Musashi

Overview
NameMusashi
Smed IDSMED30031336
Length (bp)1786
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Musashi (SMED30031336) t-SNE clustered cells

Violin plots show distribution of expression levels for Musashi (SMED30031336) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Musashi (SMED30031336) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Musashi (SMED30031336) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031336

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior region of the whole animalSMED30031336SMESG000071202.1 dd_Smed_v4_7323_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30031336SMESG000071202.1 dd_Smed_v4_7323_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30031336SMESG000071202.1 SmedASXL_008525SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031336SMESG000071202.1 dd_Smed_v4_7323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031336SMESG000071202.1 dd_Smed_v4_7323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031336SMESG000071202.1 dd_Smed_v4_7323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30031336SMESG000071202.1 dd_Smed_v4_7323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031336SMESG000071202.1 dd_Smed_v6_7323_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30031336SMESG000071202.1 OX_Smed_1.0.04792ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Musashi vs. Ensembl Human
Match: MSI1 (musashi RNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:7330])

HSP 1 Score: 239.58 bits (610), Expect = 5.347e-73
Identity = 110/194 (56.70%), Postives = 147/194 (75.77%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAI 882
            PCK+F+GGL+  TT E L+ YF QFGE+KE +VMRD + KRSRGFGFVTF D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++TVE+++QYF ++G+V++  LM DK TNRHRGFGFVTF  ED+ E++C+IH+H INNKMVE KKA PKE++S + +   +  +S  +P  +
Sbjct:   19 PCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGS---ARGRSRVMPYGM 207          
BLAST of Musashi vs. Ensembl Human
Match: MSI2 (musashi RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:18585])

HSP 1 Score: 226.483 bits (576), Expect = 1.816e-68
Identity = 105/174 (60.34%), Postives = 138/174 (79.31%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 70.8626 bits (172), Expect = 1.306e-12
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Musashi vs. Ensembl Human
Match: MSI2 (musashi RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:18585])

HSP 1 Score: 222.631 bits (566), Expect = 5.331e-68
Identity = 104/172 (60.47%), Postives = 137/172 (79.65%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:   18 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 187          

HSP 2 Score: 76.6406 bits (187), Expect = 5.644e-15
Identity = 34/107 (31.78%), Postives = 62/107 (57.94%), Query Frame = 1
Query:  574 TKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAILQNN 894
            + K+FIGG++  ++ + +R YF+++GE+  C +M D  T R RGFGFVTF D    +++    +H +++K ++ K A P+       A PK   ++ ++ +  L  N
Sbjct:   16 SSKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPR------RAQPKMVTRTKKIFVGGLSAN 116          

HSP 3 Score: 70.0922 bits (170), Expect = 8.805e-13
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  107 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 199          
BLAST of Musashi vs. Ensembl Human
Match: MSI2 (musashi RNA binding protein 2 [Source:HGNC Symbol;Acc:HGNC:18585])

HSP 1 Score: 222.631 bits (566), Expect = 4.816e-67
Identity = 103/171 (60.23%), Postives = 136/171 (79.53%), Query Frame = 1
Query:  310 LFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            +F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:    1 MFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 169          

HSP 2 Score: 70.8626 bits (172), Expect = 1.331e-12
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:   89 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 181          
BLAST of Musashi vs. Ensembl Human
Match: MSI1 (musashi RNA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:7330])

HSP 1 Score: 164.081 bits (414), Expect = 3.936e-46
Identity = 76/143 (53.15%), Postives = 106/143 (74.13%), Query Frame = 1
Query:  454 DYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAI 882
            D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++TVE+++QYF ++G+V++  LM DK TNRHRGFGFVTF  ED+ E++C+IH+H INNKMVE KKA PKE++S + +   +  +S  +P  +
Sbjct:    2 DQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGS---ARGRSRVMPYGM 139          

HSP 2 Score: 68.9366 bits (167), Expect = 1.743e-12
Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTK 579
            K+FVGGL+  TT E ++ YF QFG++ + M+M D    R RGFGFVTF     V KV +   H +++K ++ K A PK +  P   SAR +
Sbjct:   42 KIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTG-SARGR 131          
BLAST of Musashi vs. Ensembl Celegans
Match: msi-1 (MuSashI (Fly neural) family; Neural RNA-binding protein MSI-1 [Source:UniProtKB/TrEMBL;Acc:G5EFS2])

HSP 1 Score: 219.935 bits (559), Expect = 1.641e-66
Identity = 100/174 (57.47%), Postives = 131/174 (75.29%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  TT+E L+ YF +FGE+ E MVMRD   KR+RGFGF+TF D S V KVL    H LD KKIDPK+A PK      K+  +TKK+FIGG++ +ST+E+++QYF  YG+VE+  LM DKAT RHRGFGFVTF  ++VA+++C+IH+H IN KMVE KKA PKE++
Sbjct:   44 PGKMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKRT--QAKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEVM 215          

HSP 2 Score: 67.781 bits (164), Expect = 4.652e-12
Identity = 39/119 (32.77%), Postives = 67/119 (56.30%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKI----SARTKKIFIGGIATSSTVEEIRQYFNRYG 651
            K+F+GGL+ T+T E ++ YF  +G++++ M+M D   +R RGFGFVTF       KV +   H ++ K ++ K A PK +  P ++    +A  + ++  G+    T+    QY  R+G
Sbjct:  135 KVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEVMLPVQLNKSRAAAARNLY--GMP-PETLLAYAQYLPRFG 250          
BLAST of Musashi vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 157.147 bits (396), Expect = 1.009e-42
Identity = 74/185 (40.00%), Postives = 111/185 (60.00%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKS 861
            K+FVGGL   TT + ++ ++SQFGEI + +VMRD   KRSRGFGFVTF+  + V   +KQ  HI+D K +DPK AVP+      + +  TK++++ G+    T + + +YF +YG V   E+++DKAT + RGFGFVTF D D  +Q      H +N    + +K L K+ +S +      E + 
Sbjct:   24 KIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRDRETRG 208          

HSP 2 Score: 66.6254 bits (161), Expect = 1.379e-11
Identity = 28/80 (35.00%), Postives = 54/80 (67.50%), Query Frame = 1
Query:  577 KKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKE 816
            +KIF+GG+ +++T + +R++++++GE+ +  +M D  T R RGFGFVTF  +   +   +   H I+ K V+ K+A+P++
Sbjct:   23 RKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRD 102          
BLAST of Musashi vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 157.147 bits (396), Expect = 1.009e-42
Identity = 74/185 (40.00%), Postives = 111/185 (60.00%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKS 861
            K+FVGGL   TT + ++ ++SQFGEI + +VMRD   KRSRGFGFVTF+  + V   +KQ  HI+D K +DPK AVP+      + +  TK++++ G+    T + + +YF +YG V   E+++DKAT + RGFGFVTF D D  +Q      H +N    + +K L K+ +S +      E + 
Sbjct:   24 KIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRDRETRG 208          

HSP 2 Score: 66.6254 bits (161), Expect = 1.379e-11
Identity = 28/80 (35.00%), Postives = 54/80 (67.50%), Query Frame = 1
Query:  577 KKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKE 816
            +KIF+GG+ +++T + +R++++++GE+ +  +M D  T R RGFGFVTF  +   +   +   H I+ K V+ K+A+P++
Sbjct:   23 RKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRD 102          
BLAST of Musashi vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 157.147 bits (396), Expect = 1.033e-42
Identity = 74/185 (40.00%), Postives = 111/185 (60.00%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKS 861
            K+FVGGL   TT + ++ ++SQFGEI + +VMRD   KRSRGFGFVTF+  + V   +KQ  HI+D K +DPK AVP+      + +  TK++++ G+    T + + +YF +YG V   E+++DKAT + RGFGFVTF D D  +Q      H +N    + +K L K+ +S +      E + 
Sbjct:   24 KIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRDRETRG 208          

HSP 2 Score: 66.6254 bits (161), Expect = 1.388e-11
Identity = 28/80 (35.00%), Postives = 54/80 (67.50%), Query Frame = 1
Query:  577 KKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKE 816
            +KIF+GG+ +++T + +R++++++GE+ +  +M D  T R RGFGFVTF  +   +   +   H I+ K V+ K+A+P++
Sbjct:   23 RKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRD 102          
BLAST of Musashi vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 157.147 bits (396), Expect = 1.033e-42
Identity = 74/185 (40.00%), Postives = 111/185 (60.00%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKS 861
            K+FVGGL   TT + ++ ++SQFGEI + +VMRD   KRSRGFGFVTF+  + V   +KQ  HI+D K +DPK AVP+      + +  TK++++ G+    T + + +YF +YG V   E+++DKAT + RGFGFVTF D D  +Q      H +N    + +K L K+ +S +      E + 
Sbjct:   24 KIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRDRETRG 208          

HSP 2 Score: 66.6254 bits (161), Expect = 1.388e-11
Identity = 28/80 (35.00%), Postives = 54/80 (67.50%), Query Frame = 1
Query:  577 KKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKE 816
            +KIF+GG+ +++T + +R++++++GE+ +  +M D  T R RGFGFVTF  +   +   +   H I+ K V+ K+A+P++
Sbjct:   23 RKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRD 102          
BLAST of Musashi vs. Ensembl Fly
Match: Rbp6 (gene:FBgn0260943 transcript:FBtr0075285)

HSP 1 Score: 215.698 bits (548), Expect = 3.698e-64
Identity = 97/178 (54.49%), Postives = 134/178 (75.28%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSN 834
            P K+F+GGL+  T+ E+L+ YF ++G+I E MVM+D   +RSRGFGFVTF+D + V KVL Q  H LD KK+DPK+A P+    P K+  RTKKIF+GG++  +T+E+++ YF ++G +E+  LM DK TNRHRGFGFVTF  EDV +++C+IH+H INNKMVE KKA PKE++  +N
Sbjct:   28 PGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRR-AHP-KMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPAN 203          

