 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.771e-62
Identity = 170/579 (29.36%), Postives = 282/579 (48.70%), Query Frame = 1
Query:   88 DIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYG---KLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWES-NSYVKSEILNSMKLVNDNPKPHVDEWLDRETTIIKREEDEVTIVNSLIPVEESISRILSDAKMKLSNLEANHNQLKYELKIEEENLQLEIYQLEREIK-------------MAEVEVRKAPREPIQREYQDYQETDYSLQLMQNYDMSFQMPDITRPPPGFAICEMPGLTPEPQFVPPIIQQLEVEMRPERPSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAKSGEQPNDFISCLHEK 1773
            D E RN+ID+LA FVA+NG EFE MTK KQ+ N  F FLFGG + +YYQY+++ E+                      P +     G +       Q  N+          L+  LA+LQS       ++ +S+QNL ++  ++  ++  R    V   +   ++ S +  N +    ++++Q +I SCTKD+I  GK ++++N     ++ Q + ++LL  V +++ F+ +LHIIY +ND+LH+C RK    L  A+ESV+V ++  + L A E+  NKLNK+LSLWES N+Y    I++ +K      +P    W + +  ++ +                +I+ I +  K    N +A H         + +N++ +   +++++K             M+       P  PI  +    Q          N             PP F+   +P  +  P    P     E  +    PS+PY+ LPA +MV  +KL   +Y+P+D  AI+LP   PPS+RL+     FY PP+H+ PRD++GWEK  L+E+YKAK  A+  ++  D  + + +K
Sbjct:    1 DTELRNIIDKLAQFVARNGPEFEQMTKNKQKDNPKFGFLFGGEHFNYYQYKVTTEQ--------------------AIPGA---MGGVNPPIAGVTQPVNI----GGPPGWLQNELANLQSQQTTLQEQVRQSEQNLAAQHAALMAQQQGRVEDAVRQAQETALQNSAQSTNTDLVAFDAVLQPIIDSCTKDSISAGKAWILQNSVTP-QSNQVVADHLLKKVIQATNFSHKLHIIYLVNDVLHHCARKKSMDLRKAMESVVVPMFCNTSLAASEEQLNKLNKLLSLWESKNNYFDEGIIDKLK------QPSAS-WSEYQANLVAQHAS-------------AITPITTSTKQTFDNYQAQHQAFVTHALRQIQNIEQQKIAIDQQLKAPPPPPPQLNQQNMSLPPSHSGPPTPIGTDVNFSQPPPGWGVPPGNE------------PPPFSNVPLPDFSKPPPGFGPPPVIHEPSVEDLMPSMPYYELPAGLMVPLIKLEDAEYKPLDPEAIRLPPPAPPSERLVAAVEAFYAPPNHDSPRDSDGWEKLGLYEYYKAKNAARKRKE-EDITAGIRQK 518          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. TrEMBL
Match: A0A4C1XH76 (Calcium homeostasis endoplasmic reticulum protein OS=Eumeta variegata OX=151549 GN=Cherp PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.571e-61
Identity = 166/624 (26.60%), Postives = 287/624 (45.99%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQY----SHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYG--------KLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSK-SSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNS-YVKSEILNSMKLVNDNPKPHVDEWLDRETTIIKREEDEVTIVNSLIPVEESISRILSDAKMKLSNLEANHNQLKYELKIEEENLQLEIYQLEREIKMAEVEVRKAPREPIQREYQDYQETDYSL-QLMQNYDMSF------------------------------------------------QMPDI--TRPPPGFAICEMPGLT----------PEPQFVPPIIQQLEVEMRPERPSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAK 1728
            P+D + RN+ID+LA FVA+NG EFE MTK KQ+ N  F FL+GG Y +YYQY+++ E+  +  +      +      +Y   S QY      G   +      +      + + +             H          ++ +S+ NL ++   + Q++  +    V   + + I+    + NI+   +++I+Q +I +CTKD+I  GK +++ + T  +   + I +YLL  V++  + F  +LHIIY +ND+LH+C RK+   L   +E+V+V ++  + +   E+ + KLNK+L LWES S Y  S ++  MK    +P     E+ +              ++N       +IS +    K    N +  H         + + L+++ + LE + +  +V      ++ I   +Q+    D    Q+  N++ +F                                                 +P++  ++PPPGF   E P L           P P F  P   +++ ++    PS+PY+ LPA ++V  + L +  Y P+D   I+LP   PP++RL+   + FY  P+HERPRD EGWEK  L+E+YKAK  A+
Sbjct:    7 PQDQDLRNIIDKLAQFVARNGPEFERMTKNKQKNNPKFSFLYGGEYFNYYQYKVTTEQAIL--KQSAGGQAAPSPTGAYMAQSRQYVMPQQAGATPSPLGLGASLGGAPALQQWVGGPGAPAPSRDPHHINAHLTMLRDQITQSENNLNAQHTVLIQQQQAKINEIVTKAQNDAIQSMADENNISLSELDNILQPIIDTCTKDSISTGKGWILNHATSHD-AGKVIAQYLLRKVTQPGAAFTQKLHIIYLVNDVLHHCARKNAEDLKKNLENVVVPMFCNASIAVTEEQETKLNKLLKLWESKSNYFDSSVIEKMK----SPTSSYQEYQN-------------NLINQ---YSSAISHLTQQTKTTFENYQTQHQTFVAHTMQQIQQLEMQKHALELQQQSQDVSADNMQQQSIVNTFQNNNFGDQGFPQMGGNFEQNFNNQKFGSESGDNFHSNNSLSGNENSYDSQVFEQIMNQKHESMEETDLSNLPNVNFSQPPPGFKAKENPLLAFQNGLPDLSKPPPGF--PSFPEVQEDL---MPSVPYFELPAGLIVPLIMLEEDKYRPLDPQQIRLPPPAPPNERLLAAVDAFYAAPNHERPRDNEGWEKLGLYEYYKAKNAAR 602          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Cavefish
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:ZFIN;Acc:ZDB-GENE-040407-1])