HSP 2 Score: 80.8777 bits (198), Expect = 4.392e-16
Identity = 33/90 (36.67%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  547 CQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKE 816
            C P ++     K+FIGG++  ++ E +R YF RYG++    +M D  T R RGFGFVTF D +  +++     H ++ K V+ K A P+ 
Sbjct:   19 CSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRR 108          

HSP 3 Score: 71.633 bits (174), Expect = 4.092e-13
Identity = 40/91 (43.96%), Postives = 57/91 (62.64%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTK 579
            K+FVGGL+  TT E ++SYF QFG I++ M+M D    R RGFGFVTF     V KV +   H +++K ++ K A PK +  P  + A+T+
Sbjct:  119 KIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPANL-AKTR 208          
BLAST of Musashi vs. Ensembl Fly
Match: Rbp6 (gene:FBgn0260943 transcript:FBtr0333861)

HSP 1 Score: 215.698 bits (548), Expect = 3.949e-64
Identity = 97/178 (54.49%), Postives = 134/178 (75.28%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSN 834
            P K+F+GGL+  T+ E+L+ YF ++G+I E MVM+D   +RSRGFGFVTF+D + V KVL Q  H LD KK+DPK+A P+    P K+  RTKKIF+GG++  +T+E+++ YF ++G +E+  LM DK TNRHRGFGFVTF  EDV +++C+IH+H INNKMVE KKA PKE++  +N
Sbjct:   28 PGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRR-AHP-KMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPAN 203          

HSP 2 Score: 80.8777 bits (198), Expect = 3.899e-16
Identity = 33/90 (36.67%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  547 CQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKE 816
            C P ++     K+FIGG++  ++ E +R YF RYG++    +M D  T R RGFGFVTF D +  +++     H ++ K V+ K A P+ 
Sbjct:   19 CSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRR 108          

HSP 3 Score: 71.633 bits (174), Expect = 4.833e-13
Identity = 40/91 (43.96%), Postives = 57/91 (62.64%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTK 579
            K+FVGGL+  TT E ++SYF QFG I++ M+M D    R RGFGFVTF     V KV +   H +++K ++ K A PK +  P  + A+T+
Sbjct:  119 KIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPANL-AKTR 208          
BLAST of Musashi vs. Ensembl Fly
Match: Rbp6 (gene:FBgn0260943 transcript:FBtr0113427)

HSP 1 Score: 216.083 bits (549), Expect = 7.862e-63
Identity = 97/178 (54.49%), Postives = 134/178 (75.28%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSN 834
            P K+F+GGL+  T+ E+L+ YF ++G+I E MVM+D   +RSRGFGFVTF+D + V KVL Q  H LD KK+DPK+A P+    P K+  RTKKIF+GG++  +T+E+++ YF ++G +E+  LM DK TNRHRGFGFVTF  EDV +++C+IH+H INNKMVE KKA PKE++  +N
Sbjct:   28 PGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRR-AHP-KMVTRTKKIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPAN 203          

HSP 2 Score: 79.7221 bits (195), Expect = 2.155e-15
Identity = 33/90 (36.67%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  547 CQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKE 816
            C P ++     K+FIGG++  ++ E +R YF RYG++    +M D  T R RGFGFVTF D +  +++     H ++ K V+ K A P+ 
Sbjct:   19 CSPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNSVDKVLTQGTHELDGKKVDPKVAFPRR 108          

HSP 3 Score: 71.2478 bits (173), Expect = 1.013e-12
Identity = 40/91 (43.96%), Postives = 57/91 (62.64%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTK 579
            K+FVGGL+  TT E ++SYF QFG I++ M+M D    R RGFGFVTF     V KV +   H +++K ++ K A PK +  P  + A+T+
Sbjct:  119 KIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLPANL-AKTR 208          
BLAST of Musashi vs. Ensembl Fly
Match: msi (gene:FBgn0011666 transcript:FBtr0333665)

HSP 1 Score: 196.438 bits (498), Expect = 5.818e-55
Identity = 90/175 (51.43%), Postives = 129/175 (73.71%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLS 825
            P KLFVGGL+  T+S+ L+ YF+ FG + + ++M+D V +RSRGFGF+TF +   V KVLK   H LD KKIDPK A PK+  +P + + +TKKIF+GG++  ++ EE++ YF+++G VE   ++MD+ T RHRGFGFVTF +EDV +++C+IH+H I NK VE KKA PKE ++
Sbjct:  135 PGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKN--RPRQAN-KTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAVT 306          

HSP 2 Score: 73.559 bits (179), Expect = 2.021e-13
Identity = 38/96 (39.58%), Postives = 60/96 (62.50%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIG 594
            K+FVGG++  T++E +++YFSQFG ++E +++ D   KR RGFGFVTF +   V +V +   H + +KK++ K A PK    P       K+I +G
Sbjct:  225 KIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAVTPAA-QLLQKRIMLG 319          

HSP 3 Score: 73.559 bits (179), Expect = 2.111e-13
Identity = 30/89 (33.71%), Postives = 55/89 (61.80%), Query Frame = 1
Query:  580 KIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPK 846
            K+F+GG++  ++ +++++YFN +G V +  +M D  T R RGFGF+TF +    E++ ++  H ++ K ++ K A PK     +N T K
Sbjct:  137 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQANKTKK 225          
BLAST of Musashi vs. Ensembl Fly
Match: msi (gene:FBgn0011666 transcript:FBtr0305219)

HSP 1 Score: 196.438 bits (498), Expect = 8.458e-55
Identity = 90/177 (50.85%), Postives = 130/177 (73.45%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTS 831
            P KLFVGGL+  T+S+ L+ YF+ FG + + ++M+D V +RSRGFGF+TF +   V KVLK   H LD KKIDPK A PK+  +P + + +TKKIF+GG++  ++ EE++ YF+++G VE   ++MD+ T RHRGFGFVTF +EDV +++C+IH+H I NK VE KKA PKE ++ +
Sbjct:  173 PGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKN--RPRQAN-KTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAVTPA 346          

HSP 2 Score: 74.3294 bits (181), Expect = 1.468e-13
Identity = 30/89 (33.71%), Postives = 55/89 (61.80%), Query Frame = 1
Query:  580 KIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPK 846
            K+F+GG++  ++ +++++YFN +G V +  +M D  T R RGFGF+TF +    E++ ++  H ++ K ++ K A PK     +N T K
Sbjct:  175 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQANKTKK 263          

HSP 3 Score: 73.9442 bits (180), Expect = 1.889e-13
Identity = 38/100 (38.00%), Postives = 61/100 (61.00%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIAT 606
            K+FVGG++  T++E +++YFSQFG ++E +++ D   KR RGFGFVTF +   V +V +   H + +KK++ K A PK    P       K+I +G +  
Sbjct:  263 KIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAVTPAA-QLLQKRIMLGTLGV 361          
BLAST of Musashi vs. Ensembl Zebrafish
Match: msi2b (musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1268])

HSP 1 Score: 228.024 bits (580), Expect = 1.410e-69
Identity = 105/174 (60.34%), Postives = 138/174 (79.31%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 70.4774 bits (171), Expect = 7.221e-13
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Musashi vs. Ensembl Zebrafish
Match: msi2b (musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1268])

HSP 1 Score: 223.787 bits (569), Expect = 2.271e-69
Identity = 104/172 (60.47%), Postives = 137/172 (79.65%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:    4 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 173          

HSP 2 Score: 70.0922 bits (170), Expect = 2.235e-13
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:   93 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 185          
BLAST of Musashi vs. Ensembl Zebrafish
Match: msi2b (musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1268])

HSP 1 Score: 229.565 bits (584), Expect = 8.028e-69
Identity = 105/174 (60.34%), Postives = 138/174 (79.31%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 71.2478 bits (173), Expect = 1.132e-12
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Musashi vs. Ensembl Zebrafish
Match: msi2a (musashi RNA-binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-030826-25])

HSP 1 Score: 228.024 bits (580), Expect = 1.763e-68
Identity = 104/174 (59.77%), Postives = 137/174 (78.74%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YF +FGEI+E MVMRD   KRSRGFGF+TF D S V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ S+ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +ED+ E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFCKFGEIRECMVMRDPTTKRSRGFGFITFADVSSVDKVLAQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSASTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDIVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 72.0182 bits (175), Expect = 4.891e-13
Identity = 36/93 (38.71%), Postives = 56/93 (60.22%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+ +T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSASTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDIVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARSL 203          
BLAST of Musashi vs. Ensembl Zebrafish
Match: msi2a (musashi RNA-binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-030826-25])

HSP 1 Score: 228.024 bits (580), Expect = 1.763e-68
Identity = 104/174 (59.77%), Postives = 137/174 (78.74%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YF +FGEI+E MVMRD   KRSRGFGF+TF D S V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ S+ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +ED+ E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFCKFGEIRECMVMRDPTTKRSRGFGFITFADVSSVDKVLAQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSASTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDIVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 72.0182 bits (175), Expect = 4.891e-13
Identity = 36/93 (38.71%), Postives = 56/93 (60.22%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+ +T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSASTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDIVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARSL 203          
BLAST of Musashi vs. Ensembl Xenopus
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:496961])

HSP 1 Score: 235.728 bits (600), Expect = 5.968e-72
Identity = 107/179 (59.78%), Postives = 140/179 (78.21%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNA 837
            PCK+F+GGL+  TT E L+ YFS FG++KE +VMRD + KRSRGFGFVTF D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++TVE+++QYF ++G+V++  LM DK TNRHRGFGFVTF  ED+ E++C IH+H INNKMVE KKA PKE++S + +
Sbjct:   19 PCKMFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSPTGS 195          
BLAST of Musashi vs. Ensembl Xenopus
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:496961])

HSP 1 Score: 235.343 bits (599), Expect = 1.114e-71
Identity = 107/179 (59.78%), Postives = 140/179 (78.21%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNA 837
            PCK+F+GGL+  TT E L+ YFS FG++KE +VMRD + KRSRGFGFVTF D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++TVE+++QYF ++G+V++  LM DK TNRHRGFGFVTF  ED+ E++C IH+H INNKMVE KKA PKE++S + +
Sbjct:   19 PCKMFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSPTGS 195          
BLAST of Musashi vs. Ensembl Xenopus
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:496961])

HSP 1 Score: 226.483 bits (576), Expect = 5.312e-69
Identity = 104/176 (59.09%), Postives = 137/176 (77.84%), Query Frame = 1
Query:  310 LFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNA 837
            +F+GGL+  TT E L+ YFS FG++KE +VMRD + KRSRGFGFVTF D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++TVE+++QYF ++G+V++  LM DK TNRHRGFGFVTF  ED+ E++C IH+H INNKMVE KKA PKE++S + +
Sbjct:    1 MFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSPTGS 174          

HSP 2 Score: 68.1662 bits (165), Expect = 5.962e-12
Identity = 36/83 (43.37%), Postives = 50/83 (60.24%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQP 555
            K+FVGGL+  TT E ++ YF QFG++ + M+M D    R RGFGFVTF     V KV     H +++K ++ K A PK +  P
Sbjct:   89 KIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSP 171          
BLAST of Musashi vs. Ensembl Xenopus
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:496961])

HSP 1 Score: 227.254 bits (578), Expect = 6.817e-69
Identity = 104/176 (59.09%), Postives = 137/176 (77.84%), Query Frame = 1
Query:  310 LFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNA 837
            +F+GGL+  TT E L+ YFS FG++KE +VMRD + KRSRGFGFVTF D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++TVE+++QYF ++G+V++  LM DK TNRHRGFGFVTF  ED+ E++C IH+H INNKMVE KKA PKE++S + +
Sbjct:    1 MFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSPTGS 174          

HSP 2 Score: 67.781 bits (164), Expect = 9.583e-12
Identity = 36/83 (43.37%), Postives = 50/83 (60.24%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQP 555
            K+FVGGL+  TT E ++ YF QFG++ + M+M D    R RGFGFVTF     V KV     H +++K ++ K A PK +  P
Sbjct:   89 KIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSP 171          
BLAST of Musashi vs. Ensembl Xenopus
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:496961])

HSP 1 Score: 226.483 bits (576), Expect = 1.033e-68
Identity = 104/176 (59.09%), Postives = 137/176 (77.84%), Query Frame = 1
Query:  310 LFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNA 837
            +F+GGL+  TT E L+ YFS FG++KE +VMRD + KRSRGFGFVTF D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++TVE+++QYF ++G+V++  LM DK TNRHRGFGFVTF  ED+ E++C IH+H INNKMVE KKA PKE++S + +
Sbjct:    1 MFIGGLSWQTTQEGLREYFSHFGDVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSPTGS 174          

HSP 2 Score: 68.1662 bits (165), Expect = 7.154e-12
Identity = 36/83 (43.37%), Postives = 50/83 (60.24%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQP 555
            K+FVGGL+  TT E ++ YF QFG++ + M+M D    R RGFGFVTF     V KV     H +++K ++ K A PK +  P
Sbjct:   89 KIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFEGEDIVEKVCDIHFHEINNKMVECKKAQPKEVMSP 171          
BLAST of Musashi vs. Ensembl Mouse
Match: Msi1 (musashi RNA-binding protein 1 [Source:MGI Symbol;Acc:MGI:107376])

HSP 1 Score: 237.269 bits (604), Expect = 2.463e-72
Identity = 109/194 (56.19%), Postives = 146/194 (75.26%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAI 882
            PCK+F+GGL+  TT E L+ YF QFGE+KE +VMRD + KRSRGFGFVTF D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++TVE+++ YF ++G+V++  LM DK TNRHRGFGFVTF  ED+ E++C+IH+H INNKMVE KKA PKE++S + +   +  +S  +P  +
Sbjct:   19 PCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGS---ARGRSRVMPYGM 207          
BLAST of Musashi vs. Ensembl Mouse
Match: Msi2 (musashi RNA-binding protein 2 [Source:MGI Symbol;Acc:MGI:1923876])

HSP 1 Score: 227.254 bits (578), Expect = 9.579e-69
Identity = 105/174 (60.34%), Postives = 138/174 (79.31%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 70.8626 bits (172), Expect = 8.848e-13
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Musashi vs. Ensembl Mouse
Match: Msi2 (musashi RNA-binding protein 2 [Source:MGI Symbol;Acc:MGI:1923876])

HSP 1 Score: 226.483 bits (576), Expect = 1.195e-68
Identity = 105/174 (60.34%), Postives = 138/174 (79.31%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 70.8626 bits (172), Expect = 9.388e-13
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Musashi vs. Ensembl Mouse
Match: Msi1 (musashi RNA-binding protein 1 [Source:MGI Symbol;Acc:MGI:107376])

HSP 1 Score: 219.164 bits (557), Expect = 6.299e-66
Identity = 102/182 (56.04%), Postives = 136/182 (74.73%), Query Frame = 1
Query:  337 TTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAI 882
            TT E L+ YF QFGE+KE +VMRD + KRSRGFGFVTF D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++TVE+++ YF ++G+V++  LM DK TNRHRGFGFVTF  ED+ E++C+IH+H INNKMVE KKA PKE++S + +   +  +S  +P  +
Sbjct:    5 TTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGS---ARGRSRVMPYGM 181          

HSP 2 Score: 68.9366 bits (167), Expect = 3.821e-12
Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTK 579
            K+FVGGL+  TT E ++ YF QFG++ + M+M D    R RGFGFVTF     V KV +   H +++K ++ K A PK +  P   SAR +
Sbjct:   84 KIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTG-SARGR 173          
BLAST of Musashi vs. Ensembl Mouse
Match: Msi1 (musashi RNA-binding protein 1 [Source:MGI Symbol;Acc:MGI:107376])

HSP 1 Score: 214.927 bits (546), Expect = 5.597e-65
Identity = 101/171 (59.06%), Postives = 132/171 (77.19%), Query Frame = 1
Query:  343 SEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLS-TSNATPKSE 852
            +E L+ YF QFGE+KE +VMRD + KRSRGFGFVTF D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++TVE+++ YF ++G+V++  LM DK TNRHRGFGFVTF  ED+ E++C+IH+H INNKMVE KKA PKE++S T +A  +S 
Sbjct:    6 TEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSR 174          

HSP 2 Score: 68.5514 bits (166), Expect = 2.719e-12
Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTK 579
            K+FVGGL+  TT E ++ YF QFG++ + M+M D    R RGFGFVTF     V KV +   H +++K ++ K A PK +  P   SAR +
Sbjct:   83 KIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTG-SARGR 172          
BLAST of Musashi vs. UniProt/SwissProt
Match: sp|O43347|MSI1H_HUMAN (RNA-binding protein Musashi homolog 1 OS=Homo sapiens OX=9606 GN=MSI1 PE=1 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 2.568e-72
Identity = 110/194 (56.70%), Postives = 147/194 (75.77%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAI 882
            PCK+F+GGL+  TT E L+ YF QFGE+KE +VMRD + KRSRGFGFVTF D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++TVE+++QYF ++G+V++  LM DK TNRHRGFGFVTF  ED+ E++C+IH+H INNKMVE KKA PKE++S + +   +  +S  +P  +
Sbjct:   19 PCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGS---ARGRSRVMPYGM 207          
BLAST of Musashi vs. UniProt/SwissProt
Match: sp|Q61474|MSI1H_MOUSE (RNA-binding protein Musashi homolog 1 OS=Mus musculus OX=10090 GN=Msi1 PE=1 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 1.723e-71
Identity = 109/194 (56.19%), Postives = 146/194 (75.26%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAI 882
            PCK+F+GGL+  TT E L+ YF QFGE+KE +VMRD + KRSRGFGFVTF D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++TVE+++ YF ++G+V++  LM DK TNRHRGFGFVTF  ED+ E++C+IH+H INNKMVE KKA PKE++S + +   +  +S  +P  +
Sbjct:   19 PCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGS---ARGRSRVMPYGM 207          
BLAST of Musashi vs. UniProt/SwissProt
Match: sp|Q8K3P4|MSI1H_RAT (RNA-binding protein Musashi homolog 1 OS=Rattus norvegicus OX=10116 GN=Msi1 PE=1 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 1.741e-71
Identity = 109/194 (56.19%), Postives = 146/194 (75.26%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAI 882
            PCK+F+GGL+  TT E L+ YF QFGE+KE +VMRD + KRSRGFGFVTF D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++TVE+++ YF ++G+V++  LM DK TNRHRGFGFVTF  ED+ E++C+IH+H INNKMVE KKA PKE++S + +   +  +S  +P  +
Sbjct:   19 PCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSVNTTVEDVKHYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGS---ARGRSRVMPYGM 207          
BLAST of Musashi vs. UniProt/SwissProt
Match: sp|Q920Q6|MSI2H_MOUSE (RNA-binding protein Musashi homolog 2 OS=Mus musculus OX=10090 GN=Msi2 PE=1 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 6.701e-68
Identity = 105/174 (60.34%), Postives = 138/174 (79.31%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 70.8626 bits (172), Expect = 6.189e-12
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Musashi vs. UniProt/SwissProt
Match: sp|Q96DH6|MSI2H_HUMAN (RNA-binding protein Musashi homolog 2 OS=Homo sapiens OX=9606 GN=MSI2 PE=1 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 8.722e-68
Identity = 105/174 (60.34%), Postives = 138/174 (79.31%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 70.8626 bits (172), Expect = 6.274e-12
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Musashi vs. TrEMBL
Match: B1Q3I8 (Musashi OS=Dugesia japonica OX=6161 GN=DjmlgB PE=2 SV=1)