HSP 1 Score: 151.369 bits (381), Expect = 6.532e-37
Identity = 93/305 (30.49%), Postives = 152/305 (49.84%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEF-LENKSYT-PSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            PED E RNVID+LA FVA+NG EFE MT +KQ+ N  F FLFGG Y  YY+Y+L+ E++    ++   H+ E+ +E   +  P   +     D            I      +  L              LN  +Q   + +I +  E+  + L                +  ++    + ++Q +I +CTKD I  GKN++  N  K  +  + +  +L   + ++++ F  RLH+IY +ND+LH+C+RK+   LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y     +  ++
Sbjct:   62 PEDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGDYFGYYKYKLAIEQQ----QHPTTHDDEYKMEVAVHCKPPGKEVP---DVPPPMSLLPPPPIPPSTPSVEELIQQSQWNLQQQEQHLNSLRQEQVTAAIGLAMEQQTQKLLV--------------ETQLDMTEFDGLLQPIIDTCTKDAISAGKNWMFNN-AKSPQHCELMTSHLRNRITAETAHFELRLHLIYLMNDVLHHCQRKNQRDLLAALQKVVVPIYCTSFLAVEEDKQQKITRLLQLWEKNGYFDDVTIQQLQ 344          

HSP 2 Score: 89.3521 bits (220), Expect = 1.062e-17
Identity = 38/75 (50.67%), Postives = 54/75 (72.00%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFY 1707
            P++PY+ LPA +M   VKL   DY+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF+
Sbjct:  704 PNVPYFDLPAGLMAPLVKLEDHDYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFF 778          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Cavefish
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:ZFIN;Acc:ZDB-GENE-040407-1])

HSP 1 Score: 100.523 bits (249), Expect = 4.182e-21
Identity = 45/161 (27.95%), Postives = 89/161 (55.28%), Query Frame = 1
Query:  508 INQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            +N  +  +    + +    + ++   +  ++    + ++Q +I +CTKD I  GKN++  N  K  +  + +  +L   + ++++ F  RLH+IY +ND+LH+C+RK+   LL A++ V+V IY  S L  +ED + K+ ++L LWE N Y     +  ++
Sbjct:  173 LNSLRQEQVTAAIGLAMEQQTQKLLVETQLDMTEFDGLLQPIIDTCTKDAISAGKNWMFNN-AKSPQHCELMTSHLRNRITAETAHFELRLHLIYLMNDVLHHCQRKNQRDLLAALQKVVVPIYCTSFLAVEEDKQQKITRLLQLWEKNGYFDDVTIQQLQ 332          

HSP 2 Score: 89.3521 bits (220), Expect = 1.110e-17
Identity = 38/75 (50.67%), Postives = 54/75 (72.00%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFY 1707
            P++PY+ LPA +M   VKL   DY+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF+
Sbjct:  692 PNVPYFDLPAGLMAPLVKLEDHDYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFF 766          

HSP 3 Score: 79.337 bits (194), Expect = 1.369e-14
Identity = 36/61 (59.02%), Postives = 47/61 (77.05%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKM 264
            PED E RNVID+LA FVA+NG EFE MT +KQ+ N  F FLFGG Y  YY+Y+L+ E++++
Sbjct:   62 PEDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGDYFGYYKYKLAIEQQQL 122          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Cavefish
Match: sfswap (splicing factor SWAP [Source:NCBI gene;Acc:103041651])

HSP 1 Score: 50.447 bits (119), Expect = 9.425e-6
Identity = 25/55 (45.45%), Postives = 35/55 (63.64%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFL-FGGAYSDYYQYRL 243
            P  I+   +I+R ANFV K G +FE++ K KQ GNS F+FL F    + YY++ L
Sbjct:  186 PATIKTHAIIERTANFVCKQGAQFEIVLKAKQAGNSQFDFLRFDHYLNPYYKHIL 240          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001822.1 (pep scaffold:Pmarinus_7.0:GL491554:236:5412:-1 gene:ENSPMAG00000001655.1 transcript:ENSPMAT00000001822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 3.100e-22
Identity = 50/135 (37.04%), Postives = 77/135 (57.04%), Query Frame = 1
Query:  625 QALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSK-SSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMKLVNDNPKPHVDEW 1026
            Q +I +CTKD I  GK ++  N  K     + + EYL   + +  S F  RLH+IY +ND+LH+C+RK    L  A++ V+V I+ M    A+E+ + KL K+L LWE N Y +  I+  +K    NP P + ++
Sbjct:  172 QPIIDTCTKDAISTGKTWIFSN-AKSTGVCEALAEYLRWRIVRPGSSFELRLHLIYLINDVLHHCQRKQAQELQVALQQVVVPIFCM----AEEEKQQKLTKLLQLWEKNRYFEDSIIGQLK----NPAPSLAQY 297          