HSP 1 Score: 846.655 bits (2186), Expect = 0.000e+0
Identity = 438/475 (92.21%), Postives = 458/475 (96.42%), Query Frame = 1
Query:  172 MLLQEKDNMNGKNLSNHSFTESTDEDIKNXXXXXXXXXXXXXXPCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAILQNNISPTFSMNNLLQQNNGSFSPFVTMPYLQTNSGHFLLNPNLIQITNTNGISPIQSIDPLFSNDIVPYLNHLNNFSASYIPPLTSSINNSYIGQALPTLHNGTLPMQNFLIDISHQAIADPKYFPQPFSDNVKSVLYSNMNNISKRQLNSNPQQKTEPMCTPQHELKDKDSIPCQSMNHFVGRYNXXXXXXXXXXXXXXDGNSTAMGAALPDCSNSLDAPTGDSIWLIPAKIPRVH 1596
            MLLQE  NMNGKNLSNHSFTESTDED KN+FSSLEEIS+SSNEPCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDY+GVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSN + KSENKSLQVPLAILQNNISPTFSMNN+LQQNNGSFSPF+T+PYL TNSG  LLNPNLIQI NTNGISPIQ+IDPLF NDIVPYLNH+NNFSASYIPPLTSSINNSYIGQALPTLHNG+LPMQNFLID+SHQAIADPKYFPQ FS+NVKSV+Y N+NNISKRQLNSN QQK+EPMC  QHE+KDKD+I CQSMNHFVGRY+NNGLMTMMMMSGSLDGNSTA+G ALPDCSNSL+APTGDSIWLIPAKIPRVH
Sbjct:    1 MLLQE--NMNGKNLSNHSFTESTDEDFKNDFSSLEEISASSNEPCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYNGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNTSIKSENKSLQVPLAILQNNISPTFSMNNILQQNNGSFSPFLTLPYLHTNSGPLLLNPNLIQIANTNGISPIQTIDPLFPNDIVPYLNHINNFSASYIPPLTSSINNSYIGQALPTLHNGSLPMQNFLIDLSHQAIADPKYFPQQFSENVKSVIYPNLNNISKRQLNSNSQQKSEPMCPTQHEIKDKDAISCQSMNHFVGRYSNNGLMTMMMMSGSLDGNSTAIGTALPDCSNSLEAPTGDSIWLIPAKIPRVH 473          
BLAST of Musashi vs. TrEMBL
Match: A0A4E0S077 (RNA-binding protein Musashi OS=Fasciola hepatica OX=6192 GN=D915_000503 PE=4 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 1.767e-79
Identity = 118/194 (60.82%), Postives = 161/194 (82.99%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAI 882
            P K+F+GGL+PTTTSE L+ YF ++GEIKEFM+MRD + KRSRGFGFVTF+D   V KVL+   HILDSKKIDPKLAVP+   Q  K++ RTK++FIGG+AT +T +E+ +YF+++G++E+CELMMDKATNRHRGFGFVTF  E+ AE++C IH+H+++NKMVEAKKA+PKE++S+SN+  K  ++ ++ P+ I
Sbjct:   79 PGKMFIGGLSPTTTSEGLRDYFQKYGEIKEFMIMRDPLTKRSRGFGFVTFSDPLCVEKVLEAAPHILDSKKIDPKLAVPRKSGQNTKLATRTKRVFIGGVATQTTNDELSEYFSQFGKIESCELMMDKATNRHRGFGFVTFESEEAAEKVCDIHFHDLHNKMVEAKKAVPKEVMSSSNSLLKPRHQFIRAPILI 272          
BLAST of Musashi vs. TrEMBL
Match: A0A3Q0KQN1 (Rna-binding protein musashi-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 2.109e-77
Identity = 112/193 (58.03%), Postives = 161/193 (83.42%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLA 879
            P K+F+GGL+PTTTSE L+ YF ++GE++E+M+MRD + KRSRGFGF+TF+D   V KVL+   HILD KKIDPKLAVP+   Q  K+S +TK++FIGG+AT +T EE+ +YF+++G++E+CELMMDK+TNRHRGFGFVTF  E+ AE++C+IH+H+++NKMVEAKKA+PKE++ST+N+  K  ++ ++ P++
Sbjct:   77 PGKMFIGGLSPTTTSEGLRDYFQKYGELREYMIMRDPLTKRSRGFGFITFSDPVCVEKVLETAPHILDYKKIDPKLAVPRKSGQNTKVSTKTKRVFIGGVATQTTNEELSEYFSQFGKLESCELMMDKSTNRHRGFGFVTFESEESAEKVCEIHFHDLHNKMVEAKKAVPKEVMSTNNSLIKQRHQFIRAPIS 269          
BLAST of Musashi vs. TrEMBL
Match: A0A5K4ET69 (Rna-binding protein musashi-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 4.710e-77
Identity = 112/193 (58.03%), Postives = 161/193 (83.42%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLA 879
            P K+F+GGL+PTTTSE L+ YF ++GE++E+M+MRD + KRSRGFGF+TF+D   V KVL+   HILD KKIDPKLAVP+   Q  K+S +TK++FIGG+AT +T EE+ +YF+++G++E+CELMMDK+TNRHRGFGFVTF  E+ AE++C+IH+H+++NKMVEAKKA+PKE++ST+N+  K  ++ ++ P++
Sbjct:   77 PGKMFIGGLSPTTTSEGLRDYFQKYGELREYMIMRDPLTKRSRGFGFITFSDPVCVEKVLETAPHILDYKKIDPKLAVPRKSGQNTKVSTKTKRVFIGGVATQTTNEELSEYFSQFGKLESCELMMDKSTNRHRGFGFVTFESEESAEKVCEIHFHDLHNKMVEAKKAVPKEVMSTNNSLIKQRHQFIRAPIS 269          
BLAST of Musashi vs. TrEMBL
Match: A0A430Q9P0 (RNA-binding protein Musashi OS=Schistosoma bovis OX=6184 GN=DC041_0003443 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 4.710e-77
Identity = 112/193 (58.03%), Postives = 161/193 (83.42%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLA 879
            P K+F+GGL+PTTTSE L+ YF ++GE++E+M+MRD + KRSRGFGF+TF+D   V KVL+   HILD KKIDPKLAVP+   Q  K+S +TK++FIGG+AT +T EE+ +YF+++G++E+CELMMDK+TNRHRGFGFVTF  E+ AE++C+IH+H+++NKMVEAKKA+PKE++ST+N+  K  ++ ++ P++
Sbjct:   77 PGKMFIGGLSPTTTSEGLRDYFQKYGELREYMIMRDPLTKRSRGFGFITFSDPVCVEKVLETAPHILDYKKIDPKLAVPRKSGQNTKVSTKTKRVFIGGVATQTTNEELSEYFSQFGKLESCELMMDKSTNRHRGFGFVTFESEESAEKVCEIHFHDLHNKMVEAKKAVPKEVMSTNNSLIKQRHQFIRAPIS 269          
BLAST of Musashi vs. Ensembl Cavefish
Match: msi2a (RNA-binding protein Musashi homolog 2-like [Source:NCBI gene;Acc:103045937])

HSP 1 Score: 228.024 bits (580), Expect = 2.400e-69
Identity = 105/174 (60.34%), Postives = 138/174 (79.31%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 70.8626 bits (172), Expect = 7.171e-13
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Musashi vs. Ensembl Cavefish
Match: msi2b (RNA-binding protein Musashi homolog 2 [Source:NCBI gene;Acc:103023867])

HSP 1 Score: 229.18 bits (583), Expect = 5.091e-69
Identity = 105/174 (60.34%), Postives = 138/174 (79.31%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLGQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 70.8626 bits (172), Expect = 1.030e-12
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Musashi vs. Ensembl Cavefish
Match: msi2b (RNA-binding protein Musashi homolog 2 [Source:NCBI gene;Acc:103023867])

HSP 1 Score: 228.794 bits (582), Expect = 7.950e-69
Identity = 105/174 (60.34%), Postives = 138/174 (79.31%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLGQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 70.8626 bits (172), Expect = 9.620e-13
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Musashi vs. Ensembl Cavefish
Match: msi2a (RNA-binding protein Musashi homolog 2-like [Source:NCBI gene;Acc:103045937])

HSP 1 Score: 228.409 bits (581), Expect = 9.470e-69
Identity = 105/174 (60.34%), Postives = 138/174 (79.31%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 71.2478 bits (173), Expect = 7.735e-13
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Musashi vs. Ensembl Cavefish
Match: msi2a (RNA-binding protein Musashi homolog 2-like [Source:NCBI gene;Acc:103045937])

HSP 1 Score: 228.409 bits (581), Expect = 9.877e-69
Identity = 105/174 (60.34%), Postives = 138/174 (79.31%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTF D + V KVL Q +H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+VE+  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 70.8626 bits (172), Expect = 1.003e-12
Identity = 36/93 (38.71%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++++ M+M D    R RGFGFVTF +   V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Musashi vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004893.1 (pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:ENSPMAG00000004449.1 transcript:ENSPMAT00000004893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.058 bits (375), Expect = 1.558e-41
Identity = 74/172 (43.02%), Postives = 102/172 (59.30%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            KLFVGGL+  TT E L+ YF Q+G + + +VM+D   KRSRGFGFVTF+  S V   +    H +D + ++PK AV +            KKIF+GGI   +  E +R YF +YG +E  E+M ++ + + RGF FVTF D D  ++I    YH IN    E +KALPK+ L
Sbjct:   12 KLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAVSREDSMRPGAHLSVKKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPKQEL 183          