HSP 2 Score: 76.6406 bits (187), Expect = 3.616e-15
Identity = 34/57 (59.65%), Postives = 44/57 (77.19%), Query Frame = 1
Query:   88 DIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERR 258
            D E RN+ID+LA FVA+NG EFE MTKQKQ+ N  F FLF G Y +YYQY+++ E++
Sbjct:    9 DQEQRNIIDKLAQFVARNGPEFEKMTKQKQRDNPKFAFLFRGEYFNYYQYKVTTEQQ 65          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Nematostella
Match: EDO48222 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKB9])

HSP 1 Score: 91.6633 bits (226), Expect = 7.864e-19
Identity = 41/133 (30.83%), Postives = 78/133 (58.65%), Query Frame = 1
Query:  592 NINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            +++F+  + ++Q L+ SCTKD I  G+ +V+ N  K  +    I EY+L    +    F ++LH++Y +ND++H+  RK++  L +A++ V+V ++  +      +G  KL KVL +WE+N +  +  L  +K
Sbjct:  154 DLDFQEFDGMLQKLMDSCTKDAISTGRGWVLNN-AKSPQHCHHIMEYILKKCFAPGLTFPNKLHLVYIINDIVHHAARKNLTDLNSAVKEVVVPVFCYARQGDIGEGMQKLTKVLGIWETNDFFDAATLQKLK 285          

HSP 2 Score: 88.9669 bits (219), Expect = 4.434e-18
Identity = 39/74 (52.70%), Postives = 51/74 (68.92%), Query Frame = 1
Query: 1495 YWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAK 1716
            Y+ LPA +M   VKL+  DY P++   I+LP  +PPS+RL+     FY PPSHE PR+ +GWE+S L EFYKAK
Sbjct:  596 YYELPAGLMAPMVKLSDVDYVPLNPADIRLPAPQPPSERLLAAVEAFYSPPSHESPRNADGWEQSGLFEFYKAK 669          

HSP 3 Score: 68.5514 bits (166), Expect = 9.713e-12
Identity = 32/58 (55.17%), Postives = 45/58 (77.59%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGA-YSDYYQYRLSEE 252
            P+D E +N+ID+LANFVA+NG +FE MTK+KQ+ N  F FL+ G  Y +YY++R+S E
Sbjct:   14 PDDQELKNIIDKLANFVARNGSKFEDMTKEKQKNNPKFSFLYSGQNYHNYYRWRVSVE 71          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Nematostella
Match: EDO28608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T602])

HSP 1 Score: 64.6994 bits (156), Expect = 1.358e-10
Identity = 35/120 (29.17%), Postives = 65/120 (54.17%), Query Frame = 1
Query:  631 LITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            L T  T  +   G+ +V+ N  K  +    I EY+L    +    F ++LH++Y +ND++H+  RK++  L +A++ V+V ++  +      +G  KL KVL +WE+N +  +  L  +K
Sbjct:   12 LHTHLTMISSSTGRGWVLNN-AKSPQHCHHIMEYILKKCFAPGLTFPNKLHLVYIINDIVHHAARKNLTDLNSAVKEVVVPVFCYARQGDIGEGMQKLTKVLGIWETNDFFDAATLQKLK 130          

HSP 2 Score: 55.4546 bits (132), Expect = 9.525e-8
Identity = 23/37 (62.16%), Postives = 26/37 (70.27%), Query Frame = 1
Query: 1606 KRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAK 1716
            KRL      FY PPSHE PR+ +GWE+S L EFYKAK
Sbjct:  144 KRLSQAVEAFYSPPSHESPRNADGWEQSGLFEFYKAK 180          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Medaka
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:NCBI gene;Acc:101159495])

HSP 1 Score: 148.673 bits (374), Expect = 3.822e-36
Identity = 99/319 (31.03%), Postives = 157/319 (49.22%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNE------------SQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-----SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            PED E RNVID+LA FVA+NG EFE MT  KQ+ N  F FLFGG +  YY+ +L+ E+++        H S                 G D    D F N    + +D    +L+M +         +  E             +Q+L +    + QE+M   +      +  K+     +  ++   +++++Q +I +CTKD I  GKN++  N     KT Q  CE + +++     + S+ F  RLH+IY  ND+LH+C+RK    LL A++ V+V IY  S L  +E+ + K+ ++L LWE N Y   E +  ++
Sbjct:    7 PEDQELRNVIDKLAQFVARNGPEFEKMTMDKQKDNPKFSFLFGGEFFSYYKCKLALEQQQ--------HPS--------------IQEGEDCKSKDAF-NPGAKDVVDLPPPALQMVVPPQIPPPAAQPIEELIQQSQWNLQQQEQHLHT----LRQEQMSAAIALAMEQQNQKL---LVETQLDITELDNLLQPIIDTCTKDAISAGKNWMFNNA----KTPQH-CELMASHLCNRITADSAHFELRLHLIYLTNDVLHHCQRKQQKDLLAALQKVVVPIYCTSFLAVEEEKQQKITRLLQLWEKNGYFDEETIQQLQ 290          

HSP 2 Score: 94.3597 bits (233), Expect = 2.876e-19
Identity = 41/82 (50.00%), Postives = 59/82 (71.95%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAK 1728
            P++PY+ LPA +M   VKL   DY+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF++AK  A+
Sbjct:  631 PNVPYFDLPAGLMAPLVKLEDSDYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRAR 712          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Medaka
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:NCBI gene;Acc:101159495])

HSP 1 Score: 144.821 bits (364), Expect = 6.175e-35
Identity = 94/307 (30.62%), Postives = 150/307 (48.86%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-----SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMK 987
            PED E RNVID+LA FVA+NG EFE MT  KQ+ N  F FLFGG +  YY+ +L+     ++ + H   N    +     P + Q                 +I++    L   +  L  L+           Q   S +I++  E+  + L                +  ++   +++++Q +I +CTKD I  GKN++  N     KT Q  CE + +++     + S+ F  RLH+IY  ND+LH+C+RK    LL A++ V+V IY  S L  +E+ + K+ ++L LWE N Y   E +  ++
Sbjct:    7 PEDQELRNVIDKLAQFVARNGPEFEKMTMDKQKDNPKFSFLFGGEFFSYYKCKLA-----LEQQQHA-FNPGAKDVVDLPPPALQMVVPPQIPPPAAQPIEELIQQSQWNLQQQEQHLHTLR-----------QEQMSAAIALAMEQQNQKLLV--------------ETQLDITELDNLLQPIIDTCTKDAISAGKNWMFNNA----KTPQH-CELMASHLCNRITADSAHFELRLHLIYLTNDVLHHCQRKQQKDLLAALQKVVVPIYCTSFLAVEEEKQQKITRLLQLWEKNGYFDEETIQQLQ 277          

HSP 2 Score: 94.3597 bits (233), Expect = 2.892e-19
Identity = 41/82 (50.00%), Postives = 59/82 (71.95%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAK 1728
            P++PY+ LPA +M   VKL   DY+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF++AK  A+
Sbjct:  618 PNVPYFDLPAGLMAPLVKLEDSDYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRAR 699          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Medaka
Match: cherp (calcium homeostasis endoplasmic reticulum protein [Source:NCBI gene;Acc:101159495])

HSP 1 Score: 131.724 bits (330), Expect = 6.695e-31
Identity = 94/311 (30.23%), Postives = 151/311 (48.55%), Query Frame = 1
Query:   82 PEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNE------------SQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANV-----SKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVK 963
            PED E RNVID+LA FVA+NG EFE MT  KQ+ N  F FLFGG +  YY+ +L+ E+++        H S                 G D    D F N    + +D    +L+M +         +  E             +Q+L +    + QE+M   +      +  K+     +  ++   +++++Q +I +CTKD I  GKN++  N     KT Q  CE + +++     + S+ F  RLH+IY  ND+LH+C+RK    LL A++ V+V IY  S L  +E+ + K+ +   + E  + V+
Sbjct:    7 PEDQELRNVIDKLAQFVARNGPEFEKMTMDKQKDNPKFSFLFGGEFFSYYKCKLALEQQQ--------HPS--------------IQEGEDCKSKDAF-NPGAKDVVDLPPPALQMVVPPQIPPPAAQPIEELIQQSQWNLQQQEQHLHT----LRQEQMSAAIALAMEQQNQKL---LVETQLDITELDNLLQPIIDTCTKDAISAGKNWMFNNA----KTPQH-CELMASHLCNRITADSAHFELRLHLIYLTNDVLHHCQRKQQKDLLAALQKVVVPIYCTSFLAVEEEKQQKITRASLITEYAAVVQ 282          

HSP 2 Score: 94.3597 bits (233), Expect = 2.998e-19
Identity = 41/82 (50.00%), Postives = 59/82 (71.95%), Query Frame = 1
Query: 1483 PSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAK 1728
            P++PY+ LPA +M   VKL   DY+P+D   I+LP   PPS+RL+     FY PPSH+RPR++EGWE++ L+EF++AK  A+
Sbjct:  601 PNVPYFDLPAGLMAPLVKLEDSDYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRAR 682          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Planmine SMEST
Match: SMESG000008465.1 (SMESG000008465.1)