HSP 2 Score: 72.4034 bits (176), Expect = 1.297e-14
Identity = 33/89 (37.08%), Postives = 54/89 (60.67%), Query Frame = 1
Query:  550 QPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKE 816
            +PE+     +K+F+GG++  +T E +RQYF ++G + +C +M D  + R RGFGFVTF      +       H I+ +MVE K+A+ +E
Sbjct:    6 EPEQF----RKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAVSRE 90          

HSP 3 Score: 60.4622 bits (145), Expect = 1.587e-10
Identity = 30/82 (36.59%), Postives = 47/82 (57.32%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQ 552
            K+FVGG+   T  E L+ YF ++G I+   VM +    + RGF FVTF D+  V K++ Q+ H ++    + + A+PK   Q
Sbjct:  103 KIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPKQELQ 184          
BLAST of Musashi vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 142.895 bits (359), Expect = 1.539e-39
Identity = 69/172 (40.12%), Postives = 105/172 (61.05%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            KLF+GGL+  TT ++++ +F Q+G + + +VMRD   KRSRGFGFVT+T    V   +    H LD++ ++ K A+ +          + KKIF+GGI   +  + +R+YF  YG+VE  E+M D++T + RGFGFVTF D D  +++    YH IN    E +KAL K+ +
Sbjct:   10 KLFIGGLSFETTEDSMRKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYTCPEEVDAAMDARPHHLDNRVVEAKRAISREDSLKPGAHLKVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTINGHKAEVRKALSKQEM 181          

HSP 2 Score: 69.3218 bits (168), Expect = 8.255e-14
Identity = 29/80 (36.25%), Postives = 54/80 (67.50%), Query Frame = 1
Query:  577 KKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKE 816
            +K+FIGG++  +T + +R++F ++G + +C +M D  T R RGFGFVT+   +  +       H+++N++VEAK+A+ +E
Sbjct:    9 RKLFIGGLSFETTEDSMRKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYTCPEEVDAAMDARPHHLDNRVVEAKRAISRE 88          
BLAST of Musashi vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 147.132 bits (370), Expect = 1.697e-39
Identity = 70/186 (37.63%), Postives = 110/186 (59.14%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSL 864
            KLF+GGL+  TT E++Q +F Q+G + + +VMRD   KRSRGFGFVT+     V   ++   H LD + ++ K A+ +          + KKIF+GGI  ++  + +R YF+ YG VE+ ++M D+ + + RGFGFVTF D D  +++    YH IN    E +KAL K+ +++    P+    S+
Sbjct:   34 KLFIGGLSFETTEESMQKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYMSAEEVDAAMEVRPHHLDGRVVEAKRAISREDSLKPGAHLKVKKIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTINGHKAEVRKALSKQEMNSLGGDPRQGENSV 219          

HSP 2 Score: 73.9442 bits (180), Expect = 1.929e-14
Identity = 28/80 (35.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query:  577 KKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKE 816
            +K+FIGG++  +T E ++++F ++G + +C +M D  T R RGFGFVT++  +  +   ++  H+++ ++VEAK+A+ +E
Sbjct:   33 RKLFIGGLSFETTEESMQKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYMSAEEVDAAMEVRPHHLDGRVVEAKRAISRE 112          
BLAST of Musashi vs. Ensembl Sea Lamprey
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 141.739 bits (356), Expect = 1.074e-38
Identity = 69/174 (39.66%), Postives = 108/174 (62.07%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLST 828
            KLF+GGL+  TT E+L+ Y+ Q+G I + +VM+D   KRSRGFGF+T++    V   ++   H +D + ++ K AVP+   +P  I    KK+F+GGI  ++    +R YF+++G VE+ +++ DK T + RGF FVTF D D  +QI    +H IN   +E +KAL +  + T
Sbjct:   15 KLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRDDSRP-GIQVTVKKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQIVFQKFHTINCHKLEVRKALSRHEMET 187          

HSP 2 Score: 73.559 bits (179), Expect = 5.764e-15
Identity = 30/89 (33.71%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  550 QPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKE 816
            +PE++    +K+FIGG++  +T E +R+Y+ ++G + +C +M D ++ R RGFGF+T+   +      Q   H ++ ++VEAK+A+P++
Sbjct:    9 EPEQM----RKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRD 93          
BLAST of Musashi vs. Ensembl Sea Lamprey
Match: TARDBP (TAR DNA binding protein [Source:HGNC Symbol;Acc:HGNC:11571])

HSP 1 Score: 95.5153 bits (236), Expect = 9.846e-23
Identity = 56/148 (37.84%), Postives = 83/148 (56.08%), Query Frame = 1
Query:  310 LFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQIC 753
            L V GL    + + ++ YFS FGE+    V RDI    S+GFGFV F DY   +KVL Q  H++D +  D KL  P S  Q    + R++KIF+G      T +++RQ+F+++GEV +  +         R F FVTF D+ +A+ +C
Sbjct:   27 LIVLGLPWKASEQDIRDYFSTFGEVLMAQVKRDIKTGNSKGFGFVRFRDYETQLKVLAQ-RHMIDGRWCDCKL--PNSKEQQVGDAFRSRKIFVGRCTEDITADDLRQFFSQFGEVTDVFI-----PKPFRAFAFVTFSDDQIAQGLC 166          
BLAST of Musashi vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 151.754 bits (382), Expect = 5.310e-40
Identity = 68/176 (38.64%), Postives = 110/176 (62.50%), Query Frame = 1
Query:  304 CKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTS 831
            CK+F+GGLN  TT + L+ YF ++G + +  +M+D    RSRGFGF++F   S V +V+K + HILD K IDPK A+P+          +T KIF+GGI      +E  ++F+++G + + +LM+DK T + RGFGFVT+   D  +++CQ  + +  ++ +E K+A P+ +   S
Sbjct:  159 CKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ-HILDGKVIDPKRAIPRDE------QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPRHMQQKS 327          

HSP 2 Score: 72.0182 bits (175), Expect = 8.665e-14
Identity = 29/85 (34.12%), Postives = 56/85 (65.88%), Query Frame = 1
Query:  562 ISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKE 816
            +S  + K+FIGG+   +T + +R+YF +YG V + ++M D AT R RGFGF++F      +++ +   H ++ K+++ K+A+P++
Sbjct:  154 LSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ-HILDGKVIDPKRAIPRD 237          
BLAST of Musashi vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 60.4622 bits (145), Expect = 3.821e-10
Identity = 43/172 (25.00%), Postives = 86/172 (50.00%), Query Frame = 1
Query:  310 LFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKK---IDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLD-EDVAEQICQIHYHNINNKMVEAKKALPK 813
            +F+  L+P   ++AL   FS FG+I    +  D  + +S+GFGFV F +     + +   N +L + +   + P L+  +   Q E+  A    +++  I + +T E+ ++ F ++G + +  L  D A  + +GFGFV +   ED  + +  ++   +N + +   +A  K
Sbjct:  128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKK 297          
BLAST of Musashi vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 59.6918 bits (143), Expect = 4.870e-10
Identity = 45/176 (25.57%), Postives = 85/176 (48.30%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPK-LAVPKSICQPEKISARTKK-----------IFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLD-EDVAEQICQIHYHNINNKMV 789
            P  +FVG L+ +   E L+  F   G +    V+ +    RSRG+G+V F + S   K +++    +  K+ID + +    S  +P   + R KK           +F+G ++ ++  + I + F ++GEV +  +     T + +GFG+V F + ED  + +  +    I+N+ V
Sbjct:  167 PATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQE----MQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPV 338          
BLAST of Musashi vs. Ensembl Yeast
Match: MRD1 (Essential conserved small ribosomal subunit (40s) synthesis factor; component of the 90S preribosome; required for production of 18S rRNA and small ribosomal subunit; contains five consensus RNA-binding domains and binds to the pre-rRNA at two sites within the 18S region [Source:SGD;Acc:S000006316])

HSP 1 Score: 49.6766 bits (117), Expect = 9.997e-7
Identity = 29/86 (33.72%), Postives = 52/86 (60.47%), Query Frame = 1
Query:  484 QENHILDSKKID-PKLAVPKSICQP---EKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLD 729
            ++N  LD+KK + P+ AVP+   +    EKI+ +T ++F+  I  +S  E+ R+ F+ +GE+E   + +D  T + +GF +V F D
Sbjct:  311 EQNESLDTKKEEQPERAVPQKTDEELAIEKIN-QTGRLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKD 395          
BLAST of Musashi vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 49.2914 bits (116), Expect = 1.122e-6
Identity = 37/146 (25.34%), Postives = 67/146 (45.89%), Query Frame = 1
Query:  310 LFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISAR-TKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAE 744
            L+VG L+   T + L+ YF   G I    +M D  + ++  + FV +         L+     L+ K+I+  +       Q ++ S+  T  +F+G +  +   E +R  F  +    +  +M D  T   RG+GFV+F  +D A+
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMID-KNNKNVNYAFVEYHQSHDANIALQ----TLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQ 217          
BLAST of Musashi vs. Ensembl Nematostella
Match: EDO39879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S5])

HSP 1 Score: 195.282 bits (495), Expect = 3.758e-59
Identity = 95/172 (55.23%), Postives = 125/172 (72.67%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            K+F+GGL+  TT+E L+ +F +FGE+KE +VMRD V KRSRGFGF+TF D   V  VL      LD KKIDPKLAVPK    P K+   TKKIFIGG++T+++ E++++YF+++G++    LM DKAT RHRGFGFVTF  E+ A++ C   YH INNK VE KKA PKE++
Sbjct:    1 KMFIGGLSWQTTAEGLRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKIDPKLAVPKRA--PAKMVTTTKKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKEVM 170          
BLAST of Musashi vs. Ensembl Nematostella
Match: EDO49349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG33])