HSP 1 Score: 1385.16 bits (3584), Expect = 0.000e+0
Identity = 689/717 (96.09%), Postives = 695/717 (96.93%), Query Frame = 1
Query:   79 YPEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMKLVNDNPKPHVDEWLDRETTIIKREEDEVTIVNSLIPVEESISRILSDAKMKLSNLEANHNQLKYELKIEEENLQLEIYQLEREIKMAEVEVRKAPREPIQREYQDYQETDYSLQLMQNYDMSFQMPDITRPPPGFAICEMPGLTPEPQFVPPIIQQLEVEMRPERPSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAKSGEQPNDFISCLHEKHNEDDYHESIQGNERLMDTDYRHMDISDLNDFRSVPDLNCSNPDYSFHHHAPQFGMSPNCSPRVSSQRSLLGSPWEEYRHHPFNNPDMPLXXXXXXXXXXXXVAPSLLGTPSRHMQPKVTPLMSLDVSNSFKRQSNPRNKRDSYSRNVDNMP 2229
            YPEDIEHRN IDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSKSSQFNDRLHIIYFLNDLLHYCKRKSVP+LLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMKLVNDNPKPHVDEWLDRETTIIKREEDEVT+VNSLIPVEESISRILSDAKMKLSNLEANHNQLKYELKIEEENLQLEIYQLEREIKMAEVEVRKAPREPIQREYQDYQETDY LQLMQNYDMSFQMPDITRPPPGFAICEMPGLTPEPQFVPPI QQLEVEMRPERPSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPP + + D+          E  +D    EKSALHEFYKAKEMAKSGEQPNDFISCLHEKHNEDDYHESIQGNERLMDTDYRHMDISDLNDFRSVPDLNCSNPDYSFHHHAPQFGMSPNCSPRVSSQRSLLGSPWEEYRHHPFNNPDMPLMRNMNYNNSSNRVAPSLLGTPSRHMQPKVTPLMSLDVSNSFKRQSNPRNKRDSYSRNVDNMP
Sbjct:    7 YPEDIEHRNAIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSKSSQFNDRLHIIYFLNDLLHYCKRKSVPILLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMKLVNDNPKPHVDEWLDRETTIIKREEDEVTVVNSLIPVEESISRILSDAKMKLSNLEANHNQLKYELKIEEENLQLEIYQLEREIKMAEVEVRKAPREPIQREYQDYQETDYPLQLMQNYDMSFQMPDITRPPPGFAICEMPGLTPEPQFVPPITQQLEVEMRPERPSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPLRVMRDL----------EILKDG---EKSALHEFYKAKEMAKSGEQPNDFISCLHEKHNEDDYHESIQGNERLMDTDYRHMDISDLNDFRSVPDLNCSNPDYSFHHHAPQFGMSPNCSPRVSSQRSLLGSPWEEYRHHPFNNPDMPLMRNMNYNNSSNRVAPSLLGTPSRHMQPKVTPLMSLDVSNSFKRQSNPRNKRDSYSRNVDNMP 710          

HSP 2 Score: 161.384 bits (407), Expect = 2.562e-40
Identity = 98/98 (100.00%), Postives = 98/98 (100.00%), Query Frame = 1
Query: 2413 DKLPYKGGFIAXXXXXXXXXXXXXXXXXXXXEYETPHNQYNKVRNEDFEEVTEPVLRNEHYPEVDRYTNEDVFSRFRLRKSVGYSEWMKERTERRIGV 2706
            DKLPYKGGFIARKSRSRSYSRSRSLSRSPRSEYETPHNQYNKVRNEDFEEVTEPVLRNEHYPEVDRYTNEDVFSRFRLRKSVGYSEWMKERTERRIGV
Sbjct:  772 DKLPYKGGFIARKSRSRSYSRSRSLSRSPRSEYETPHNQYNKVRNEDFEEVTEPVLRNEHYPEVDRYTNEDVFSRFRLRKSVGYSEWMKERTERRIGV 869          
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Planmine SMEST
Match: SMESG000008465.1 (SMESG000008465.1)

HSP 1 Score: 1336.63 bits (3458), Expect = 0.000e+0
Identity = 672/717 (93.72%), Postives = 679/717 (94.70%), Query Frame = 1
Query:   79 YPEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFGGAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSKSSQFNDRLHIIYFLNDLLHYCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMKLVNDNPKPHVDEWLDRETTIIKREEDEVTIVNSLIPVEESISRILSDAKMKLSNLEANHNQLKYELKIEEENLQLEIYQLEREIKMAEVEVRKAPREPIQREYQDYQETDYSLQLMQNYDMSFQMPDITRPPPGFAICEMPGLTPEPQFVPPIIQQLEVEMRPERPSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYKAKEMAKSGEQPNDFISCLHEKHNEDDYHESIQGNERLMDTDYRHMDISDLNDFRSVPDLNCSNPDYSFHHHAPQFGMSPNCSPRVSSQRSLLGSPWEEYRHHPFNNPDMPLXXXXXXXXXXXXVAPSLLGTPSRHMQPKVTPLMSLDVSNSFKRQSNPRNKRDSYSRNVDNMP 2229
            YPEDIEHRN IDRLANFVAKNGDEFELMTKQKQQGNS+                LSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSKSSQFNDRLHIIYFLNDLLHYCKRKSVP+LLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMKLVNDNPKPHVDEWLDRETTIIKREEDEVT+VNSLIPVEESISRILSDAKMKLSNLEANHNQLKYELKIEEENLQLEIYQLEREIKMAEVEVRKAPREPIQREYQDYQETDY LQLMQNYDMSFQMPDITRPPPGFAICEMPGLTPEPQFVPPI QQLEVEMRPERPSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPP + + D+          E  +D    EKSALHEFYKAKEMAKSGEQPNDFISCLHEKHNEDDYHESIQGNERLMDTDYRHMDISDLNDFRSVPDLNCSNPDYSFHHHAPQFGMSPNCSPRVSSQRSLLGSPWEEYRHHPFNNPDMPLMRNMNYNNSSNRVAPSLLGTPSRHMQPKVTPLMSLDVSNSFKRQSNPRNKRDSYSRNVDNMP
Sbjct:    7 YPEDIEHRNAIDRLANFVAKNGDEFELMTKQKQQGNSI----------------LSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFTQTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISINQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNICNGKNFVIENMTKDNKTTQFICEYLLANVSKSSQFNDRLHIIYFLNDLLHYCKRKSVPILLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYVKSEILNSMKLVNDNPKPHVDEWLDRETTIIKREEDEVTVVNSLIPVEESISRILSDAKMKLSNLEANHNQLKYELKIEEENLQLEIYQLEREIKMAEVEVRKAPREPIQREYQDYQETDYPLQLMQNYDMSFQMPDITRPPPGFAICEMPGLTPEPQFVPPITQQLEVEMRPERPSIPYWRLPAAVMVAHVKLAQFDYEPIDANAIQLPQLKPPLRVMRDL----------EILKDG---EKSALHEFYKAKEMAKSGEQPNDFISCLHEKHNEDDYHESIQGNERLMDTDYRHMDISDLNDFRSVPDLNCSNPDYSFHHHAPQFGMSPNCSPRVSSQRSLLGSPWEEYRHHPFNNPDMPLMRNMNYNNSSNRVAPSLLGTPSRHMQPKVTPLMSLDVSNSFKRQSNPRNKRDSYSRNVDNMP 694          

HSP 2 Score: 161.77 bits (408), Expect = 1.650e-40
Identity = 98/98 (100.00%), Postives = 98/98 (100.00%), Query Frame = 1
Query: 2413 DKLPYKGGFIAXXXXXXXXXXXXXXXXXXXXEYETPHNQYNKVRNEDFEEVTEPVLRNEHYPEVDRYTNEDVFSRFRLRKSVGYSEWMKERTERRIGV 2706
            DKLPYKGGFIARKSRSRSYSRSRSLSRSPRSEYETPHNQYNKVRNEDFEEVTEPVLRNEHYPEVDRYTNEDVFSRFRLRKSVGYSEWMKERTERRIGV
Sbjct:  756 DKLPYKGGFIARKSRSRSYSRSRSLSRSPRSEYETPHNQYNKVRNEDFEEVTEPVLRNEHYPEVDRYTNEDVFSRFRLRKSVGYSEWMKERTERRIGV 853          
The following BLAST results are available for this feature:
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CHERP2.859e-3630.03calcium homeostasis endoplasmic reticulum protein ... [more]
CHERP1.967e-3228.66calcium homeostasis endoplasmic reticulum protein ... [more]
back to top
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tag-653.987e-1026.26SR-related CTD associated factor 6 [Source:UniPro... [more]
tag-653.987e-1026.26SR-related CTD associated factor 6 [Source:UniPro... [more]
tag-653.987e-1026.26SR-related CTD associated factor 6 [Source:UniPro... [more]
back to top
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
scaf65.560e-2328.49gene:FBgn0261872 transcript:FBtr0091474[more]
scaf64.210e-1823.44gene:FBgn0261872 transcript:FBtr0345067[more]
scaf67.486e-1858.62gene:FBgn0261872 transcript:FBtr0301554[more]
Sf3a11.304e-745.76gene:FBgn0266917 transcript:FBtr0083374[more]
back to top
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cherp7.159e-3931.27calcium homeostasis endoplasmic reticulum protein ... [more]
cherp7.589e-3931.27calcium homeostasis endoplasmic reticulum protein ... [more]
cherp5.208e-3730.94calcium homeostasis endoplasmic reticulum protein ... [more]
cherp5.819e-3331.01calcium homeostasis endoplasmic reticulum protein ... [more]
sf3a18.578e-641.38splicing factor 3a, subunit 1 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cherp5.169e-3630.38calcium homeostasis endoplasmic reticulum protein ... [more]
cherp1.507e-3531.40calcium homeostasis endoplasmic reticulum protein ... [more]
cherp1.282e-3330.80calcium homeostasis endoplasmic reticulum protein ... [more]
cherp1.357e-3330.80calcium homeostasis endoplasmic reticulum protein ... [more]
cherp3.157e-3330.93calcium homeostasis endoplasmic reticulum protein ... [more]
back to top
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cherp1.742e-3531.02calcium homeostasis endoplasmic reticulum protein ... [more]
Cherp1.504e-3129.62calcium homeostasis endoplasmic reticulum protein ... [more]
back to top
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q8IWX8|CHERP_HUMAN1.373e-3530.03Calcium homeostasis endoplasmic reticulum protein ... [more]
sp|Q8CGZ0|CHERP_MOUSE1.213e-3431.02Calcium homeostasis endoplasmic reticulum protein ... [more]
sp|Q94C11|SUGP1_ARATH8.350e-745.90SURP and G-patch domain-containing protein 1-like ... [more]
back to top
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5E4M4X98.203e-6429.31CID domain,RNA polymerase II-binding domain,G-patc... [more]
A0A2S2P2P73.040e-6230.08Calcium homeostasis endoplasmic reticulum protein ... [more]
A0A1L8DTZ13.636e-6229.42Putative calcium homeostasis endoplasmic reticulum... [more]
A0A0L7R0084.771e-6229.36Calcium homeostasis endoplasmic reticulum protein ... [more]
A0A4C1XH761.571e-6126.60Calcium homeostasis endoplasmic reticulum protein ... [more]
back to top
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cherp6.532e-3730.49calcium homeostasis endoplasmic reticulum protein ... [more]
cherp4.182e-2127.95calcium homeostasis endoplasmic reticulum protein ... [more]
sfswap9.425e-645.45splicing factor SWAP [Source:NCBI gene;Acc:1030416... [more]
back to top
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001822.13.100e-2237.04pep scaffold:Pmarinus_7.0:GL491554:236:5412:-1 gen... [more]