HSP 1 Score: 150.599 bits (379), Expect = 1.272e-42
Identity = 74/179 (41.34%), Postives = 117/179 (65.36%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRY------GEVENCELMMDKAT-NRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            K+F+GGLN  TT E L+ YFSQ+G I + ++M+     RSRGFGFVT+     V +VLK+++H+LD ++I+PK +VP+      +  ++T+KIF+GG+A+++  E+I++YFN        GEV + +L  D+    R RGF FVTF ++++ E++C + YH I  K  E KKA P+  +
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMKR--DGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQSAM 177          

HSP 2 Score: 65.0846 bits (157), Expect = 2.713e-12
Identity = 35/125 (28.00%), Postives = 73/125 (58.40%), Query Frame = 1
Query:  580 KIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAIL-----QNNISPTFSMNNLLQQNN 939
            KIFIGG+  ++T E ++ YF+++G + +C +M  K   R RGFGFVT+   D   ++ +   H ++++ +E K+++P++     +  P++ +K+ ++ +  L     + +I   F  N+L ++N 
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIM--KRDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRD----ESGAPEAMSKTRKIFVGGLASTTVEEDIKEYF--NSLCRKNG 117          
BLAST of Musashi vs. Ensembl Nematostella
Match: EDO38417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX6])

HSP 1 Score: 147.902 bits (372), Expect = 4.155e-40
Identity = 89/249 (35.74%), Postives = 132/249 (53.01%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQEN-HILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNR-YGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAILQNNISPTFSMNNLLQQNNGSFSPFVTMPYLQTNSGHFLLNPNLIQITNTNGISP 1047
            KLFVGGL+  TT E+L+ YFS++GE+    +  D +  R RGF FV F   S    VL Q + H+LD + IDPK A P  I +P  +  R KKIF+GG+   ++ E+IR+YF + Y  V+  E + + ++NR RGF FV+F  ED  ++IC+  +HNI    VE K+ALPKE+     A   +  + +   L  L   +            + G++ P  T  Y    +     +P L   +   G+SP
Sbjct:   30 KLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQVDPHVLDGRTIDPKPAAP--IGKPPHL--RVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPKEVQQQQAALRAAAGRGIIPALGTLGPRVG----------LSTGAY-PSYTALYGAFGANAAAFDPALYGASYVPGLSP 263          
BLAST of Musashi vs. Ensembl Nematostella
Match: EDO33389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE1])

HSP 1 Score: 143.28 bits (360), Expect = 4.396e-40
Identity = 75/163 (46.01%), Postives = 101/163 (61.96%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQ--PEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMV 789
            K+FVGGL  +T S  LQ YF ++GE+ + ++M D V KRSR FGF+TF D S V  V+  + H LD K IDPK AVP+   Q  P+       KIF+GG+A S++ +++  YF  YG+V +  LM+D  T + RGFGFVTF  +D   +    HYH IN K V
Sbjct:    2 KIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPRGPGQGPPQGNQNNEFKIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADEHYHQINGKTV 164          

HSP 2 Score: 78.1814 bits (191), Expect = 5.890e-17
Identity = 33/79 (41.77%), Postives = 50/79 (63.29%), Query Frame = 1
Query:  577 KKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPK 813
            +KIF+GG+A S+    ++ YF +YGEV +C LM D  T R R FGF+TF D  V + +     H ++ KM++ K A+P+
Sbjct:    1 RKIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPR 79          
BLAST of Musashi vs. Ensembl Nematostella
Match: EDO36522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF0])

HSP 1 Score: 133.265 bits (334), Expect = 3.992e-36
Identity = 77/181 (42.54%), Postives = 111/181 (61.33%), Query Frame = 1
Query:  304 CKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQ--EN--HILDSKKIDPKLAVPK---SICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGE--VENCELMMDKATN-RHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKE 816
             KLFVGGLN  TT+E L+ YF  +GE+ + +V+ D   K+SRGFG+VTF DY     VLK   EN  H +D K+++ K A+P+   S    EK    TKKIF+GG+   +T E+I++      E  V+  +L+M K    +HRGF FV   +ED A+++C +   ++  KMVEAKKA P++
Sbjct:   14 AKLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDDNSATSHEK----TKKIFVGGLPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDETKHRGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPRD 190          
BLAST of Musashi vs. Ensembl Medaka
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:101173434])

HSP 1 Score: 239.965 bits (611), Expect = 1.423e-73
Identity = 110/194 (56.70%), Postives = 149/194 (76.80%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAI 882
            PCK+F+GGL+  TT E L+ YF ++GE+KE MVMRD V KRSRGFGFVTF D +GV KVL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++T+E+++QYF+++G+V++  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE++S + +   +  +S  +P  +
Sbjct:   19 PCKMFIGGLSWQTTQEGLKEYFCKYGEVKECMVMRDPVTKRSRGFGFVTFVDQAGVDKVLAQSRHELDSKTIDPKVAFPRR-AQP-KLVTRTKKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGS---ARGRSRVMPYGM 207          
BLAST of Musashi vs. Ensembl Medaka
Match: MSI1 (RNA-binding protein Musashi homolog 1 [Source:NCBI gene;Acc:101154771])

HSP 1 Score: 238.039 bits (606), Expect = 7.035e-73
Identity = 108/194 (55.67%), Postives = 149/194 (76.80%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAI 882
            PCK+F+GGL+  TT E L+ YF +FGE+KE MVMRD V KRSRGFGFVT+ D +GV +VL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++T+E+++QYF+++G+V++  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE+++ + +   +  +S  +P  +
Sbjct:   21 PCKMFIGGLSWQTTQEGLREYFGKFGEVKECMVMRDPVTKRSRGFGFVTYADQAGVEQVLAQNRHELDSKTIDPKVAFPRR-AQP-KLVTRTKKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMTPTGS---ARGRSRVMPYGM 209          
BLAST of Musashi vs. Ensembl Medaka
Match: MSI1 (RNA-binding protein Musashi homolog 1 [Source:NCBI gene;Acc:101154771])

HSP 1 Score: 231.106 bits (588), Expect = 1.720e-70
Identity = 109/191 (57.07%), Postives = 146/191 (76.44%), Query Frame = 1
Query:  301 PC------KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLS-TSNATPKSE 852
            PC      K+F+GGL+  TT E L+ YF +FGE+KE MVMRD V KRSRGFGFVT+ D +GV +VL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++T+E+++QYF+++G+V++  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE+++ T +A  +S 
Sbjct:    2 PCVFLSLSKMFIGGLSWQTTQEGLREYFGKFGEVKECMVMRDPVTKRSRGFGFVTYADQAGVEQVLAQNRHELDSKTIDPKVAFPRR-AQP-KLVTRTKKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMTPTGSARGRSR 190          
BLAST of Musashi vs. Ensembl Medaka
Match: MSI1 (RNA-binding protein Musashi homolog 1 [Source:NCBI gene;Acc:101154771])

HSP 1 Score: 231.106 bits (588), Expect = 3.355e-70
Identity = 107/183 (58.47%), Postives = 144/183 (78.69%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLS-TSNATPKSE 852
            K+F+GGL+  TT E L+ YF +FGE+KE MVMRD V KRSRGFGFVT+ D +GV +VL Q  H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++T+E+++QYF+++G+V++  LM DK TNRHRGFGFVTF +EDV E++C+IH+H INNKMVE KKA PKE+++ T +A  +S 
Sbjct:   29 KMFIGGLSWQTTQEGLREYFGKFGEVKECMVMRDPVTKRSRGFGFVTYADQAGVEQVLAQNRHELDSKTIDPKVAFPRR-AQP-KLVTRTKKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMTPTGSARGRSR 209          
BLAST of Musashi vs. Ensembl Medaka
Match: msi2a (musashi RNA binding protein 2 [Source:NCBI gene;Acc:101163923])

HSP 1 Score: 228.794 bits (582), Expect = 8.511e-70
Identity = 103/174 (59.20%), Postives = 139/174 (79.89%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELL 822
            P K+F+GGL+  T+ ++L+ YFS+FGEI+E MVMRD   KRSRGFGFVTFTD + V KVL Q++H LDSK IDPK+A P+   QP K+  RTKKIF+GG++ ++ VE+++QYF ++G+V++  LM DK TNRHRGFGF+TF  ED+ E++C+IH+H INNKMVE KKA PKE++
Sbjct:   20 PGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQQHHELDSKTIDPKVAFPRR-AQP-KMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVM 191          

HSP 2 Score: 68.9366 bits (167), Expect = 2.553e-12
Identity = 35/93 (37.63%), Postives = 53/93 (56.99%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKI 585
            K+FVGGL+  T  E ++ YF QFG++ + M+M D    R RGFGF+TF     V KV +   H +++K ++ K A PK +  P     R + +
Sbjct:  111 KIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Musashi vs. Planmine SMEST
Match: SMESG000071202.1 (SMESG000071202.1)

HSP 1 Score: 915.22 bits (2364), Expect = 0.000e+0
Identity = 475/475 (100.00%), Postives = 475/475 (100.00%), Query Frame = 1
Query:  172 MLLQEKDNMNGKNLSNHSFTESTDEDIKNXXXXXXXXXXXXXXPCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAILQNNISPTFSMNNLLQQNNGSFSPFVTMPYLQTNSGHFLLNPNLIQITNTNGISPIQSIDPLFSNDIVPYLNHLNNFSASYIPPLTSSINNSYIGQALPTLHNGTLPMQNFLIDISHQAIADPKYFPQPFSDNVKSVLYSNMNNISKRQLNSNPQQKTEPMCTPQHELKDKDSIPCQSMNHFVGRYNXXXXXXXXXXXXXXDGNSTAMGAALPDCSNSLDAPTGDSIWLIPAKIPRVH 1596
            MLLQEKDNMNGKNLSNHSFTESTDEDIKNEFSSLEEISSSSNEPCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAILQNNISPTFSMNNLLQQNNGSFSPFVTMPYLQTNSGHFLLNPNLIQITNTNGISPIQSIDPLFSNDIVPYLNHLNNFSASYIPPLTSSINNSYIGQALPTLHNGTLPMQNFLIDISHQAIADPKYFPQPFSDNVKSVLYSNMNNISKRQLNSNPQQKTEPMCTPQHELKDKDSIPCQSMNHFVGRYNNNGLMTMMMMSGSLDGNSTAMGAALPDCSNSLDAPTGDSIWLIPAKIPRVH
Sbjct:    1 MLLQEKDNMNGKNLSNHSFTESTDEDIKNEFSSLEEISSSSNEPCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAILQNNISPTFSMNNLLQQNNGSFSPFVTMPYLQTNSGHFLLNPNLIQITNTNGISPIQSIDPLFSNDIVPYLNHLNNFSASYIPPLTSSINNSYIGQALPTLHNGTLPMQNFLIDISHQAIADPKYFPQPFSDNVKSVLYSNMNNISKRQLNSNPQQKTEPMCTPQHELKDKDSIPCQSMNHFVGRYNNNGLMTMMMMSGSLDGNSTAMGAALPDCSNSLDAPTGDSIWLIPAKIPRVH 475          
BLAST of Musashi vs. Planmine SMEST
Match: SMESG000071202.1 (SMESG000071202.1)

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 467/467 (100.00%), Postives = 467/467 (100.00%), Query Frame = 1
Query:  196 MNGKNLSNHSFTESTDEDIKNXXXXXXXXXXXXXXPCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAILQNNISPTFSMNNLLQQNNGSFSPFVTMPYLQTNSGHFLLNPNLIQITNTNGISPIQSIDPLFSNDIVPYLNHLNNFSASYIPPLTSSINNSYIGQALPTLHNGTLPMQNFLIDISHQAIADPKYFPQPFSDNVKSVLYSNMNNISKRQLNSNPQQKTEPMCTPQHELKDKDSIPCQSMNHFVGRYNXXXXXXXXXXXXXXDGNSTAMGAALPDCSNSLDAPTGDSIWLIPAKIPRVH 1596
            MNGKNLSNHSFTESTDEDIKNEFSSLEEISSSSNEPCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAILQNNISPTFSMNNLLQQNNGSFSPFVTMPYLQTNSGHFLLNPNLIQITNTNGISPIQSIDPLFSNDIVPYLNHLNNFSASYIPPLTSSINNSYIGQALPTLHNGTLPMQNFLIDISHQAIADPKYFPQPFSDNVKSVLYSNMNNISKRQLNSNPQQKTEPMCTPQHELKDKDSIPCQSMNHFVGRYNNNGLMTMMMMSGSLDGNSTAMGAALPDCSNSLDAPTGDSIWLIPAKIPRVH
Sbjct:    1 MNGKNLSNHSFTESTDEDIKNEFSSLEEISSSSNEPCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAILQNNISPTFSMNNLLQQNNGSFSPFVTMPYLQTNSGHFLLNPNLIQITNTNGISPIQSIDPLFSNDIVPYLNHLNNFSASYIPPLTSSINNSYIGQALPTLHNGTLPMQNFLIDISHQAIADPKYFPQPFSDNVKSVLYSNMNNISKRQLNSNPQQKTEPMCTPQHELKDKDSIPCQSMNHFVGRYNNNGLMTMMMMSGSLDGNSTAMGAALPDCSNSLDAPTGDSIWLIPAKIPRVH 467          
BLAST of Musashi vs. Planmine SMEST
Match: SMESG000077233.1 (SMESG000077233.1)

HSP 1 Score: 242.662 bits (618), Expect = 2.481e-73
Identity = 118/232 (50.86%), Postives = 164/232 (70.69%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSI------CQPE------------KIS------ARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAILQNNISPTFSMNNL 924
            P K+F+GGL+PTT+ E ++ YF ++G+IKEFM+MRD V KRSRGFGFVTF + S V KVL +  H LDSKKIDPK+AVP+ I      C               K+S      A+TKK+FIGGI+T++T +E+ +YF+++G +E CELMMDKAT+RHRGFGFVTF +ED AE++C IH+H++NNK VEAKKALPKE++  +N   K  N+ ++  L ++ N +   +++N L
Sbjct:   27 PGKMFIGGLSPTTSPETMRDYFRKYGDIKEFMIMRDPVTKRSRGFGFVTFLESSSVKKVLNKTPHFLDSKKIDPKVAVPRKIESSTKNCDTSIDCLGINGYSSGKLSDSSLNNAKTKKVFIGGISTNTTKQELEEYFSQFGILETCELMMDKATSRHRGFGFVTFENEDSAEKVCDIHFHDLNNKTVEAKKALPKEIIG-NNGVLKQRNQLIRTSLPLISNQLQNNYALNAL 257          
BLAST of Musashi vs. Planmine SMEST
Match: SMESG000077233.1 (SMESG000077233.1)

HSP 1 Score: 242.662 bits (618), Expect = 3.431e-73
Identity = 118/232 (50.86%), Postives = 164/232 (70.69%), Query Frame = 1
Query:  301 PCKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSI------CQPE------------KIS------ARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAILQNNISPTFSMNNL 924
            P K+F+GGL+PTT+ E ++ YF ++G+IKEFM+MRD V KRSRGFGFVTF + S V KVL +  H LDSKKIDPK+AVP+ I      C               K+S      A+TKK+FIGGI+T++T +E+ +YF+++G +E CELMMDKAT+RHRGFGFVTF +ED AE++C IH+H++NNK VEAKKALPKE++  +N   K  N+ ++  L ++ N +   +++N L
Sbjct:   27 PGKMFIGGLSPTTSPETMRDYFRKYGDIKEFMIMRDPVTKRSRGFGFVTFLESSSVKKVLNKTPHFLDSKKIDPKVAVPRKIESSTKNCDTSIDCLGINGYSSGKLSDSSLNNAKTKKVFIGGISTNTTKQELEEYFSQFGILETCELMMDKATSRHRGFGFVTFENEDSAEKVCDIHFHDLNNKTVEAKKALPKEIIG-NNGVLKQRNQLIRTSLPLISNQLQNNYALNAL 257          
BLAST of Musashi vs. Planmine SMEST
Match: SMESG000045507.1 (SMESG000045507.1)

HSP 1 Score: 164.081 bits (414), Expect = 1.448e-47
Identity = 76/139 (54.68%), Postives = 107/139 (76.98%), Query Frame = 1
Query:  307 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKI-----SARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGF 708
            KLF+GGL+P TT E L++YF  +G+IK+ M+++D V KRSRGFGFVTF DYS + K+L    H LDSKKIDPK+A+PK   +PE I     + +T+K+FIGG++ S+  +++  +F +YG+VE+CELMMDK+TNRHRG+
Sbjct:   18 KLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSKKIDPKIAIPK---KPELIDKAINTEKTRKVFIGGLSNSTVHKDLEAFFGKYGKVESCELMMDKSTNRHRGY 153          

HSP 2 Score: 75.8702 bits (185), Expect = 5.873e-16
Identity = 39/101 (38.61%), Postives = 62/101 (61.39%), Query Frame = 1
Query:  556 EKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPK--ELLSTSNATPKSE 852
            EK     KK+FIGG++  +T+E +R YF  YG++++  ++ D  T R RGFGFVTF+D    E+I     H +++K ++ K A+PK  EL+  +  T K+ 
Sbjct:   10 EKCHEVNKKLFIGGLSPHTTLETLRNYFQNYGDIKDVMILKDPVTKRSRGFGFVTFIDYSTIEKILLNSPHFLDSKKIDPKIAIPKKPELIDKAINTEKTR 110          
The following BLAST results are available for this feature:
BLAST of Musashi vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MSI15.347e-7356.70musashi RNA binding protein 1 [Source:HGNC Symbol;... [more]
MSI21.816e-6860.34musashi RNA binding protein 2 [Source:HGNC Symbol;... [more]
MSI25.331e-6860.47musashi RNA binding protein 2 [Source:HGNC Symbol;... [more]
MSI24.816e-6760.23musashi RNA binding protein 2 [Source:HGNC Symbol;... [more]
MSI13.936e-4653.15musashi RNA binding protein 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Musashi vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msi-11.641e-6657.47MuSashI (Fly neural) family; Neural RNA-binding pr... [more]
hrp-11.009e-4240.00Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-11.009e-4240.00Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-11.033e-4240.00Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-11.033e-4240.00Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
back to top
BLAST of Musashi vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbp63.698e-6454.49gene:FBgn0260943 transcript:FBtr0075285[more]
Rbp63.949e-6454.49gene:FBgn0260943 transcript:FBtr0333861[more]
Rbp67.862e-6354.49gene:FBgn0260943 transcript:FBtr0113427[more]
msi5.818e-5551.43gene:FBgn0011666 transcript:FBtr0333665[more]
msi8.458e-5550.85gene:FBgn0011666 transcript:FBtr0305219[more]
back to top
BLAST of Musashi vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msi2b1.410e-6960.34musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZD... [more]
msi2b2.271e-6960.47musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZD... [more]
msi2b8.028e-6960.34musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZD... [more]
msi2a1.763e-6859.77musashi RNA-binding protein 2a [Source:ZFIN;Acc:ZD... [more]
msi2a1.763e-6859.77musashi RNA-binding protein 2a [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Musashi vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msi15.968e-7259.78musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
msi11.114e-7159.78musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
msi15.312e-6959.09musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
msi16.817e-6959.09musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
msi11.033e-6859.09musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Musashi vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Msi12.463e-7256.19musashi RNA-binding protein 1 [Source:MGI Symbol;A... [more]
Msi29.579e-6960.34musashi RNA-binding protein 2 [Source:MGI Symbol;A... [more]
Msi21.195e-6860.34musashi RNA-binding protein 2 [Source:MGI Symbol;A... [more]
Msi16.299e-6656.04musashi RNA-binding protein 1 [Source:MGI Symbol;A... [more]
Msi15.597e-6559.06musashi RNA-binding protein 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Musashi vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43347|MSI1H_HUMAN2.568e-7256.70RNA-binding protein Musashi homolog 1 OS=Homo sapi... [more]
sp|Q61474|MSI1H_MOUSE1.723e-7156.19RNA-binding protein Musashi homolog 1 OS=Mus muscu... [more]
sp|Q8K3P4|MSI1H_RAT1.741e-7156.19RNA-binding protein Musashi homolog 1 OS=Rattus no... [more]
sp|Q920Q6|MSI2H_MOUSE6.701e-6860.34RNA-binding protein Musashi homolog 2 OS=Mus muscu... [more]
sp|Q96DH6|MSI2H_HUMAN8.722e-6860.34RNA-binding protein Musashi homolog 2 OS=Homo sapi... [more]
back to top
BLAST of Musashi vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B1Q3I80.000e+092.21Musashi OS=Dugesia japonica OX=6161 GN=DjmlgB PE=2... [more]
A0A4E0S0771.767e-7960.82RNA-binding protein Musashi OS=Fasciola hepatica O... [more]
A0A3Q0KQN12.109e-7758.03Rna-binding protein musashi-related OS=Schistosoma... [more]
A0A5K4ET694.710e-7758.03Rna-binding protein musashi-related OS=Schistosoma... [more]
A0A430Q9P04.710e-7758.03RNA-binding protein Musashi OS=Schistosoma bovis O... [more]
back to top
BLAST of Musashi vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msi2a2.400e-6960.34RNA-binding protein Musashi homolog 2-like [Source... [more]
msi2b5.091e-6960.34RNA-binding protein Musashi homolog 2 [Source:NCBI... [more]
msi2b7.950e-6960.34RNA-binding protein Musashi homolog 2 [Source:NCBI... [more]
msi2a9.470e-6960.34RNA-binding protein Musashi homolog 2-like [Source... [more]
msi2a9.877e-6960.34RNA-binding protein Musashi homolog 2-like [Source... [more]
back to top
BLAST of Musashi vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004893.11.558e-4143.02pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:... [more]
HNRNPA01.539e-3940.12heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA01.697e-3937.63heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA2B11.074e-3839.66heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
TARDBP9.846e-2337.84TAR DNA binding protein [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Musashi vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRP15.310e-4038.64Subunit of cleavage factor I; cleavage factor I is... [more]
PAB13.821e-1025.00Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
NSR14.870e-1025.57Nucleolar protein that binds nuclear localization ... [more]
MRD19.997e-733.72Essential conserved small ribosomal subunit (40s) ... [more]
PUB11.122e-625.34Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
back to top
BLAST of Musashi vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398793.758e-5955.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493491.272e-4241.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384174.155e-4035.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333894.396e-4046.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365223.992e-3642.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Musashi vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msi11.423e-7356.70musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
MSI17.035e-7355.67RNA-binding protein Musashi homolog 1 [Source:NCBI... [more]
MSI11.720e-7057.07RNA-binding protein Musashi homolog 1 [Source:NCBI... [more]
MSI13.355e-7058.47RNA-binding protein Musashi homolog 1 [Source:NCBI... [more]
msi2a8.511e-7059.20musashi RNA binding protein 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Musashi vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071202.10.000e+0100.00SMESG000071202.1[more]
SMESG000071202.10.000e+0100.00SMESG000071202.1[more]
SMESG000077233.12.481e-7350.86SMESG000077233.1[more]
SMESG000077233.13.431e-7350.86SMESG000077233.1[more]
SMESG000045507.11.448e-4754.68SMESG000045507.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031336 ID=SMED30031336|Name=Musashi|organism=Schmidtea mediterranea sexual|type=transcript|length=1786bp
ATTTTTTTTCGACAAAATTAATTTTTAACAATTCAAATCGACGATGATTT
TTTGACGAATTTTGATTCTCTCTGGTTTTTGTCAGTTGATATATTCTTTA
TATTTGATTGTTGTTTTAACGTATCGCTGAAATAAAAACAAAGCACAAAA
CAGTTTACTTCTTTTCAGTTAATGTTACTCCAAGAAAAAGACAATATGAA
TGGAAAAAATTTATCAAATCATTCCTTCACTGAATCGACAGATGAAGACA
TCAAAAACGAATTCTCATCGTTGGAGGAAATTTCTAGCAGTTCAAATGAG
CCATGTAAATTGTTTGTCGGTGGTCTCAATCCAACCACAACTTCTGAAGC
TCTTCAATCGTATTTCTCCCAGTTTGGTGAAATCAAAGAATTCATGGTGA
TGAGAGACATTGTGCACAAACGATCAAGAGGATTCGGATTTGTCACATTT
ACAGATTATAGTGGCGTTATAAAAGTACTCAAACAGGAAAACCATATATT
AGATTCAAAAAAAATAGATCCTAAACTGGCAGTTCCGAAAAGTATTTGCC
AACCTGAAAAGATCTCTGCACGAACAAAAAAGATATTTATCGGTGGCATA
GCAACCTCAAGCACCGTTGAAGAAATTCGACAATATTTCAATCGTTATGG
AGAGGTGGAAAACTGCGAATTGATGATGGATAAGGCAACAAACCGACACC
GAGGATTTGGATTTGTGACATTTCTCGATGAAGATGTTGCAGAGCAAATC
TGTCAAATTCATTATCACAATATTAACAATAAAATGGTTGAAGCTAAGAA
AGCTTTGCCCAAAGAATTGTTATCTACGTCAAATGCAACTCCAAAGTCCG
AGAACAAATCACTCCAAGTACCTTTAGCAATACTCCAAAACAACATCAGT
CCAACATTTTCAATGAATAATCTTCTACAACAGAACAATGGCTCATTTTC
TCCATTTGTTACTATGCCATATTTACAAACAAATTCTGGACATTTTTTAC
TCAATCCCAATTTGATACAAATAACTAATACAAACGGAATCTCTCCAATT
CAGAGTATAGACCCCTTGTTTTCAAATGACATTGTTCCGTATTTAAATCA
TTTAAACAATTTCTCAGCATCATACATTCCACCGCTAACCTCTTCTATAA
ACAACAGTTACATTGGTCAAGCTCTTCCGACCCTGCATAATGGTACACTT
CCGATGCAAAATTTTCTCATCGATATATCACATCAAGCGATTGCCGACCC
AAAATATTTCCCTCAACCTTTTTCCGATAATGTAAAGTCAGTTCTCTATT
CAAATATGAACAACATTAGCAAAAGACAATTGAATTCAAACCCTCAACAG
AAGACCGAGCCCATGTGTACACCTCAACACGAATTGAAGGATAAAGATTC
TATTCCATGTCAGTCAATGAATCATTTTGTTGGTAGGTATAATAATAATG
GTTTAATGACTATGATGATGATGTCTGGCTCGCTTGATGGAAACTCAACT
GCCATGGGGGCAGCGCTACCTGATTGCAGTAACTCATTAGACGCCCCAAC
TGGAGACAGTATATGGTTAATTCCAGCTAAAATTCCCAGAGTTCATTAAC
AAAACCAAGTTTTATTTTCAAATAACCGATCCAGATGTTTATTAAAATCG
GCATTAGTGTCCAGAAATAATAAATGCTGTGATTACAGTTATTAGCGTAC
TCCAACAGGTTGTGCATGACCTATTTTAACTCCTTGTGTTTATCATCATC
GAGTCAATTTTATTCGATAATAAATATTAATATAAT
back to top

protein sequence of SMED30031336-orf-1

>SMED30031336-orf-1 ID=SMED30031336-orf-1|Name=SMED30031336-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=476bp
MLLQEKDNMNGKNLSNHSFTESTDEDIKNEFSSLEEISSSSNEPCKLFVG
GLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVI
KVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVE
EIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHN
INNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAILQNNISPTFSMNN
LLQQNNGSFSPFVTMPYLQTNSGHFLLNPNLIQITNTNGISPIQSIDPLF
SNDIVPYLNHLNNFSASYIPPLTSSINNSYIGQALPTLHNGTLPMQNFLI
DISHQAIADPKYFPQPFSDNVKSVLYSNMNNISKRQLNSNPQQKTEPMCT
PQHELKDKDSIPCQSMNHFVGRYNNNGLMTMMMMSGSLDGNSTAMGAALP
DCSNSLDAPTGDSIWLIPAKIPRVH*
back to top
Aliases
The feature 'Musashi' has the following synonyms
Synonym
Dj-musashi
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR037366BOULE/DAZ
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 46..118
e-value: 6.1E-21
score: 85.6
coord: 137..209
e-value: 6.9E-22
score: 88.7
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 138..204
e-value: 8.4E-14
score: 51.1
coord: 47..108
e-value: 2.7E-17
score: 62.3
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 45..122
score: 15.613
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 136..213
score: 16.074
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 135..211
e-value: 1.5E-22
score: 81.7
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 45..125
e-value: 8.1E-23
score: 82.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..25
NoneNo IPR availablePANTHERPTHR11176:SF13GENE 17190-RELATEDcoord: 100..257
NoneNo IPR availablePANTHERPTHR11176:SF13GENE 17190-RELATEDcoord: 45..130
IPR037366BOULE/DAZ familyPANTHERPTHR11176BOULE-RELATEDcoord: 45..130
coord: 100..257
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 43..127
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 128..215