back to top
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO482227.864e-1930.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286081.358e-1029.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cherp3.822e-3631.03calcium homeostasis endoplasmic reticulum protein ... [more]
cherp6.175e-3530.62calcium homeostasis endoplasmic reticulum protein ... [more]
cherp6.695e-3130.23calcium homeostasis endoplasmic reticulum protein ... [more]
back to top
BLAST of Calcium homeostasis endoplasmic reticulum protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000008465.12.562e-4096.09SMESG000008465.1[more]
SMESG000008465.11.650e-4093.72SMESG000008465.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031338 ID=SMED30031338|Name=Calcium homeostasis endoplasmic reticulum protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2857bp
GTAATTGGCCATATTCTCTATAAAATAATTATTTATTATCTTATGTTATT
TTAGCTTTTCATGAATAATAATTATTTTTATCCTGAAGATATCGAACATA
GAAATGTAATTGATAGACTTGCAAATTTCGTTGCCAAAAATGGCGATGAA
TTTGAATTAATGACTAAGCAAAAGCAGCAAGGAAATTCAATGTTTGAGTT
TTTGTTTGGTGGTGCATATAGTGATTACTATCAATACAGATTATCGGAAG
AAAGAAGAAAAATGGACAATGAAAATCATATGAATCATAATTCAGAATTT
TTAGAAAATAAATCTTACACCCCGTCTTCTAATCAATATTCACATGGCTT
TGATTTCACACAGACTGACTATTTTCAAAATTACAACGTCATTGAAGAAA
TGGATAAACGGCTTTCCAGTTTGAAAATGTCTTTAGCAGATTTACAGAGT
GCTCATTATGGAAAGCTAAATGAAAGTCAGCAAAATTTAACTTCGGAATC
TATTAGTATTAATCAGGAGAAAATGAGAAGATGTTTGACTACTGTAAATA
TTAATCGTTTAAATAAAATAAAAGAAAGTTGTAAAGATTATAACATCAAT
TTTGAAACTATGGAAAGCATAATCCAAGCATTGATTACAAGCTGTACCAA
AGATAATATATGCAATGGCAAAAACTTTGTTATTGAAAATATGACTAAAG
ATAACAAAACAACTCAATTTATTTGTGAATATCTTCTGGCAAATGTTTCT
AAGTCTAGTCAATTTAATGATAGACTGCACATAATTTATTTTTTAAATGA
TTTGCTTCATTACTGTAAAAGAAAAAGCGTTCCTGTTCTTTTAAACGCCA
TAGAATCAGTTATTGTTTTGATATATTCAATGTCTGTTCTGTTAGCCGAT
GAAGATGGTAAAAATAAATTGAACAAAGTTCTATCTTTGTGGGAATCAAA
TTCATATGTTAAGTCGGAAATATTGAATTCAATGAAATTAGTCAACGATA
ATCCTAAACCACACGTAGATGAATGGTTAGATAGAGAAACAACAATAATA
AAACGCGAAGAAGATGAGGTGACTATTGTCAATAGTTTAATACCAGTCGA
GGAAAGTATTTCTCGAATTCTATCTGATGCGAAAATGAAATTAAGTAATT
TGGAAGCAAATCATAATCAGTTAAAGTACGAGTTAAAAATCGAAGAGGAA
AATCTCCAATTGGAAATTTATCAGCTGGAACGGGAAATAAAAATGGCTGA
AGTAGAAGTCCGCAAAGCGCCTAGAGAACCGATCCAAAGAGAGTATCAAG
ACTACCAAGAAACTGATTATTCTCTCCAATTGATGCAAAATTATGACATG
TCGTTTCAAATGCCCGATATTACCAGGCCTCCGCCCGGGTTTGCAATTTG
TGAGATGCCTGGCCTGACTCCAGAACCGCAGTTTGTGCCACCAATTATCC
AGCAACTAGAAGTTGAAATGCGCCCCGAGCGACCTTCTATTCCTTATTGG
CGTTTGCCAGCTGCTGTAATGGTGGCACATGTAAAATTGGCCCAGTTTGA
TTATGAACCGATCGATGCCAATGCGATTCAACTGCCGCAGCTGAAACCGC
CGTCAAAACGATTGATTGATATTACAAACACATTTTACCAGCCTCCGAGT
CATGAGAGACCTAGAGATACTGAAGGATGGGAGAAATCGGCGTTGCATGA
GTTTTACAAAGCCAAGGAAATGGCAAAATCCGGAGAGCAACCGAATGATT
TCATTAGCTGTCTCCATGAGAAACATAACGAGGATGATTACCATGAATCG
ATTCAAGGGAATGAAAGATTGATGGATACAGATTATCGCCACATGGACAT
TTCAGATTTGAATGATTTCAGATCGGTTCCAGATCTCAATTGTTCCAATC
CCGATTATAGTTTCCATCACCACGCGCCTCAATTTGGGATGTCTCCCAAT
TGCAGCCCACGGGTCAGCAGTCAAAGATCATTATTGGGATCCCCGTGGGA
GGAATATCGACACCATCCATTCAATAATCCAGACATGCCATTGATGAGAA
ACATGAACTATAATAATTCTAGCAATAGAGTTGCGCCCAGCCTCCTGGGG
ACTCCCTCTCGTCATATGCAACCTAAAGTCACTCCACTGATGAGTCTTGA
TGTTTCAAACAGTTTCAAACGACAGTCGAATCCCAGAAACAAACGAGATA
GTTATTCTCGGAATGTAGACAACATGCCATACAATAATCGAAACAAAAAC
CGACGACGATACCTCTCCAGATCAAGGTCTCCCTACAATCGATCAGTATC
GCGGTCTAGGTCAAGATCTTCAAGGTATTCGCGTAGTAGGTCTAGAACCT
ACTCAAGGTCACGATCCTTTTCAAGGTCAAGATCGCAATCCTCTCGCTCA
TCTCGAAGTAGCGATAAACTTCCATATAAAGGTGGATTTATAGCTCGTAA
AAGTCGTTCTAGGTCTTACAGCAGGTCTCGCAGTTTATCTAGGTCGCCAA
GATCTGAATATGAAACGCCTCACAACCAGTATAATAAAGTTAGAAATGAA
GATTTTGAGGAAGTTACTGAACCAGTGTTAAGAAATGAGCATTATCCAGA
AGTTGACCGCTACACAAACGAGGATGTATTTTCTCGTTTCAGGTTACGAA
AATCAGTTGGTTATTCAGAGTGGATGAAAGAGCGGACGGAAAGAAGAATT
GGTGTTCCCGAAGAGCTTCCAGAAAGTTACTGAAGCTAGGAATCGAAAAA
TTGTGACTAATAAAAAACAATTTCATCAAACGCGTGTTTTGACTCAAGAA
ATTAAATTTTATCGCTGTCGTTGTAAATTAATAAAATTTTATTTTATTCA
AAAAAAA
back to top

protein sequence of SMED30031338-orf-1

>SMED30031338-orf-1 ID=SMED30031338-orf-1|Name=SMED30031338-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=891bp
MNNNYFYPEDIEHRNVIDRLANFVAKNGDEFELMTKQKQQGNSMFEFLFG
GAYSDYYQYRLSEERRKMDNENHMNHNSEFLENKSYTPSSNQYSHGFDFT
QTDYFQNYNVIEEMDKRLSSLKMSLADLQSAHYGKLNESQQNLTSESISI
NQEKMRRCLTTVNINRLNKIKESCKDYNINFETMESIIQALITSCTKDNI
CNGKNFVIENMTKDNKTTQFICEYLLANVSKSSQFNDRLHIIYFLNDLLH
YCKRKSVPVLLNAIESVIVLIYSMSVLLADEDGKNKLNKVLSLWESNSYV
KSEILNSMKLVNDNPKPHVDEWLDRETTIIKREEDEVTIVNSLIPVEESI
SRILSDAKMKLSNLEANHNQLKYELKIEEENLQLEIYQLEREIKMAEVEV
RKAPREPIQREYQDYQETDYSLQLMQNYDMSFQMPDITRPPPGFAICEMP
GLTPEPQFVPPIIQQLEVEMRPERPSIPYWRLPAAVMVAHVKLAQFDYEP
IDANAIQLPQLKPPSKRLIDITNTFYQPPSHERPRDTEGWEKSALHEFYK
AKEMAKSGEQPNDFISCLHEKHNEDDYHESIQGNERLMDTDYRHMDISDL
NDFRSVPDLNCSNPDYSFHHHAPQFGMSPNCSPRVSSQRSLLGSPWEEYR
HHPFNNPDMPLMRNMNYNNSSNRVAPSLLGTPSRHMQPKVTPLMSLDVSN
SFKRQSNPRNKRDSYSRNVDNMPYNNRNKNRRRYLSRSRSPYNRSVSRSR
SRSSRYSRSRSRTYSRSRSFSRSRSQSSRSSRSSDKLPYKGGFIARKSRS
RSYSRSRSLSRSPRSEYETPHNQYNKVRNEDFEEVTEPVLRNEHYPEVDR
YTNEDVFSRFRLRKSVGYSEWMKERTERRIGVPEELPESY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: biological process
TermDefinition
GO:0006874cellular calcium ion homeostasis
GO:0006396RNA processing
Vocabulary: INTERPRO
TermDefinition
IPR000061Surp
IPR008942ENTH_VHS
IPR006903RNA_pol_II-bd
IPR006569CID_dom
IPR011528NERD
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding