C-Jun-amino-terminal kinase-interacting protein 3

Overview
NameC-Jun-amino-terminal kinase-interacting protein 3
Smed IDSMED30031333
Length (bp)3161
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C-Jun-amino-terminal kinase-interacting protein 3 (SMED30031333) t-SNE clustered cells

Violin plots show distribution of expression levels for C-Jun-amino-terminal kinase-interacting protein 3 (SMED30031333) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C-Jun-amino-terminal kinase-interacting protein 3 (SMED30031333) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C-Jun-amino-terminal kinase-interacting protein 3 (SMED30031333) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031333

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30031333SMESG000055134.1 dd_Smed_v4_8581_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031333SMESG000055134.1 dd_Smed_v4_8581_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Human
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 141.739 bits (356), Expect = 2.105e-33
Identity = 85/195 (43.59%), Postives = 125/195 (64.10%), Query Frame = 1
Query:   88 PDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK---LSGNRNMSLLQKHSISKFAKPLDMGM 663
            P  +  +MSE+V  +A  IYREFERL+  YD  VVK LMPL+V VLENL+ +      + +E+ELLR+DN  L+ QY++EK+ R+  EEK +  E + E EKK    ++E+LE+  R LELK++N  D + RLEE+E E KKEY  LH+R+T++   + + LER K   LSG+  +     HS  +  +P+ +G+
Sbjct:   13 PGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLEST-AHSRIRKERPISLGI 206          

HSP 2 Score: 127.487 bits (319), Expect = 6.017e-29
Identity = 100/280 (35.71%), Postives = 148/280 (52.86%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPN----DSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPL--------SDVC-KVDKKSHTKFQ------KCFIF----------------------------KEDINRSQLYGWSVPRDLLQSSVSS------NVPIPV 1656
             G+GRE+EN+I EN +L+ETKNALNIVK+DLI K+D LT E D+L+  L++    ++ L+ +   +E+E++  R + ED + K ++ D+ +      KRFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR++P      + K +S I +           S++    K+ E P+        S V   V K+S T  Q      K F F                            KED  R Q +GWS+P+   Q +         N+P+PV
Sbjct:  390 LGMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAM----QEKKRSSIWQLLSSFSFSRLFSSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYRQVKAHVQKED-GRVQAFGWSLPQKYKQVTNGQGENKMKNLPVPV 664          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Human
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 141.739 bits (356), Expect = 2.246e-33
Identity = 85/195 (43.59%), Postives = 125/195 (64.10%), Query Frame = 1
Query:   88 PDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK---LSGNRNMSLLQKHSISKFAKPLDMGM 663
            P  +  +MSE+V  +A  IYREFERL+  YD  VVK LMPL+V VLENL+ +      + +E+ELLR+DN  L+ QY++EK+ R+  EEK +  E + E EKK    ++E+LE+  R LELK++N  D + RLEE+E E KKEY  LH+R+T++   + + LER K   LSG+  +     HS  +  +P+ +G+
Sbjct:   13 PGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLEST-AHSRIRKERPISLGI 206          

HSP 2 Score: 127.102 bits (318), Expect = 6.938e-29
Identity = 69/139 (49.64%), Postives = 103/139 (74.10%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPN----DSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHP 1380
             G+GRE+EN+I EN +L+ETKNALNIVK+DLI K+D LT E D+L+  L++    ++ L+ +   +E+E++  R + ED + K ++ D+ +      KRFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR++P
Sbjct:  390 LGMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENP 528          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Human
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 141.354 bits (355), Expect = 2.578e-33
Identity = 85/195 (43.59%), Postives = 125/195 (64.10%), Query Frame = 1
Query:   88 PDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK---LSGNRNMSLLQKHSISKFAKPLDMGM 663
            P  +  +MSE+V  +A  IYREFERL+  YD  VVK LMPL+V VLENL+ +      + +E+ELLR+DN  L+ QY++EK+ R+  EEK +  E + E EKK    ++E+LE+  R LELK++N  D + RLEE+E E KKEY  LH+R+T++   + + LER K   LSG+  +     HS  +  +P+ +G+
Sbjct:   13 PGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLEST-AHSRIRKERPISLGI 206          

HSP 2 Score: 126.716 bits (317), Expect = 8.223e-29
Identity = 69/139 (49.64%), Postives = 103/139 (74.10%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPN----DSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHP 1380
             G+GRE+EN+I EN +L+ETKNALNIVK+DLI K+D LT E D+L+  L++    ++ L+ +   +E+E++  R + ED + K ++ D+ +      KRFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR++P
Sbjct:  404 LGMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENP 542          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Human
Match: SPAG9 (sperm associated antigen 9 [Source:HGNC Symbol;Acc:HGNC:14524])

HSP 1 Score: 141.354 bits (355), Expect = 2.743e-33
Identity = 85/195 (43.59%), Postives = 125/195 (64.10%), Query Frame = 1
Query:   88 PDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK---LSGNRNMSLLQKHSISKFAKPLDMGM 663
            P  +  +MSE+V  +A  IYREFERL+  YD  VVK LMPL+V VLENL+ +      + +E+ELLR+DN  L+ QY++EK+ R+  EEK +  E + E EKK    ++E+LE+  R LELK++N  D + RLEE+E E KKEY  LH+R+T++   + + LER K   LSG+  +     HS  +  +P+ +G+
Sbjct:   13 PGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLEST-AHSRIRKERPISLGI 206          

HSP 2 Score: 129.413 bits (324), Expect = 1.396e-29
Identity = 101/279 (36.20%), Postives = 149/279 (53.41%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPN----DSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEK-------RKENPLSDVC-KVDKKSHTKFQ------KCFIF----------------------------KEDINRSQLYGWSVPRDLLQSSVSS------NVPIPV 1656
             G+GRE+EN+I EN +L+ETKNALNIVK+DLI K+D LT E D+L+  L++    ++ L+ +   +E+E++  R + ED + K ++ D+ +      KRFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR++P      + K +S I +F          S++ T +K       +   P S V   V K+S T  Q      K F F                            KED  R Q +GWS+P+   Q +         N+P+PV
Sbjct:  390 LGMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAM----QEKKRSSIWQFVPTRFSRLFSSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYRQVKAHVQKED-GRVQAFGWSLPQKYKQVTNGQGENKMKNLPVPV 663          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Human
Match: MAPK8IP3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:HGNC Symbol;Acc:HGNC:6884])

HSP 1 Score: 136.346 bits (342), Expect = 9.592e-32
Identity = 100/304 (32.89%), Postives = 154/304 (50.66%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPND----------------SKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL----------KPDEESN-------TLTEEKRKEN---PLS-----------DVCKVDKKSHTKFQKCFIFKEDI----NRSQLYGWSVPRDLLQSSVSS--------NVPIPVGSHSILE--PKDSIICVT 1704
            FG+G+E+ N++ EN +L+ETKNALN+VK+DLI K+D L+ E ++LR  L++    ++ L+ RI  +E+E+K  R ++E   ++ E  +E  D                 +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+HP      + K +S I +FF  L           +P    N       T    +R+ +   P+S           D C    +   K ++    +E +     R Q  GWS+P    Q S +         NVP+PV    ++E  P   + C  
Sbjct:  422 FGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELK--RVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSV----QEKKKSTIWQFFSRLFSSSSSPPPAKRPYPSVNIHYKSPTTAGFSQRRNHAMCPISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAA 719          

HSP 2 Score: 136.346 bits (342), Expect = 1.128e-31
Identity = 77/161 (47.83%), Postives = 109/161 (67.70%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +A  IYREFERL+  YD  VVK LMPL+V VLENL+ +      +++E+ELLREDN  L+ QY++EK+ RR  EEK +  E   E EKK    ++E+ E   R LELK++N  D + RLEE+E E KKEY  LH+R+T++ + + + +ER K+
Sbjct:   24 VMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKM 184          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 241.121 bits (614), Expect = 2.951e-65
Identity = 212/620 (34.19%), Postives = 318/620 (51.29%), Query Frame = 1
Query:   70 YEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK-LSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYK--------RYAQIDNYDLDLLEQTLSADWKD--------SAR--PECAADIIKENFDG-QTEPNVLIDRSLETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREI---DLKARINSIEQEIKDLRHQNEDFKSKLENADEPND-SKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL-------------KPDEESNTLTEEKRKENP--LSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSIL--EPKDSIICVTKSPSMECSDE-FLWIIVERPVRDGSAYYLAQFSL 1803
            Y   G PDE+   MS+KVQ+MA+ IYRE E +++ +    VK LMPL+V VLE L+     +     E+E+L+EDN  L  QY++EK+ R+  E+K + +E T   + K   +KIE+LE+ +R+LELK++NA D+  RLEE+E EQK E+ +LHERY  + + H D +ER K L G+    L+Q   +        MGM ++   D ++ +           Q    D++L     + DW+D        S R  P+ +AD +       +  P        +++    DE TS D   PK        D             G+GRE+EN+IKEN EL++ KNALNIVK+DLI ++D L SEN +LR   D N +R++    ++ +I   E+EIK L+ +  + +++ E  D P    KRFTR EM  +L +RN +KEK +EL+E++++TEM RA +         + KS  GI EFF  LL             +       +T      +P  +S+    +++   K  +  + KED  R + YGWS+P   +++ VSS VPIPV    +L  EP   I C T        DE   WI+       G   Y A  S+
Sbjct:   25 YGGPGSPDEHRT-MSDKVQTMASAIYRELETMIKVHGEDGVKTLMPLVVNVLEALDLAYLERDEQTAELEMLKEDNEQLQTQYEREKALRKQTEQKYIEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERYNTLLRTHVDHMERTKYLMGSEKFELMQNMPLPNMQLRNKMGMAAS--VDASSIRGVSDLISAHMTQSTTMDVNLANHITNEDWQDEFSSDIEPSPRDIPQSSADALTSPITTKEPTPKREAASPKQSEEEEADETTSVD---PKENNDLLGADLT-----------GMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILR---DENLSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEEDDVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESIKWTEMQRAKKMQQQQQNVNQKKS-GGIWEFFSSLLGDSVTPPASSRGNRASSSRGKMTRSVEYIDPDMISERRAAERREQYKLVREHVKKED-GRIEAYGWSLPN--VEAEVSS-VPIPVCCRPLLDNEPSLKIWCATGVVLRGGRDERGQWIV-------GDPIYFAPASM 612          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 240.736 bits (613), Expect = 3.616e-65
Identity = 212/620 (34.19%), Postives = 318/620 (51.29%), Query Frame = 1
Query:   70 YEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK-LSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYK--------RYAQIDNYDLDLLEQTLSADWKD--------SAR--PECAADIIKENFDG-QTEPNVLIDRSLETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREI---DLKARINSIEQEIKDLRHQNEDFKSKLENADEPND-SKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL-------------KPDEESNTLTEEKRKENP--LSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSIL--EPKDSIICVTKSPSMECSDE-FLWIIVERPVRDGSAYYLAQFSL 1803
            Y   G PDE+   MS+KVQ+MA+ IYRE E +++ +    VK LMPL+V VLE L+     +     E+E+L+EDN  L  QY++EK+ R+  E+K + +E T   + K   +KIE+LE+ +R+LELK++NA D+  RLEE+E EQK E+ +LHERY  + + H D +ER K L G+    L+Q   +        MGM ++   D ++ +           Q    D++L     + DW+D        S R  P+ +AD +       +  P        +++    DE TS D   PK        D             G+GRE+EN+IKEN EL++ KNALNIVK+DLI ++D L SEN +LR   D N +R++    ++ +I   E+EIK L+ +  + +++ E  D P    KRFTR EM  +L +RN +KEK +EL+E++++TEM RA +         + KS  GI EFF  LL             +       +T      +P  +S+    +++   K  +  + KED  R + YGWS+P   +++ VSS VPIPV    +L  EP   I C T        DE   WI+       G   Y A  S+
Sbjct:   25 YGGPGSPDEHRT-MSDKVQTMASAIYRELETMIKVHGEDGVKTLMPLVVNVLEALDLAYLERDEQTAELEMLKEDNEQLQTQYEREKALRKQTEQKYIEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERYNTLLRTHVDHMERTKYLMGSEKFELMQNMPLPNMQLRNKMGMAAS--VDASSIRGVSDLISAHMTQSTTMDVNLANHITNEDWQDEFSSDIEPSPRDIPQSSADALTSPITTKEPTPKREAASPKQSEEEEADETTSVD---PKENNDLLGADLT-----------GMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILR---DENLSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEEDDVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESIKWTEMQRAKKMQQQQQNVNQKKS-GGIWEFFSSLLGDSVTPPASSRGNRASSSRGKMTRSVEYIDPDMISERRAAERREQYKLVREHVKKED-GRIEAYGWSLPN--VEAEVSS-VPIPVCCRPLLDNEPSLKIWCATGVVLRGGRDERGQWIV-------GDPIYFAPASM 612          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 238.039 bits (606), Expect = 2.597e-64
Identity = 212/639 (33.18%), Postives = 323/639 (50.55%), Query Frame = 1
Query:   70 YEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK-LSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYK--------RYAQIDNYDLDLLEQTLSADWKDSARPE---CAADIIKENFDGQTEPNVL-------------------IDRSLETDSNIFDELTSDDMKSPKS--------PTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREI---DLKARINSIEQEIKDLRHQNEDFKSKLENADEPND-SKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL-------------KPDEESNTLTEEKRKENP--LSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSIL--EPKDSIICVTKSPSMECSDE-FLWIIVERPVRDGSAYYLAQFSL 1803
            Y   G PDE+   MS+KVQ+MA+ IYRE E +++ +    VK LMPL+V VLE L+     +     E+E+L+EDN  L  QY++EK+ R+  E+K + +E T   + K   +KIE+LE+ +R+LELK++NA D+  RLEE+E EQK E+ +LHERY  + + H D +ER K L G+    L+Q   +        MGM ++   D ++ +           Q    D++L     + DW+D    +      DI + + D  T P                       D +   D    ++L   D+   +S        P  +   +  +D D  +D   G+GRE+EN+IKEN EL++ KNALNIVK+DLI ++D L SEN +LR   D N +R++    ++ +I   E+EIK L+ +  + +++ E  D P    KRFTR EM  +L +RN +KEK +EL+E++++TEM RA +         + KS  GI EFF  LL             +       +T      +P  +S+    +++   K  +  + KED  R + YGWS+P   +++ VSS VPIPV    +L  EP   I C T        DE   WI+       G   Y A  S+
Sbjct:   25 YGGPGSPDEHRT-MSDKVQTMASAIYRELETMIKVHGEDGVKTLMPLVVNVLEALDLAYLERDEQTAELEMLKEDNEQLQTQYEREKALRKQTEQKYIEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERYNTLLRTHVDHMERTKYLMGSEKFELMQNMPLPNMQLRNKMGMAAS--VDASSIRGVSDLISAHMTQSTTMDVNLANHITNEDWQDEFSSDIEPSPRDIPQSSADALTSPITTKEPTPKREAASPKQSEEEEADETTSVDPKENNDLLGADLTDDESDWNGLGLIPRRHRPNEMLDDDDTSDDGSLGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILR---DENLSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEEDDVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESIKWTEMQRAKKMQQQQQNVNQKKS-GGIWEFFSSLLGDSVTPPASSRGNRASSSRGKMTRSVEYIDPDMISERRAAERREQYKLVREHVKKED-GRIEAYGWSLPN--VEAEVSS-VPIPVCCRPLLDNEPSLKIWCATGVVLRGGRDERGQWIV-------GDPIYFAPASM 645          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 233.417 bits (594), Expect = 6.592e-63
Identity = 208/611 (34.04%), Postives = 317/611 (51.88%), Query Frame = 1
Query:  109 MSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK-LSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYK--------RYAQIDNYDLDLLEQTLSADWKD--------SAR--PECAADIIKENFDG-QTEPNVLIDRSLETDSNIFDELTSDDMKSP----KSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREI---DLKARINSIEQEIKDLRHQNEDFKSKLENADEPND-SKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL-------------KPDEESNTLTEEKRKENP--LSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSIL--EPKDSIICVTKSPSMECSDE-FLWIIVERPVRDGSAYYLAQFSL 1803
            MS+KVQ+MA+ IYRE E +++ +    VK LMPL+V VLE L+     +     E+E+L+EDN  L  QY++EK+ R+  E+K + +E T   + K   +KIE+LE+ +R+LELK++NA D+  RLEE+E EQK E+ +LHERY  + + H D +ER K L G+    L+Q   +        MGM ++   D ++ +           Q    D++L     + DW+D        S R  P+ +AD +       +  P        +++    DE TS D K       +     + D    +   ND+  G+GRE+EN+IKEN EL++ KNALNIVK+DLI ++D L SEN +LR   D N +R++    ++ +I   E+EIK L+ +  + +++ E  D P    KRFTR EM  +L +RN +KEK +EL+E++++TEM RA +         + KS  GI EFF  LL             +       +T      +P  +S+    +++   K  +  + KED  R + YGWS+P   +++ VSS VPIPV    +L  EP   I C T        DE   WI+       G   Y A  S+
Sbjct:    1 MSDKVQTMASAIYRELETMIKVHGEDGVKTLMPLVVNVLEALDLAYLERDEQTAELEMLKEDNEQLQTQYEREKALRKQTEQKYIEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERYNTLLRTHVDHMERTKYLMGSEKFELMQNMPLPNMQLRNKMGMAAS--VDASSIRGVSDLISAHMTQSTTMDVNLANHITNEDWQDEFSSDIEPSPRDIPQSSADALTSPITTKEPTPKREAASPKQSEEEEADETTSVDPKENNDLLGADLTGNLVDPAEFASAVNDTFIGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILR---DENLSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEEDDVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESIKWTEMQRAKKMQQQQQNVNQKKS-GGIWEFFSSLLGDSVTPPASSRGNRASSSRGKMTRSVEYIDPDMISERRAAERREQYKLVREHVKKED-GRIEAYGWSLPN--VEAEVSS-VPIPVCCRPLLDNEPSLKIWCATGVVLRGGRDERGQWIV-------GDPIYFAPASM 594          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Celegans
Match: unc-16 (JNK-interacting protein [Source:UniProtKB/Swiss-Prot;Acc:P34609])

HSP 1 Score: 219.164 bits (557), Expect = 3.312e-61
Identity = 177/483 (36.65%), Postives = 269/483 (55.69%), Query Frame = 1
Query:   70 YEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK-LSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYK--------RYAQIDNYDLDLLEQTLSADWKD--------SAR--PECAADIIKENFDG-QTEPNVLIDRSLETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREI---DLKARINSIEQEIKDLRHQNEDFKSKLENADEPND-SKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
            Y   G PDE+   MS+KVQ+MA+ IYRE E +++ +    VK LMPL+V VLE L+     +     E+E+L+EDN  L  QY++EK+ R+  E+K + +E T   + K   +KIE+LE+ +R+LELK++NA D+  RLEE+E EQK E+ +LHERY  + + H D +ER K L G+    L+Q   +        MGM ++   D ++ +           Q    D++L     + DW+D        S R  P+ +AD +       +  P        +++    DE TS D K  ++  +       N  D    +  G+GRE+EN+IKEN EL++ KNALNIVK+DLI ++D L SEN +LR   D N +R++    ++ +I   E+EIK L+ +  + +++ E  D P    KRFTR EM  +L +RN +KEK +EL+E++++TEM RA +         + KS  GI EFF  LL
Sbjct:   25 YGGPGSPDEHRT-MSDKVQTMASAIYRELETMIKVHGEDGVKTLMPLVVNVLEALDLAYLERDEQTAELEMLKEDNEQLQTQYEREKALRKQTEQKYIEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERYNTLLRTHVDHMERTKYLMGSEKFELMQNMPLPNMQLRNKMGMAAS--VDASSIRGVSDLISAHMTQSTTMDVNLANHITNEDWQDEFSSDIEPSPRDIPQSSADALTSPITTKEPTPKREAASPKQSEEEEADETTSVDPK--ENNDLLGADLTGNLVDPAEFASAGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILR---DENLSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEEDDVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESIKWTEMQRAKKMQQQQQNVNQKKS-GGIWEFFSSLL 498          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0332790)

HSP 1 Score: 256.529 bits (654), Expect = 3.471e-70
Identity = 192/512 (37.50%), Postives = 289/512 (56.45%), Query Frame = 1
Query:   49 TETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL---SGNRNMSLLQK---------HSISKFAKPLDMGMESNE------------VCDEANYKRYAQIDNYDLDLLEQTLS-ADWKDSARPECAADIIKENFDGQTEPNVL--IDRSL-----ETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXE--FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEP-NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTE 1479
             ET+Y         ++NN++MSEKVQ +A  IY+EFER++  YD  VVKNLMPL+V VLE L+   +     D+E+ELLREDN  L+ QY++EKS R+  E+K++  E   E E K    ++E++E+ +R+LELK +N+ ++  RLEE+E + KKEY KLHERYT++FK H D +ER K+   S +  MS   +         + +++ + P+  G  S E            V  +++      + N +LD L  TL      D+ + +  A   +        PNV   + RS       +D+N++ EL+  D +  +   I             + ++  FG+G+E+EN+I EN EL+ TKNALNIVKDDLI K+D LT E +++R  L++       L+ RI+ +E E+K  + Q +   ++ E  D P    KRFTRVEMA++L ERNQ+KE+ +ELQEA+R TE++RASR   +       KS+  I ++F  L  P   SN  TE
Sbjct:   18 AETVYGT-------EDNNMVMSEKVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTKMLMGSTHSQMSTASERMDVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVGSQSDDSGPPSLQN-ELDNLSGTLERGAATDALQQQHHATSPQSPDSSPVVPNVPTNVGRSTTKKEQRSDNNLYQELSFQDNEESEENEIVTGSWVHPGEYASSANDNYFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNL----DRKSKQSIWKYFSNLFTP---SNRPTE 514          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0332792)

HSP 1 Score: 256.144 bits (653), Expect = 4.081e-70
Identity = 192/512 (37.50%), Postives = 289/512 (56.45%), Query Frame = 1
Query:   49 TETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL---SGNRNMSLLQK---------HSISKFAKPLDMGMESNE------------VCDEANYKRYAQIDNYDLDLLEQTLS-ADWKDSARPECAADIIKENFDGQTEPNVL--IDRSL-----ETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXE--FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEP-NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTE 1479
             ET+Y         ++NN++MSEKVQ +A  IY+EFER++  YD  VVKNLMPL+V VLE L+   +     D+E+ELLREDN  L+ QY++EKS R+  E+K++  E   E E K    ++E++E+ +R+LELK +N+ ++  RLEE+E + KKEY KLHERYT++FK H D +ER K+   S +  MS   +         + +++ + P+  G  S E            V  +++      + N +LD L  TL      D+ + +  A   +        PNV   + RS       +D+N++ EL+  D +  +   I             + ++  FG+G+E+EN+I EN EL+ TKNALNIVKDDLI K+D LT E +++R  L++       L+ RI+ +E E+K  + Q +   ++ E  D P    KRFTRVEMA++L ERNQ+KE+ +ELQEA+R TE++RASR   +       KS+  I ++F  L  P   SN  TE
Sbjct:   18 AETVYGT-------EDNNMVMSEKVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTKMLMGSTHSQMSTASERMDVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVGSQSDDSGPPSLQN-ELDNLSGTLERGAATDALQQQHHATSPQSPDSSPVVPNVPTNVGRSTTKKEQRSDNNLYQELSFQDNEESEENEIVTGSWVHPGEYASSANDNYFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNL----DRKSKQSIWKYFSNLFTP---SNRPTE 514          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0332791)

HSP 1 Score: 255.758 bits (652), Expect = 5.664e-70
Identity = 192/512 (37.50%), Postives = 289/512 (56.45%), Query Frame = 1
Query:   49 TETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL---SGNRNMSLLQK---------HSISKFAKPLDMGMESNE------------VCDEANYKRYAQIDNYDLDLLEQTLS-ADWKDSARPECAADIIKENFDGQTEPNVL--IDRSL-----ETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXE--FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEP-NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTE 1479
             ET+Y         ++NN++MSEKVQ +A  IY+EFER++  YD  VVKNLMPL+V VLE L+   +     D+E+ELLREDN  L+ QY++EKS R+  E+K++  E   E E K    ++E++E+ +R+LELK +N+ ++  RLEE+E + KKEY KLHERYT++FK H D +ER K+   S +  MS   +         + +++ + P+  G  S E            V  +++      + N +LD L  TL      D+ + +  A   +        PNV   + RS       +D+N++ EL+  D +  +   I             + ++  FG+G+E+EN+I EN EL+ TKNALNIVKDDLI K+D LT E +++R  L++       L+ RI+ +E E+K  + Q +   ++ E  D P    KRFTRVEMA++L ERNQ+KE+ +ELQEA+R TE++RASR   +       KS+  I ++F  L  P   SN  TE
Sbjct:   18 AETVYGT-------EDNNMVMSEKVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTKMLMGSTHSQMSTASERMDVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVGSQSDDSGPPSLQN-ELDNLSGTLERGAATDALQQQHHATSPQSPDSSPVVPNVPTNVGRSTTKKEQRSDNNLYQELSFQDNEESEENEIVTGSWVHPGEYASSANDNYFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNL----DRKSKQSIWKYFSNLFTP---SNRPTE 514          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0332787)

HSP 1 Score: 253.062 bits (645), Expect = 4.089e-69
Identity = 191/510 (37.45%), Postives = 287/510 (56.27%), Query Frame = 1
Query:   49 TETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL---SGNRNMSLLQK---------HSISKFAKPLDMGMESNE------------VCDEANYKRYAQIDNYDLDLLEQTLS-ADWKDSARPECAADIIKENFDGQTEPNVL--IDRSL-----ETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEP-NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTE 1479
             ET+Y         ++NN++MSEKVQ +A  IY+EFER++  YD  VVKNLMPL+V VLE L+   +     D+E+ELLREDN  L+ QY++EKS R+  E+K++  E   E E K    ++E++E+ +R+LELK +N+ ++  RLEE+E + KKEY KLHERYT++FK H D +ER K+   S +  MS   +         + +++ + P+  G  S E            V  +++      + N +LD L  TL      D+ + +  A   +        PNV   + RS       +D+N++ EL+  D +  +   I       +       +  G+G+E+EN+I EN EL+ TKNALNIVKDDLI K+D LT E +++R  L++       L+ RI+ +E E+K  + Q +   ++ E  D P    KRFTRVEMA++L ERNQ+KE+ +ELQEA+R TE++RASR   +       KS+  I ++F  L  P   SN  TE
Sbjct:   18 AETVYGT-------EDNNMVMSEKVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTKMLMGSTHSQMSTASERMDVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVGSQSDDSGPPSLQN-ELDNLSGTLERGAATDALQQQHHATSPQSPDSSPVVPNVPTNVGRSTTKKEQRSDNNLYQELSFQDNEESEENEIV----TGSWVHPGEYASSGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNL----DRKSKQSIWKYFSNLFTP---SNRPTE 508          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Fly
Match: syd (gene:FBgn0024187 transcript:FBtr0332789)

HSP 1 Score: 253.062 bits (645), Expect = 4.343e-69
Identity = 191/510 (37.45%), Postives = 287/510 (56.27%), Query Frame = 1
Query:   49 TETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL---SGNRNMSLLQK---------HSISKFAKPLDMGMESNE------------VCDEANYKRYAQIDNYDLDLLEQTLS-ADWKDSARPECAADIIKENFDGQTEPNVL--IDRSL-----ETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEP-NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTE 1479
             ET+Y         ++NN++MSEKVQ +A  IY+EFER++  YD  VVKNLMPL+V VLE L+   +     D+E+ELLREDN  L+ QY++EKS R+  E+K++  E   E E K    ++E++E+ +R+LELK +N+ ++  RLEE+E + KKEY KLHERYT++FK H D +ER K+   S +  MS   +         + +++ + P+  G  S E            V  +++      + N +LD L  TL      D+ + +  A   +        PNV   + RS       +D+N++ EL+  D +  +   I       +       +  G+G+E+EN+I EN EL+ TKNALNIVKDDLI K+D LT E +++R  L++       L+ RI+ +E E+K  + Q +   ++ E  D P    KRFTRVEMA++L ERNQ+KE+ +ELQEA+R TE++RASR   +       KS+  I ++F  L  P   SN  TE
Sbjct:   18 AETVYGT-------EDNNMVMSEKVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTKMLMGSTHSQMSTASERMDVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVGSQSDDSGPPSLQN-ELDNLSGTLERGAATDALQQQHHATSPQSPDSSPVVPNVPTNVGRSTTKKEQRSDNNLYQELSFQDNEESEENEIV----TGSWVHPGEYASSGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNL----DRKSKQSIWKYFSNLFTP---SNRPTE 508          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Zebrafish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:ZFIN;Acc:ZDB-GENE-090303-6])

HSP 1 Score: 141.739 bits (356), Expect = 1.498e-33
Identity = 77/169 (45.56%), Postives = 112/169 (66.27%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQ------------NEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
            FG+G+E+EN++ EN++L+ETKNALNIVK+DLI K+D L+SE ++LR  L+S    +  +  R+  +E+E+K LR +             ED+ S L++       +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+ P     P  K +S I +FF  L 
Sbjct:  400 FGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSSEQEVLREELESVKQSKTKVDQRVKELEEELKRLRAEALGASQDSKDEGGEDYSSPLQDDVTMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPPL---PE-KKKSIIWQFFARLF 564          

HSP 2 Score: 134.035 bits (336), Expect = 3.670e-31
Identity = 74/161 (45.96%), Postives = 111/161 (68.94%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +A+ IY+EFERL+++YD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E +KK     +E LE   + LELKS+N  D + RLEE+E + KKEY  LH+R+T++ + + + +ER KL
Sbjct:   18 VMSERVTGLASSIYQEFERLIKTYDEEVVKELMPLVVNVLENLDSVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEADKKDLQTTVETLELQAKQLELKSKNYADQISRLEERESDMKKEYNALHQRHTEMIQTYVEHIERSKL 178          

HSP 3 Score: 53.1434 bits (126), Expect = 2.229e-6
Identity = 49/203 (24.14%), Postives = 97/203 (47.78%), Query Frame = 1
Query: 2134 LATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMS--HSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDIIESIDKCSKFRFSFPIITE---DRDRLWLGSDCGFIVC--LSKRQLLNEGQ 2721
            L +I L  SV ++ + +GR+++A  DG L +F  +     W++    ++++   H S I  +A   D   +W G+  + +VI    +++  SF  +    E  + ++  I      D +W+S+    TL  Y +++++     D    +  ++ +     K  FSF  IT      +RLW+G+  G I+   L++  +L+ GQ
Sbjct:  976 LHSIKLKDSVLSLVHVKGRVLVALADGTLAIFH-RSEDGQWDLSNYHLMDLGRPHHS-IRCMAVVHD--KVWCGNKNKIHVIQPKSMQIEKSFDAHPR-KESQVRQLAWI-----GDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGT----GKLGFSFVRITALLIGGNRLWVGTGNGVIISIPLTETVVLHRGQ 1164          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Zebrafish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:ZFIN;Acc:ZDB-GENE-090303-6])

HSP 1 Score: 141.354 bits (355), Expect = 1.761e-33
Identity = 77/169 (45.56%), Postives = 112/169 (66.27%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQ------------NEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
            FG+G+E+EN++ EN++L+ETKNALNIVK+DLI K+D L+SE ++LR  L+S    +  +  R+  +E+E+K LR +             ED+ S L++       +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+ P     P  K +S I +FF  L 
Sbjct:  380 FGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSSEQEVLREELESVKQSKTKVDQRVKELEEELKRLRAEALGASQDSKDEGGEDYSSPLQDDVTMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPPL---PE-KKKSIIWQFFARLF 544          

HSP 2 Score: 134.035 bits (336), Expect = 3.639e-31
Identity = 74/161 (45.96%), Postives = 111/161 (68.94%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +A+ IY+EFERL+++YD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E +KK     +E LE   + LELKS+N  D + RLEE+E + KKEY  LH+R+T++ + + + +ER KL
Sbjct:   17 VMSERVTGLASSIYQEFERLIKTYDEEVVKELMPLVVNVLENLDSVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEADKKDLQTTVETLELQAKQLELKSKNYADQISRLEERESDMKKEYNALHQRHTEMIQTYVEHIERSKL 177          

HSP 3 Score: 53.1434 bits (126), Expect = 2.150e-6
Identity = 49/203 (24.14%), Postives = 97/203 (47.78%), Query Frame = 1
Query: 2134 LATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMS--HSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDIIESIDKCSKFRFSFPIITE---DRDRLWLGSDCGFIVC--LSKRQLLNEGQ 2721
            L +I L  SV ++ + +GR+++A  DG L +F  +     W++    ++++   H S I  +A   D   +W G+  + +VI    +++  SF  +    E  + ++  I      D +W+S+    TL  Y +++++     D    +  ++ +     K  FSF  IT      +RLW+G+  G I+   L++  +L+ GQ
Sbjct:  962 LHSIKLKDSVLSLVHVKGRVLVALADGTLAIFH-RSEDGQWDLSNYHLMDLGRPHHS-IRCMAVVHD--KVWCGNKNKIHVIQPKSMQIEKSFDAHPR-KESQVRQLAWI-----GDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGT----GKLGFSFVRITALLIGGNRLWVGTGNGVIISIPLTETVVLHRGQ 1150          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Zebrafish
Match: SPAG9 (sperm associated antigen 9b [Source:NCBI gene;Acc:100333761])

HSP 1 Score: 130.183 bits (326), Expect = 4.706e-30
Identity = 90/271 (33.21%), Postives = 142/271 (52.40%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPN----DSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFV-------------------------------LEPRIKSQSGIMEFFRGLLKPDEESNT---LTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSS------NVPIPV 1656
             G+GRE+E++I EN +L+ETKNALN+VK+DLI ++D L  E D+L+  ++     +  L+ R   +E E+K +R + E+ K + +  D+ +      KRFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RAS+++P                                  + P +K +S  +        P ++S     L EE   E  +S   +  K++  +  K  + KED  R Q YGWS+P     ++         N+P+PV
Sbjct:  235 LGMGREVEHLIHENTQLLETKNALNVVKNDLIARVDELVCEKDVLQGEIEVLKQTKDKLEERNKELEDELKKVRAEMEETKVETKGDDDSDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASKENPALSEKKKSTSPLSSPQSKKPEAPVNMKYNAPSSHVVPSVKKRSSTLAQL-----PSDKSKAFDFLNEEAEVETVVSR--REQKRAQYRQVKAHVQKED-GRMQAYGWSLPPKYKVANGGQADSKIKNLPVPV 497          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Zebrafish
Match: SPAG9 (sperm associated antigen 9b [Source:NCBI gene;Acc:100333761])

HSP 1 Score: 129.028 bits (323), Expect = 1.220e-29
Identity = 90/271 (33.21%), Postives = 142/271 (52.40%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPN----DSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFV-------------------------------LEPRIKSQSGIMEFFRGLLKPDEESNT---LTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSS------NVPIPV 1656
             G+GRE+E++I EN +L+ETKNALN+VK+DLI ++D L  E D+L+  ++     +  L+ R   +E E+K +R + E+ K + +  D+ +      KRFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RAS+++P                                  + P +K +S  +        P ++S     L EE   E  +S   +  K++  +  K  + KED  R Q YGWS+P     ++         N+P+PV
Sbjct:  382 LGMGREVEHLIHENTQLLETKNALNVVKNDLIARVDELVCEKDVLQGEIEVLKQTKDKLEERNKELEDELKKVRAEMEETKVETKGDDDSDVPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASKENPALSEKKKSTSPLSSPQSKKPEAPVNMKYNAPSSHVVPSVKKRSSTLAQL-----PSDKSKAFDFLNEEAEVETVVSR--REQKRAQYRQVKAHVQKED-GRMQAYGWSLPPKYKVANGGQADSKIKNLPVPV 644          

HSP 2 Score: 127.487 bits (319), Expect = 3.122e-29
Identity = 72/163 (44.17%), Postives = 111/163 (68.10%), Query Frame = 1
Query:   97 NNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK 585
            ++ +MSE+V  +A+ IYREFER++  YD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EE+ +  E + E +KK    +++ LEA  R +E K++N  D + RLEE+E E KKEY  LH+R+T++   + + LER K
Sbjct:   15 SSAMMSERVSGLASSIYREFERMIGRYDEDVVKELMPLVVAVLENLDSVFAENQEHEVELELLKEDNEQLVTQYEREKALRKNAEERYIEYEDSQEQDKKALQTRVQLLEAQTRQMEFKTKNCTDQIGRLEEREAELKKEYNALHQRHTEMIHSYMEHLERSK 177          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Zebrafish
Match: spag9a (sperm associated antigen 9a [Source:ZFIN;Acc:ZDB-GENE-070820-7])

HSP 1 Score: 129.028 bits (323), Expect = 1.253e-29
Identity = 72/164 (43.90%), Postives = 112/164 (68.29%), Query Frame = 1
Query:   97 NNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
             + +MSE++  +AN IYREFERL+  YD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EE+ +  E + E EKK     +E+L ++ R LELK +N +D + RLEE+E E K+EY  LH R+T++   + + +ER+++
Sbjct:   15 TSAVMSERISGLANSIYREFERLIRKYDEDVVKELMPLVVAVLENLDTVFAENQEHEVELELLKEDNEQLVTQYEREKALRKHTEERFIEFEDSQEQEKKDLQNHLESLGSHSRQLELKIKNYSDQISRLEEREAELKREYNSLHLRHTEMIHNYMEHVERIRM 178          

HSP 2 Score: 107.842 bits (268), Expect = 3.563e-23
Identity = 93/290 (32.07%), Postives = 155/290 (53.45%), Query Frame = 1
Query:  979 GVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPND-----SKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPR-----------------------IKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCK--VD----------KKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSS-----NVPIPVGSHSILEPKDS---IICVT 1704
            G+ RE+EN+I+EN +L+ETKNALN+VK+DLI ++D L+ E ++L+  LD+    +  L+ +   +E+E+K ++ + E+ K      ++ +D      +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR++ +   + R                           S +      ++K   +SNT ++  R+++   D  K  VD          K++  +  K  + KED  R   +GWS+P     ++        N+P+PV     LE KD+   ++C T
Sbjct:  411 GMSREVENLIQENVQLLETKNALNVVKNDLIARVDELSCEKEVLQGELDAVLQAKAKLEEKYKELEEELKKIKTETEEAKQNNNKEEDESDVPTAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENSEVAEKKRSSIRQFFSRLFSSSSSAASSSSSRALPSNVKYNPPSIMK---KSNTFSQFPREKSKAFDFLKEEVDSSGSLSRREQKRAQYQHVKAHMQKED-GRVTAHGWSLPGKYKVANGGPVENKINLPVPV-CLKPLEQKDASMKLLCAT 695          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 137.887 bits (346), Expect = 3.047e-32
Identity = 86/198 (43.43%), Postives = 123/198 (62.12%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKLS---------GNRNMSLLQKHSISKFAKPLDMGMESN 672
            +MSE+V  +AN IYREFERL+  YD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    ++E LE   R +ELK++N  D + RLEE+E E KKEY  LH+R+T++ + + + +ER KL          G   MS   + S++  A P   G +SN
Sbjct:   20 VMSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSKLQQVAGNSQSDGGDEMSESGQSSVA--ATPSTTGTKSN 215          

HSP 2 Score: 135.191 bits (339), Expect = 1.872e-31
Identity = 70/168 (41.67%), Postives = 112/168 (66.67%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQN----EDFKSKLENADEP-------NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
             G+G+E+ N++ EN +L+ETKNALN+VK+DLI KLD LT E ++L+  L++    ++ ++ R+  +E+E+K ++ +     ++ K ++E +  P          +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+HP      + K +S I +FF  L 
Sbjct:  344 LGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEESSSPLQDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSV----QEKKKSTIWQFFSRLF 507          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 137.502 bits (345), Expect = 3.501e-32
Identity = 71/168 (42.26%), Postives = 113/168 (67.26%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQN----EDFKSKLENADEP-------NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
            FG+G+E+ N++ EN +L+ETKNALN+VK+DLI KLD LT E ++L+  L++    ++ ++ R+  +E+E+K ++ +     ++ K ++E +  P          +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+HP      + K +S I +FF  L 
Sbjct:  385 FGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEESSSPLQDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSV----QEKKKSTIWQFFSRLF 548          

HSP 2 Score: 135.191 bits (339), Expect = 1.971e-31
Identity = 77/161 (47.83%), Postives = 110/161 (68.32%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +AN IYREFERL+  YD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    ++E LE   R +ELK++N  D + RLEE+E E KKEY  LH+R+T++ + + + +ER KL
Sbjct:   21 VMSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSKL 181          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 137.502 bits (345), Expect = 3.604e-32
Identity = 71/168 (42.26%), Postives = 113/168 (67.26%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQN----EDFKSKLENADEP-------NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
            FG+G+E+ N++ EN +L+ETKNALN+VK+DLI KLD LT E ++L+  L++    ++ ++ R+  +E+E+K ++ +     ++ K ++E +  P          +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+HP      + K +S I +FF  L 
Sbjct:  377 FGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEESSSPLQDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSV----QEKKKSTIWQFFSRLF 540          

HSP 2 Score: 135.191 bits (339), Expect = 2.154e-31
Identity = 77/161 (47.83%), Postives = 110/161 (68.32%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +AN IYREFERL+  YD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    ++E LE   R +ELK++N  D + RLEE+E E KKEY  LH+R+T++ + + + +ER KL
Sbjct:   21 VMSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSKL 181          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 135.576 bits (340), Expect = 1.661e-31
Identity = 77/161 (47.83%), Postives = 110/161 (68.32%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +AN IYREFERL+  YD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    ++E LE   R +ELK++N  D + RLEE+E E KKEY  LH+R+T++ + + + +ER KL
Sbjct:   21 VMSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSKL 181          

HSP 2 Score: 129.413 bits (324), Expect = 1.276e-29
Identity = 70/171 (40.94%), Postives = 109/171 (63.74%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQN-EDFKSKLENADEPNDS-------------KRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
             G+G+E+ N++ EN +L+ETKNALN+VK+DLI KLD LT E ++L+  L++    ++ ++ R+  +E+E+K ++ +     +   E  +E   S             +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+HP      + K +S I +FF  L 
Sbjct:  406 LGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEEVGISLTCFSDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSV----QEKKKSTIWQFFSRLF 572          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Xenopus
Match: cldn2 (claudin 2 [Source:Xenbase;Acc:XB-GENE-994508])

HSP 1 Score: 135.191 bits (339), Expect = 1.947e-31
Identity = 77/161 (47.83%), Postives = 110/161 (68.32%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +AN IYREFERL+  YD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    ++E LE   R +ELK++N  D + RLEE+E E KKEY  LH+R+T++ + + + +ER KL
Sbjct:   21 VMSERVSGLANSIYREFERLIRCYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKDLQYQVETLEFQGRQMELKTKNYADQISRLEERESELKKEYNALHQRHTEMIQTYVEHIERSKL 181          

HSP 2 Score: 134.806 bits (338), Expect = 2.538e-31
Identity = 72/170 (42.35%), Postives = 114/170 (67.06%), Query Frame = 1
Query:  973 EF-GVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQN----EDFKSKLENADEP-------NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
            EF G+G+E+ N++ EN +L+ETKNALN+VK+DLI KLD LT E ++L+  L++    ++ ++ R+  +E+E+K ++ +     ++ K ++E +  P          +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+HP      + K +S I +FF  L 
Sbjct:  377 EFSGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKLDQLTGEQEVLKGELEATKQAKVKMETRVKELEEELKRVKSEAIVALQEPKEEVEESSSPLQDNIPIAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSV----QEKKKSTIWQFFSRLF 542          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Mouse
Match: Spag9 (sperm associated antigen 9 [Source:MGI Symbol;Acc:MGI:1918084])

HSP 1 Score: 142.124 bits (357), Expect = 9.879e-34
Identity = 85/195 (43.59%), Postives = 125/195 (64.10%), Query Frame = 1
Query:   88 PDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK---LSGNRNMSLLQKHSISKFAKPLDMGM 663
            P  +  +MSE+V  +A  IYREFERL+  YD  VVK LMPL+V VLENL+ +      + +E+ELLR+DN  L+ QY++EK+ R+  EEK +  E + E EKK    ++E+LE+  R LELK++N  D + RLEE+E E KKEY  LH+R+T++   + + LER K   LSG+  +     HS  +  +P+ +G+
Sbjct:   13 PGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLEAT-AHSRIRKERPISLGI 206          

HSP 2 Score: 135.576 bits (340), Expect = 1.287e-31
Identity = 68/139 (48.92%), Postives = 103/139 (74.10%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPN----DSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHP 1380
             G+GRE+EN+I EN +L+ETKNALN+VK+DLI K+D LT E D+L+  L++    ++ L+ +   +E+E++  R + ED + K ++ D+ +      KRFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR++P
Sbjct:  390 LGMGREVENLILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEDKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENP 528          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Mouse
Match: Spag9 (sperm associated antigen 9 [Source:MGI Symbol;Acc:MGI:1918084])

HSP 1 Score: 139.043 bits (349), Expect = 8.370e-33
Identity = 69/139 (49.64%), Postives = 104/139 (74.82%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPN----DSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHP 1380
            FG+GRE+EN+I EN +L+ETKNALN+VK+DLI K+D LT E D+L+  L++    ++ L+ +   +E+E++  R + ED + K ++ D+ +      KRFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR++P
Sbjct:  252 FGMGREVENLILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEDKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENP 390          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Mouse
Match: Mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:MGI Symbol;Acc:MGI:1353598])

HSP 1 Score: 139.043 bits (349), Expect = 9.007e-33
Identity = 100/297 (33.67%), Postives = 150/297 (50.51%), Query Frame = 1
Query:  973 EF-GVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSK-------RFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLK---------------------------PDEESNTLTEEKRKENPLS----DVCKVDKKSHTKFQKCFIFKE----DINRSQLYGWSVPRDLLQSSVSS--------NVPIPVGSHSILE--PKDSIICVT 1704
            EF G+G+E+ N++ EN +L+ETKNALN+VK+DLI K+D L+ E ++L+  L++    ++ L+ RI  +E+E+K  R ++E   ++ E  +E  D K       RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+HP      + K +S I +FF  L                                 S+ L +      PL     D C    +   K ++    +E    D  R Q  GWS+P    Q S +         NVP+PV    ++E  P   + C  
Sbjct:  407 EFSGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELK--RVKSEAVTARREPREEVEDDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSV----QEKKKSTIWQFFSRLFSSSSSPPPAKRSYPSVNIHYKSPTAAGFSQRRSHALCQISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPSTKLWCAA 697          

HSP 2 Score: 136.732 bits (343), Expect = 5.293e-32
Identity = 76/161 (47.20%), Postives = 109/161 (67.70%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +A  IYREFERL+  YD  VVK LMPL+V VLENL+ +      +++E+ELLREDN  L+ QY++EK+ R+  EEK +  E   E EKK    ++E+ E   R LELK++N  D + RLEE+E E KKEY  LH+R+T++ + + + +ER K+
Sbjct:   24 VMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKM 184          

HSP 3 Score: 53.1434 bits (126), Expect = 2.512e-6
Identity = 47/202 (23.27%), Postives = 95/202 (47.03%), Query Frame = 1
Query: 2134 LATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHS-SPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDIIESIDKCSKFRFSFPIITE---DRDRLWLGSDCGFIVC--LSKRQLLNEGQ 2721
            L +I L  SV ++ + +GR+++A  DG L +F  +     W++    ++++ H    I  +A   D   +W G   + +VI    +++  SF  +    E  + ++  I      D +W+S+    TL  Y +++++     D    +  ++ +     K  FSF  IT      +RLW+G+  G ++   L++  +L+ GQ
Sbjct:  979 LHSIKLKDSVLSLVHVKGRVLVALADGTLAIFH-RGEDGQWDLSNYHLMDLGHPHHSIRCMAVVND--RVWCGYKNKVHVIQPKTMQIEKSFDAHPR-RESQVRQLAWI-----GDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGT----GKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQ 1167          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Mouse
Match: Mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:MGI Symbol;Acc:MGI:1353598])

HSP 1 Score: 137.887 bits (346), Expect = 2.604e-32
Identity = 98/304 (32.24%), Postives = 149/304 (49.01%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPND----------------SKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLK---------------------------PDEESNTLTEEKRKENPLS----DVCKVDKKSHTKFQKCFIFKE----DINRSQLYGWSVPRDLLQSSVSS--------NVPIPVGSHSILE--PKDSIICVT 1704
            FG+G+E+ N++ EN +L+ETKNALN+VK+DLI K+D L+ E ++L+  L++    ++ L+ RI  +E+E+K  R ++E   ++ E  +E  D                 +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+HP      + K +S I +FF  L                                 S+ L +      PL     D C    +   K ++    +E    D  R Q  GWS+P    Q S +         NVP+PV    ++E  P   + C  
Sbjct:  415 FGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELK--RVKSEAVTARREPREEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSV----QEKKKSTIWQFFSRLFSSSSSPPPAKRSYPSVNIHYKSPTAAGFSQRRSHALCQISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPSTKLWCAA 712          

HSP 2 Score: 136.732 bits (343), Expect = 5.074e-32
Identity = 76/161 (47.20%), Postives = 109/161 (67.70%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +A  IYREFERL+  YD  VVK LMPL+V VLENL+ +      +++E+ELLREDN  L+ QY++EK+ R+  EEK +  E   E EKK    ++E+ E   R LELK++N  D + RLEE+E E KKEY  LH+R+T++ + + + +ER K+
Sbjct:   24 VMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKM 184          

HSP 3 Score: 52.7582 bits (125), Expect = 2.694e-6
Identity = 47/202 (23.27%), Postives = 95/202 (47.03%), Query Frame = 1
Query: 2134 LATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHS-SPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDIIESIDKCSKFRFSFPIITE---DRDRLWLGSDCGFIVC--LSKRQLLNEGQ 2721
            L +I L  SV ++ + +GR+++A  DG L +F  +     W++    ++++ H    I  +A   D   +W G   + +VI    +++  SF  +    E  + ++  I      D +W+S+    TL  Y +++++     D    +  ++ +     K  FSF  IT      +RLW+G+  G ++   L++  +L+ GQ
Sbjct:  994 LHSIKLKDSVLSLVHVKGRVLVALADGTLAIFH-RGEDGQWDLSNYHLMDLGHPHHSIRCMAVVND--RVWCGYKNKVHVIQPKTMQIEKSFDAHPR-RESQVRQLAWI-----GDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGT----GKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQ 1182          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Mouse
Match: Mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:MGI Symbol;Acc:MGI:1353598])

HSP 1 Score: 137.887 bits (346), Expect = 2.604e-32
Identity = 98/304 (32.24%), Postives = 149/304 (49.01%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPND----------------SKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLK---------------------------PDEESNTLTEEKRKENPLS----DVCKVDKKSHTKFQKCFIFKE----DINRSQLYGWSVPRDLLQSSVSS--------NVPIPVGSHSILE--PKDSIICVT 1704
            FG+G+E+ N++ EN +L+ETKNALN+VK+DLI K+D L+ E ++L+  L++    ++ L+ RI  +E+E+K  R ++E   ++ E  +E  D                 +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+HP      + K +S I +FF  L                                 S+ L +      PL     D C    +   K ++    +E    D  R Q  GWS+P    Q S +         NVP+PV    ++E  P   + C  
Sbjct:  415 FGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLKGELEAAKQAKVKLENRIKELEEELK--RVKSEAVTARREPREEVEDVSSYLCTELDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSV----QEKKKSTIWQFFSRLFSSSSSPPPAKRSYPSVNIHYKSPTAAGFSQRRSHALCQISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPSTKLWCAA 712          

HSP 2 Score: 136.732 bits (343), Expect = 5.074e-32
Identity = 76/161 (47.20%), Postives = 109/161 (67.70%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +A  IYREFERL+  YD  VVK LMPL+V VLENL+ +      +++E+ELLREDN  L+ QY++EK+ R+  EEK +  E   E EKK    ++E+ E   R LELK++N  D + RLEE+E E KKEY  LH+R+T++ + + + +ER K+
Sbjct:   24 VMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRKQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKM 184          

HSP 3 Score: 52.7582 bits (125), Expect = 2.694e-6
Identity = 47/202 (23.27%), Postives = 95/202 (47.03%), Query Frame = 1
Query: 2134 LATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHS-SPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDIIESIDKCSKFRFSFPIITE---DRDRLWLGSDCGFIVC--LSKRQLLNEGQ 2721
            L +I L  SV ++ + +GR+++A  DG L +F  +     W++    ++++ H    I  +A   D   +W G   + +VI    +++  SF  +    E  + ++  I      D +W+S+    TL  Y +++++     D    +  ++ +     K  FSF  IT      +RLW+G+  G ++   L++  +L+ GQ
Sbjct:  994 LHSIKLKDSVLSLVHVKGRVLVALADGTLAIFH-RGEDGQWDLSNYHLMDLGHPHHSIRCMAVVND--RVWCGYKNKVHVIQPKTMQIEKSFDAHPR-RESQVRQLAWI-----GDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGT----GKLGFSFVRITALLIAGNRLWVGTGNGVVISIPLTETVVLHRGQ 1182          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. UniProt/SwissProt
Match: sp|Q29EP6|JIP3_DROPS (JNK-interacting protein 3 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=syd PE=3 SV=2)

HSP 1 Score: 251.521 bits (641), Expect = 1.501e-67
Identity = 190/526 (36.12%), Postives = 285/526 (54.18%), Query Frame = 1
Query:   49 TETIYKNYEKLGLPDENNVIMSEK-------VQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHS------------ISKFAKPLDMGMESNE---------VCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTE----------PNVL---IDRSL-----ETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXE--FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEP-NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTE 1479
             ET+Y         ++NN++MSEK       VQ +A  IY+EFER++  YD  VVKNLMPL+V VLE L+   +     D+E+ELLREDN  L+ QY++EKS R+  E+K++  E   E E K    ++E++E+ +R+LELK +N+ ++  RLEE+E + KKEY KLHERYT++FK H D +ER K+      S +   S            +++ + P+  G  S E         +C        +Q D+     L+  L      +A    A D +++     +           PNV    + RS       +D+N++ EL+  D +  +   I             + ++  FG+G+E+EN+I EN EL+ TKNALNIVKDDLI K+D LT E +++R  L +       L+ RI+ +E+E+K  + Q +   ++ E  D P    KRFTRVEMA++L ERNQ+KE+ +ELQEA+R TE++RASR   +       KS+  I ++F  L  P   SN  TE
Sbjct:   18 AETVYGT-------EDNNMVMSEKNDQVVSIVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVELELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEERETDLKKEYNKLHERYTELFKNHVDYMERTKMLMGSTHSQMSTASDRMEVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVG-----SQSDDSGPPSLQNELDMSLPSTAERGAATDSLQQQHQATSPQSPPDTSPVVPNVPPANVGRSTTKKEQRSDNNLYQELSFQDNEESEENEIVTGCWVHPGEYASSANDNYFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELSAMQQSRTKLRQRISELEEELKKTKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNL----DKKSKQSIWKYFSNLFTP---SNRPTE 524          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. UniProt/SwissProt
Match: sp|Q9GQF1|JIP3_DROME (JNK-interacting protein 3 OS=Drosophila melanogaster OX=7227 GN=syd PE=1 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 9.758e-67
Identity = 192/519 (36.99%), Postives = 289/519 (55.68%), Query Frame = 1
Query:   49 TETIYKNYEKLGLPDENNVIMSEK-------VQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL---SGNRNMSLLQK---------HSISKFAKPLDMGMESNE------------VCDEANYKRYAQIDNYDLDLLEQTLS-ADWKDSARPECAADIIKENFDGQTEPNVL--IDRSL-----ETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXE--FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEP-NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTE 1479
             ET+Y         ++NN++MSEK       VQ +A  IY+EFER++  YD  VVKNLMPL+V VLE L+   +     D+E+ELLREDN  L+ QY++EKS R+  E+K++  E   E E K    ++E++E+ +R+LELK +N+ ++  RLEE+E + KKEY KLHERYT++FK H D +ER K+   S +  MS   +         + +++ + P+  G  S E            V  +++      + N +LD L  TL      D+ + +  A   +        PNV   + RS       +D+N++ EL+  D +  +   I             + ++  FG+G+E+EN+I EN EL+ TKNALNIVKDDLI K+D LT E +++R  L++       L+ RI+ +E E+K  + Q +   ++ E  D P    KRFTRVEMA++L ERNQ+KE+ +ELQEA+R TE++RASR   +       KS+  I ++F  L  P   SN  TE
Sbjct:   18 AETVYGT-------EDNNMVMSEKNEQVVSIVQQLAGSIYQEFERMINRYDEDVVKNLMPLLVNVLECLDASYRINQEQDVEVELLREDNEQLVTQYEREKSARKQSEQKLLEAEDLAEQENKELATRLESVESIVRMLELKHKNSLEHASRLEEREADLKKEYNKLHERYTELFKNHVDYMERTKMLMGSTHSQMSTASERMDVSRARLNPVARSSGPVSYGFASLENSVMLDTETICSVGSQSDDSGPPSLQN-ELDNLSGTLERGAATDALQQQHHATSPQSPDSSPVVPNVPTNVGRSTTKKEQRSDNNLYQELSFQDNEESEENEIVTGSWVHPGEYASSANDNYFGMGKEVENLIMENNELLATKNALNIVKDDLIVKVDELTGEVEIVREELNAMQQSRTKLRQRISELEDELKKAKEQVKQQNTEQEENDVPLAQRKRFTRVEMAMVLMERNQYKERLMELQEAVRLTEILRASRTVDNL----DRKSKQSIWKYFSNLFTP---SNRPTE 521          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. UniProt/SwissProt
Match: sp|P34609|JIP_CAEEL (JNK-interacting protein OS=Caenorhabditis elegans OX=6239 GN=unc-16 PE=1 SV=4)

HSP 1 Score: 238.039 bits (606), Expect = 3.303e-63
Identity = 212/639 (33.18%), Postives = 323/639 (50.55%), Query Frame = 1
Query:   70 YEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK-LSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYK--------RYAQIDNYDLDLLEQTLSADWKDSARPE---CAADIIKENFDGQTEPNVL-------------------IDRSLETDSNIFDELTSDDMKSPKS--------PTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREI---DLKARINSIEQEIKDLRHQNEDFKSKLENADEPND-SKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL-------------KPDEESNTLTEEKRKENP--LSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSIL--EPKDSIICVTKSPSMECSDE-FLWIIVERPVRDGSAYYLAQFSL 1803
            Y   G PDE+   MS+KVQ+MA+ IYRE E +++ +    VK LMPL+V VLE L+     +     E+E+L+EDN  L  QY++EK+ R+  E+K + +E T   + K   +KIE+LE+ +R+LELK++NA D+  RLEE+E EQK E+ +LHERY  + + H D +ER K L G+    L+Q   +        MGM ++   D ++ +           Q    D++L     + DW+D    +      DI + + D  T P                       D +   D    ++L   D+   +S        P  +   +  +D D  +D   G+GRE+EN+IKEN EL++ KNALNIVK+DLI ++D L SEN +LR   D N +R++    ++ +I   E+EIK L+ +  + +++ E  D P    KRFTR EM  +L +RN +KEK +EL+E++++TEM RA +         + KS  GI EFF  LL             +       +T      +P  +S+    +++   K  +  + KED  R + YGWS+P   +++ VSS VPIPV    +L  EP   I C T        DE   WI+       G   Y A  S+
Sbjct:   25 YGGPGSPDEHRT-MSDKVQTMASAIYRELETMIKVHGEDGVKTLMPLVVNVLEALDLAYLERDEQTAELEMLKEDNEQLQTQYEREKALRKQTEQKYIEIEDTLIGQNKELDKKIESLESIMRMLELKAKNATDHASRLEEREVEQKLEFDRLHERYNTLLRTHVDHMERTKYLMGSEKFELMQNMPLPNMQLRNKMGMAAS--VDASSIRGVSDLISAHMTQSTTMDVNLANHITNEDWQDEFSSDIEPSPRDIPQSSADALTSPITTKEPTPKREAASPKQSEEEEADETTSVDPKENNDLLGADLTDDESDWNGLGLIPRRHRPNEMLDDDDTSDDGSLGMGREVENLIKENSELLDMKNALNIVKNDLINQVDELNSENMILR---DENLSRQMVSEKMQEQITKHEEEIKTLKQKLMEKENEQEEDDVPMAMRKRFTRSEMQRVLMDRNAYKEKLMELEESIKWTEMQRAKKMQQQQQNVNQKKS-GGIWEFFSSLLGDSVTPPASSRGNRASSSRGKMTRSVEYIDPDMISERRAAERREQYKLVREHVKKED-GRIEAYGWSLPN--VEAEVSS-VPIPVCCRPLLDNEPSLKIWCATGVVLRGGRDERGQWIV-------GDPIYFAPASM 645          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. UniProt/SwissProt
Match: sp|Q58A65|JIP4_MOUSE (C-Jun-amino-terminal kinase-interacting protein 4 OS=Mus musculus OX=10090 GN=Spag9 PE=1 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 7.036e-33
Identity = 85/195 (43.59%), Postives = 125/195 (64.10%), Query Frame = 1
Query:   88 PDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK---LSGNRNMSLLQKHSISKFAKPLDMGM 663
            P  +  +MSE+V  +A  IYREFERL+  YD  VVK LMPL+V VLENL+ +      + +E+ELLR+DN  L+ QY++EK+ R+  EEK +  E + E EKK    ++E+LE+  R LELK++N  D + RLEE+E E KKEY  LH+R+T++   + + LER K   LSG+  +     HS  +  +P+ +G+
Sbjct:   13 PGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLEAT-AHSRIRKERPISLGI 206          

HSP 2 Score: 135.576 bits (340), Expect = 8.777e-31
Identity = 68/139 (48.92%), Postives = 103/139 (74.10%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPN----DSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHP 1380
             G+GRE+EN+I EN +L+ETKNALN+VK+DLI K+D LT E D+L+  L++    ++ L+ +   +E+E++  R + ED + K ++ D+ +      KRFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR++P
Sbjct:  404 LGMGREVENLILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEDKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENP 542          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. UniProt/SwissProt
Match: sp|O60271|JIP4_HUMAN (C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4)

HSP 1 Score: 141.354 bits (355), Expect = 1.238e-32
Identity = 85/195 (43.59%), Postives = 125/195 (64.10%), Query Frame = 1
Query:   88 PDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK---LSGNRNMSLLQKHSISKFAKPLDMGM 663
            P  +  +MSE+V  +A  IYREFERL+  YD  VVK LMPL+V VLENL+ +      + +E+ELLR+DN  L+ QY++EK+ R+  EEK +  E + E EKK    ++E+LE+  R LELK++N  D + RLEE+E E KKEY  LH+R+T++   + + LER K   LSG+  +     HS  +  +P+ +G+
Sbjct:   13 PGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLEST-AHSRIRKERPISLGI 206          

HSP 2 Score: 126.716 bits (317), Expect = 3.949e-28
Identity = 69/139 (49.64%), Postives = 103/139 (74.10%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPN----DSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHP 1380
             G+GRE+EN+I EN +L+ETKNALNIVK+DLI K+D LT E D+L+  L++    ++ L+ +   +E+E++  R + ED + K ++ D+ +      KRFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR++P
Sbjct:  404 LGMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENP 542          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. TrEMBL
Match: A0A139WM95 (JNK-interacting protein 3-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC003186 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 2.568e-75
Identity = 210/617 (34.04%), Postives = 323/617 (52.35%), Query Frame = 1
Query:   52 ETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL-------------SGNRNMSLLQKHSISKFAKPLDMG---MESNEVCDEANYKR----------YAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNV-LIDRSLETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEF-GVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPND-----SKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDF-------------------------VLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDL------LQSSVSSNVPIPVGSHSILE--PKDSIICVT 1704
            ETIY  +E      +++V+MSEKVQS+A  IY+EFER++  YD  VVK LMPL+V VLE L+   +    +D+E+ELLREDN  L+ QY++EK  R+  E+K++  E   E E+K    ++E LE+ +R+LELK +N+ ++  RLEE+E E KKEY KLHERYT++FK H D +ER KL             +G  N + +   +I + + P+  G   +E+ EV D                ++++DN D  ++E+    D  +          +       T  N   + +   + + ++ EL+  D+       I        +     +  F G+G+E+EN+I EN EL+ TKNALN+VKDDLI K+D LT E +MLR  + S N     L+ RI+ +E+E++ ++  NE   +K + AD+ +D      KRFTRVEMA +L ERNQ+KE+++ELQEA+R+TEM+RASR    F                         ++ P ++ Q+   +   G+       +   E +     L+    V+++   +  +  + KED  R Q YGWS+P  +       QSS    VP+PV    + E  P   I C  
Sbjct:   13 ETIYGTHE------DSHVVMSEKVQSLAGSIYQEFERMIARYDEDVVKTLMPLLVNVLECLDAAYQQNQEHDVELELLREDNEQLVTQYEREKGARKAAEQKLLEFEDAAEGERKELAARLEALESIVRMLELKHKNSMEHAGRLEEREGELKKEYAKLHERYTELFKTHMDYMERTKLLLSGQQLANERAEAGRLNSNRI---NIGRSSGPISFGFTSLENAEVVDSVPSSPISSTHSSPSLHSELDNLDKKMVERGQETDSLNLENKSVITSPVSPPGQPTTNNNTGRLKKEQRSGNTLYQELSFQDVDGDDDGDITGGWVHPGEYASSVNDNFYGMGKEVENLIMENNELLATKNALNVVKDDLIVKVDELTGEIEMLREEILSLNVSRTKLRERISDLEEELRKVKEANE---AKQDGADDESDVPMAQRKRFTRVEMARVLMERNQYKERFMELQEAVRWTEMIRASRNDTAFDKKSKQSIWRFFSNLFSGSERPQRPLVGPHLRYQTATNQIAPGVRALPRPGHDFVETELGSEKLALRRAVERREQYRQVRAHVRKED-GRLQAYGWSLPGKVGPGTKGTQSSSGVPVPVPVYCRPLAETTPGMKIWCAA 616          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. TrEMBL
Match: A0A139WLX9 (JNK-interacting protein 3-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC003186 PE=4 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 1.334e-73
Identity = 190/502 (37.85%), Postives = 284/502 (56.57%), Query Frame = 1
Query:   52 ETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL-------------SGNRNMSLLQKHSISKFAKPLDMG---MESNEVCDEANYKR----------YAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNV-LIDRSLETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEF-GVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPND-----SKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDE 1458
            ETIY  +E      +++V+MSEKVQS+A  IY+EFER++  YD  VVK LMPL+V VLE L+   +    +D+E+ELLREDN  L+ QY++EK  R+  E+K++  E   E E+K    ++E LE+ +R+LELK +N+ ++  RLEE+E E KKEY KLHERYT++FK H D +ER KL             +G  N + +   +I + + P+  G   +E+ EV D                ++++DN D  ++E+    D  +          +       T  N   + +   + + ++ EL+  D+       I        +     +  F G+G+E+EN+I EN EL+ TKNALN+VKDDLI K+D LT E +MLR  + S N     L+ RI+ +E+E++ ++  NE   +K + AD+ +D      KRFTRVEMA +L ERNQ+KE+++ELQEA+R+TEM+RASR    F      KS+  I  FF  L    E
Sbjct:   13 ETIYGTHE------DSHVVMSEKVQSLAGSIYQEFERMIARYDEDVVKTLMPLLVNVLECLDAAYQQNQEHDVELELLREDNEQLVTQYEREKGARKAAEQKLLEFEDAAEGERKELAARLEALESIVRMLELKHKNSMEHAGRLEEREGELKKEYAKLHERYTELFKTHMDYMERTKLLLSGQQLANERAEAGRLNSNRI---NIGRSSGPISFGFTSLENAEVVDSVPSSPISSTHSSPSLHSELDNLDKKMVERGQETDSLNLENKSVITSPVSPPGQPTTNNNTGRLKKEQRSGNTLYQELSFQDVDGDDDGDITGGWVHPGEYASSVNDNFYGMGKEVENLIMENNELLATKNALNVVKDDLIVKVDELTGEIEMLREEILSLNVSRTKLRERISDLEEELRKVKEANE---AKQDGADDESDVPMAQRKRFTRVEMARVLMERNQYKERFMELQEAVRWTEMIRASRNDTAF----DKKSKQSIWRFFSNLFSGSE 498          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. TrEMBL
Match: A0A139WLQ9 (JNK-interacting protein 3-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC003186 PE=4 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 4.986e-73
Identity = 189/501 (37.72%), Postives = 282/501 (56.29%), Query Frame = 1
Query:   52 ETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL-------------SGNRNMSLLQKHSISKFAKPLDMG---MESNEVCDEANYKR----------YAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNV-LIDRSLETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPND-----SKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDE 1458
            ETIY  +E      +++V+MSEKVQS+A  IY+EFER++  YD  VVK LMPL+V VLE L+   +    +D+E+ELLREDN  L+ QY++EK  R+  E+K++  E   E E+K    ++E LE+ +R+LELK +N+ ++  RLEE+E E KKEY KLHERYT++FK H D +ER KL             +G  N + +   +I + + P+  G   +E+ EV D                ++++DN D  ++E+    D  +          +       T  N   + +   + + ++ EL+  D+       I        +         G+G+E+EN+I EN EL+ TKNALN+VKDDLI K+D LT E +MLR  + S N     L+ RI+ +E+E++ ++  NE   +K + AD+ +D      KRFTRVEMA +L ERNQ+KE+++ELQEA+R+TEM+RASR    F      KS+  I  FF  L    E
Sbjct:   13 ETIYGTHE------DSHVVMSEKVQSLAGSIYQEFERMIARYDEDVVKTLMPLLVNVLECLDAAYQQNQEHDVELELLREDNEQLVTQYEREKGARKAAEQKLLEFEDAAEGERKELAARLEALESIVRMLELKHKNSMEHAGRLEEREGELKKEYAKLHERYTELFKTHMDYMERTKLLLSGQQLANERAEAGRLNSNRI---NIGRSSGPISFGFTSLENAEVVDSVPSSPISSTHSSPSLHSELDNLDKKMVERGQETDSLNLENKSVITSPVSPPGQPTTNNNTGRLKKEQRSGNTLYQELSFQDVDGDDDGDITGGWVHPGEYASS-----GMGKEVENLIMENNELLATKNALNVVKDDLIVKVDELTGEIEMLREEILSLNVSRTKLRERISDLEEELRKVKEANE---AKQDGADDESDVPMAQRKRFTRVEMARVLMERNQYKERFMELQEAVRWTEMIRASRNDTAF----DKKSKQSIWRFFSNLFSGSE 492          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. TrEMBL
Match: A0A182E156 (Uncharacterized protein OS=Onchocerca ochengi OX=42157 GN=NOO_LOCUS1689 PE=4 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 2.088e-71
Identity = 204/583 (34.99%), Postives = 310/583 (53.17%), Query Frame = 1
Query:   52 ETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLK-LSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYK--------RYAQIDNYDLDLLEQTLS-ADWKDSARPECAADIIKEN------------------FDGQTEPNVLIDRSLETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEP-NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL--KPDEESNTLTEEKRKENP---LSDVCKVD---------KKSHTKFQKCFIFKEDINRSQ-----LYGWSVPRDLLQSSVSSNVPIPV 1656
            E +Y     +G   ++  +MSEKVQ +A+ IY+EFE ++E      VKNLMPL+V VLE+L+     K    +++E+L+EDN  LM QY++EK  RR  ++K + +E +  ++ +    KIE+LE+ +R+LELK++NA+D+  RLEE+E +QK E+ KLHERY  + + H D +ER K L G     ++Q   +        +GM      D +  +          +Q    D++L     S +DW D    + A+DI++                     D   +P+  I  S+ + ++  D L +D   +   P  +              +  G+GRE+EN+IKEN EL+ETKNALNIVK+DLI ++D L+SE D+LR  + S       +  RI  +E E++DL+ + E  +S+ +  D P    KRFTR+EMA +L ERNQ+KEK +ELQEA+++TEM RA R +         K  SGI EFF GL   +P   SN   +    E     LS    +D         +++  + Q+  I KE INR +      YGWSVP    + + S+ VP+PV
Sbjct:   21 EVVYGATGSVGSAGDDTRVMSEKVQMLASSIYKEFETMIEKNGEDSVKNLMPLVVNVLESLDLAYLEKEECSVDLEMLKEDNEQLMTQYEREKQLRRAQDQKCLEIEDSLVEQNRELESKIESLESIMRMLELKAKNASDHAARLEEREADQKAEFDKLHERYNILLRTHIDHMERTKYLMGTEKFEMMQSMPLPSHHLRTKLGMGMAASVDASTIRGVSDLISAHMSQSTTLDVNLANHISSESDWHDEF-GQNASDILQSPRDYSSSAAESPREAPLPISDNTVQPSTSIPASVASTNDAVDSLGADLTGALVDPAEF--------------ASAGMGREVENLIKENTELLETKNALNIVKNDLIARVDELSSEQDILREEIRSLEMVRSKMSERIKELESEVRDLKDKLET-RSEDDQEDLPMAQRKRFTRLEMARVLLERNQYKEKLMELQEAVKWTEMQRAKRLNA-----LNTKKSSGIWEFFSGLFMHEPPRSSNRRRKTGGNERDTLRLSSAKTIDFLDTDYSSERRAAKRRQQYKIVKEHINREESDRFHSYGWSVPAIFGEPNESTVVPVPV 582          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. TrEMBL
Match: A0A0V1I094 (C-Jun-amino-terminal kinase-interacting protein 4 OS=Trichinella zimbabwensis OX=268475 GN=Spag9 PE=4 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 4.163e-71
Identity = 206/590 (34.92%), Postives = 319/590 (54.07%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL------------------SG-NRNMSLLQKHS--ISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRSLETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEP-NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSG-IMEFFRGLLK--------------------PDEESNTLTEEKRK-------------ENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSIL--EPKDSIICV 1701
            +MSEKVQ+MA+ IY+EFER+++ +    VK+LMPL+V++LE L+     K  +++E+ELL+EDN  L+ QY++EK  RR  E++ + +E  FE+E+    EK+E+LE+ +R+LELK++N  D + RLE++E E K+EY KLH+RYT++F+ H D +ER K                   SG  +N ++ Q HS  + +F      G + N     ++ +R + +D +     E+T+ AD +  A   C     K   + ++ P    + +   DS   D L  D       P  +              +  G+GRE+EN+IKEN EL+ETKNALN+VK+DLI +LD + SE D+LR  + S       L  R+  +EQE+K+ +   E+ +++ EN+D P    KRFTR+EMA +L ERNQ+KEK +ELQEA+R+TEM+RASR       +P +K + G I +FF GL                      P+      +E+ RK             +N  S+    ++K   K  K  + K++  R Q YGWS+P   +  +  ++VP+PV    +   EP   I C 
Sbjct:   27 VMSEKVQTMASSIYKEFERMIQQFGEESVKDLMPLVVSMLEALDLAQLEKEEHEVELELLKEDNEQLVTQYEREKQLRRSTEQRCLEVEDVFEEERSGMKEKLESLESIVRMLELKAKNCTDQVARLEDREVESKQEYNKLHDRYTELFRTHMDYMERTKFLMGSDKFDVSMTSSGVFSSGTGKNFTVPQVHSHLVGQFHDDNVEGRDLNNYPRRSD-RRSSAVDGWSF---ERTVPADAEFEAEDFCETPTKKAE-EAESPPASTHNAA---DSGSDDALGVDLTGGLVDPAEF--------------ASAGMGREVENLIKENTELLETKNALNVVKNDLIAQLDGMASEQDILREEIRSLEMVRAKLNERLRELEQELKESKQSLEELRNRDENSDVPMAQRKRFTRIEMARVLMERNQYKEKLMELQEAVRWTEMIRASRN------DPSLKRKRGSIWDFFNGLFSSGSNNAASDQHAMVNLRYNAPNRNLLPGSEKTRKSSNGKLKAFDFLDKNFSSERRAAERKEQYKLVKAHVKKDESGRFQAYGWSIP---VLDAPQTSVPVPVSCQPLYENEPHLKIWCA 585          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 138.658 bits (348), Expect = 9.591e-33
Identity = 74/169 (43.79%), Postives = 112/169 (66.27%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQ------------NEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
            FG+G+E+EN++ EN++L+ETKNALNIVK+DLI K+D L+ E ++LR  L++    +  + +R+  +E+E+K LR +             ED+ S L++       +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+ P      + K +S I +FF  L 
Sbjct:  410 FGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVKQSKNKVDSRVKELEEELKRLRAEALGASQDSKDEGGEDYSSTLQDDVAMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPQM----QEKKKSTIWQFFARLF 574          

HSP 2 Score: 133.265 bits (334), Expect = 4.942e-31
Identity = 75/161 (46.58%), Postives = 111/161 (68.94%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +AN IYREFERL+ SYD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    +++ LE   + LELK++N  D + RLEE+E + KKEY  LH+R+T++ + + + +ER K+
Sbjct:   20 VMSERVSGLANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQSQVDFLELQGKQLELKTKNYADQISRLEEREGDMKKEYNALHQRHTEMIQTYVEHIERSKM 180          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 138.658 bits (348), Expect = 9.980e-33
Identity = 74/169 (43.79%), Postives = 112/169 (66.27%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQ------------NEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
            FG+G+E+EN++ EN++L+ETKNALNIVK+DLI K+D L+ E ++LR  L++    +  + +R+  +E+E+K LR +             ED+ S L++       +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+ P      + K +S I +FF  L 
Sbjct:  406 FGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVKQSKNKVDSRVKELEEELKRLRAEALGASQDSKDEGGEDYSSTLQDDVAMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPQM----QEKKKSTIWQFFARLF 570          

HSP 2 Score: 133.265 bits (334), Expect = 5.140e-31
Identity = 75/161 (46.58%), Postives = 111/161 (68.94%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +AN IYREFERL+ SYD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    +++ LE   + LELK++N  D + RLEE+E + KKEY  LH+R+T++ + + + +ER K+
Sbjct:   20 VMSERVSGLANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQSQVDFLELQGKQLELKTKNYADQISRLEEREGDMKKEYNALHQRHTEMIQTYVEHIERSKM 180          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 138.658 bits (348), Expect = 1.026e-32
Identity = 74/169 (43.79%), Postives = 112/169 (66.27%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQ------------NEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
            FG+G+E+EN++ EN++L+ETKNALNIVK+DLI K+D L+ E ++LR  L++    +  + +R+  +E+E+K LR +             ED+ S L++       +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+ P      + K +S I +FF  L 
Sbjct:  410 FGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVKQSKNKVDSRVKELEEELKRLRAEALGASQDSKDEGGEDYSSTLQDDVAMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPQM----QEKKKSTIWQFFARLF 574          

HSP 2 Score: 133.265 bits (334), Expect = 5.108e-31
Identity = 75/161 (46.58%), Postives = 111/161 (68.94%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +AN IYREFERL+ SYD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    +++ LE   + LELK++N  D + RLEE+E + KKEY  LH+R+T++ + + + +ER K+
Sbjct:   20 VMSERVSGLANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQSQVDFLELQGKQLELKTKNYADQISRLEEREGDMKKEYNALHQRHTEMIQTYVEHIERSKM 180          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 138.658 bits (348), Expect = 1.155e-32
Identity = 74/169 (43.79%), Postives = 112/169 (66.27%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQ------------NEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
            FG+G+E+EN++ EN++L+ETKNALNIVK+DLI K+D L+ E ++LR  L++    +  + +R+  +E+E+K LR +             ED+ S L++       +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+ P      + K +S I +FF  L 
Sbjct:  410 FGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVKQSKNKVDSRVKELEEELKRLRAEALGASQDSKDEGGEDYSSTLQDDVAMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPQM----QEKKKSTIWQFFARLF 574          

HSP 2 Score: 132.88 bits (333), Expect = 5.951e-31
Identity = 75/161 (46.58%), Postives = 111/161 (68.94%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +AN IYREFERL+ SYD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    +++ LE   + LELK++N  D + RLEE+E + KKEY  LH+R+T++ + + + +ER K+
Sbjct:   20 VMSERVSGLANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQSQVDFLELQGKQLELKTKNYADQISRLEEREGDMKKEYNALHQRHTEMIQTYVEHIERSKM 180          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Cavefish
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:103035578])

HSP 1 Score: 135.961 bits (341), Expect = 7.047e-32
Identity = 73/169 (43.20%), Postives = 111/169 (65.68%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQ------------NEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
             G+G+E+EN++ EN++L+ETKNALNIVK+DLI K+D L+ E ++LR  L++    +  + +R+  +E+E+K LR +             ED+ S L++       +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+ P      + K +S I +FF  L 
Sbjct:  369 LGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVKQSKNKVDSRVKELEEELKRLRAEALGASQDSKDEGGEDYSSTLQDDVAMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPQM----QEKKKSTIWQFFARLF 533          

HSP 2 Score: 132.88 bits (333), Expect = 6.401e-31
Identity = 75/161 (46.58%), Postives = 111/161 (68.94%), Query Frame = 1
Query:  106 IMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +MSE+V  +AN IYREFERL+ SYD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    +++ LE   + LELK++N  D + RLEE+E + KKEY  LH+R+T++ + + + +ER K+
Sbjct:   20 VMSERVSGLANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLTENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQSQVDFLELQGKQLELKTKNYADQISRLEEREGDMKKEYNALHQRHTEMIQTYVEHIERSKM 180          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Nematostella
Match: EDO47039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNC5])

HSP 1 Score: 196.823 bits (499), Expect = 2.017e-51
Identity = 184/635 (28.98%), Postives = 304/635 (47.87%), Query Frame = 1
Query:   52 ETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKLSG-----------NRNMSLLQKHSISKFAKPLDMGMES----NEVCDEANYKRYAQIDNYDL-------DLL-----EQTLSADWKDSAR-----PE-CAADIIKENF---DGQTEPNVLIDRSLE------TDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENAD-EPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEES---------------NTLTEEKRKENPLSDVCKVDKKSHTKFQKCF-----------------IFKEDI--NRSQLYGWSVP-------RDLLQSSVSSNVPIPVGSHSILEPKDSIICVT 1704
            E +Y + E+ G       +MSE+V ++AN IY EFER+++ YD  VV  LMPL+V+VLE L+          +E+E+L +DN  L+ QY++EK  R+  E + + +E   E EK+   + IE+LE + R LE + ++  D++ RLEE+  E K+EY  LH+R++++ + + + +ER +              NR + +L+  S +   K     ++     N  C        + +DN  +       ++L     + +L+   KD+A      PE   ++++ E      G +  N  +   LE        S++F EL+S++      P +    D   D          +GRE+EN++KEN+ELV  KN L   K+DL+K+L+ L+++ +++   L S    +  +  R+   E E+K  +H+ E     L+ A       KRFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RAS++     LE + K +S I +FF  L  P   +                  T   R+ N L+++      S     + F                     D+   R Q YGWS+P        +  +S VS  VP+     ++ +P   I C  
Sbjct:    9 EAVYSSGEEGG-----TTVMSERVSNLANSIYSEFERMIQKYDQDVVSGLMPLMVSVLEQLDSAYGDNNEQLVELEILSDDNEQLITQYEREKQLRKLAENRYLEIEDQIEAEKRNAEKDIESLEHDNRGLEARIKSYQDHVERLEERISEMKREYGSLHQRHSEVVQHYMERIERAEKRSIASTETPQKGLNRYLHMLKLSSSTGLEKSQGANVDGLDVNNSTCS------ISDVDNLPIVSAREAANMLTPGSSDVSLTGISKDAAAILASTPELSGSNVVTEVARREKGSSSANRPVSLDLENLPEGVAASSLFAELSSEE------PDVIGQMDTGADI-------IAMGRELENVMKENKELVTVKNKLETQKNDLLKRLEELSNDKEVMTEELKSLQEVKQRMNIRVTECEHELKRTKHEAEKATVALKEASVSAAHRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASKERN---LELQQKKKSSIWKFFSNLFGPTPRARPNPSTVSIRYNSGEGQGTPPARRHNSLTNLNTGSNMSGGYGSENFDRQRLNERRERYKQVRAYLNTDLSEGRMQAYGWSLPAKYSSEVAEGGKSLVSVPVPVYCRPLNLSDPGMKIWCAA 616          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Medaka
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:101157621])

HSP 1 Score: 139.043 bits (349), Expect = 7.073e-33
Identity = 83/184 (45.11%), Postives = 120/184 (65.22%), Query Frame = 1
Query:   37 MSIITETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            M  I E +Y++    G       +MSE+V  MAN IYREFERL+ SYD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    ++E LE   + LELK++N +D + RLEE+E + KKEY  LH+R+T++ + + + +ER KL
Sbjct:    1 MMEIDEVVYQDDYGSG------TVMSERVSGMANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLIENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQMQVEFLELQGKQLELKTKNYSDQITRLEERESDLKKEYNALHQRHTEMIQTYVEHIERSKL 178          

HSP 2 Score: 138.272 bits (347), Expect = 1.476e-32
Identity = 75/168 (44.64%), Postives = 112/168 (66.67%), Query Frame = 1
Query:  979 GVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIK-----------DLRHQNEDFKSKLENADEP-NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
            G+G+E+EN++ EN++L+ETKNALNIVK+DLI K+D L+ E ++LR  L++    +  + ARI  +E+EIK           D + + +DF S +++ D      +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+ P      + K +S I +FF  L 
Sbjct:  364 GMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVRQSKNKVDARIKELEEEIKRLKAEALGASRDSKDEGDDFSSPIQDGDMTMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPPI----QEKKKSTIWQFFARLF 527          

HSP 3 Score: 52.373 bits (124), Expect = 3.063e-6
Identity = 49/203 (24.14%), Postives = 96/203 (47.29%), Query Frame = 1
Query: 2134 LATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMS--HSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDIIESIDKCSKFRFSFPIITE---DRDRLWLGSDCGFIVC--LSKRQLLNEGQ 2721
            L +I L  SV ++ + +GR+++A  DG L +F  +     W++    ++++   H S I  +A   D   +W G   + +VI    +++  SF  +    E  + ++  I      D +W+S+    TL  Y +++++     D    +  ++ +     K  FSF  IT      +RLW+G+  G I+   L++  +L+ GQ
Sbjct:  968 LHSIKLKDSVLSLVHVKGRVLVALADGTLAIFH-RSEDGQWDLSNYHLMDLGRPHHS-IRCMAVVHD--KVWCGYKNKIHVIQPKSMQIEKSFDAHPR-RESQVRQLAWI-----GDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGT----GKLGFSFVRITALLIGGNRLWVGTGNGVIISIPLTETVVLHRGQ 1156          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Medaka
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:101157621])

HSP 1 Score: 139.043 bits (349), Expect = 8.089e-33
Identity = 83/184 (45.11%), Postives = 120/184 (65.22%), Query Frame = 1
Query:   37 MSIITETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            M  I E +Y++    G       +MSE+V  MAN IYREFERL+ SYD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    ++E LE   + LELK++N +D + RLEE+E + KKEY  LH+R+T++ + + + +ER KL
Sbjct:    1 MMEIDEVVYQDDYGSG------TVMSERVSGMANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLIENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQMQVEFLELQGKQLELKTKNYSDQITRLEERESDLKKEYNALHQRHTEMIQTYVEHIERSKL 178          

HSP 2 Score: 138.272 bits (347), Expect = 1.199e-32
Identity = 75/169 (44.38%), Postives = 112/169 (66.27%), Query Frame = 1
Query:  976 FGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIK-----------DLRHQNEDFKSKLENADEP-NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
             G+G+E+EN++ EN++L+ETKNALNIVK+DLI K+D L+ E ++LR  L++    +  + ARI  +E+EIK           D + + +DF S +++ D      +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+ P      + K +S I +FF  L 
Sbjct:  359 LGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVRQSKNKVDARIKELEEEIKRLKAEALGASRDSKDEGDDFSSPIQDGDMTMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPPI----QEKKKSTIWQFFARLF 523          

HSP 3 Score: 52.373 bits (124), Expect = 3.010e-6
Identity = 49/203 (24.14%), Postives = 96/203 (47.29%), Query Frame = 1
Query: 2134 LATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMS--HSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDIIESIDKCSKFRFSFPIITE---DRDRLWLGSDCGFIVC--LSKRQLLNEGQ 2721
            L +I L  SV ++ + +GR+++A  DG L +F  +     W++    ++++   H S I  +A   D   +W G   + +VI    +++  SF  +    E  + ++  I      D +W+S+    TL  Y +++++     D    +  ++ +     K  FSF  IT      +RLW+G+  G I+   L++  +L+ GQ
Sbjct:  964 LHSIKLKDSVLSLVHVKGRVLVALADGTLAIFH-RSEDGQWDLSNYHLMDLGRPHHS-IRCMAVVHD--KVWCGYKNKIHVIQPKSMQIEKSFDAHPR-RESQVRQLAWI-----GDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGT----GKLGFSFVRITALLIGGNRLWVGTGNGVIISIPLTETVVLHRGQ 1152          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Medaka
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:101157621])

HSP 1 Score: 139.043 bits (349), Expect = 8.596e-33
Identity = 78/164 (47.56%), Postives = 113/164 (68.90%), Query Frame = 1
Query:   97 NNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +  +MSE+V  MAN IYREFERL+ SYD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    ++E LE   + LELK++N +D + RLEE+E + KKEY  LH+R+T++ + + + +ER KL
Sbjct:   15 SGTVMSERVSGMANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLIENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQMQVEFLELQGKQLELKTKNYSDQITRLEERESDLKKEYNALHQRHTEMIQTYVEHIERSKL 178          

HSP 2 Score: 136.346 bits (342), Expect = 5.748e-32
Identity = 68/137 (49.64%), Postives = 100/137 (72.99%), Query Frame = 1
Query:  979 GVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFV 1389
            G+G+E+EN++ EN++L+ETKNALNIVK+DLI K+D L+ E ++LR  L++    +  + ARI  +E+EIK L+   E   +  ++ DE +D +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+R  R  P  V
Sbjct:  398 GMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVRQSKNKVDARIKELEEEIKRLK--AEALGASRDSKDEGDDRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRRKRSPPSAV 532          

HSP 3 Score: 51.9878 bits (123), Expect = 4.138e-6
Identity = 49/203 (24.14%), Postives = 96/203 (47.29%), Query Frame = 1
Query: 2134 LATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMS--HSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDIIESIDKCSKFRFSFPIITE---DRDRLWLGSDCGFIVC--LSKRQLLNEGQ 2721
            L +I L  SV ++ + +GR+++A  DG L +F  +     W++    ++++   H S I  +A   D   +W G   + +VI    +++  SF  +    E  + ++  I      D +W+S+    TL  Y +++++     D    +  ++ +     K  FSF  IT      +RLW+G+  G I+   L++  +L+ GQ
Sbjct:  940 LHSIKLKDSVLSLVHVKGRVLVALADGTLAIFH-RSEDGQWDLSNYHLMDLGRPHHS-IRCMAVVHD--KVWCGYKNKIHVIQPKSMQIEKSFDAHPR-RESQVRQLAWI-----GDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGT----GKLGFSFVRITALLIGGNRLWVGTGNGVIISIPLTETVVLHRGQ 1128          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Medaka
Match: ENSORLT00000028893.1 (pep primary_assembly:ASM223467v1:8:13379366:13393011:1 gene:ENSORLG00000027081.1 transcript:ENSORLT00000028893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.028 bits (323), Expect = 8.712e-33
Identity = 76/189 (40.21%), Postives = 121/189 (64.02%), Query Frame = 1
Query:   97 NNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGM 663
             + +MSE+V  +A+ IYREFERL+  YD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EE+ M  E T E EKK     ++ +E++ R LELK +N +D + RLEE+E E KK++  LH+R++++   + + +ER+K+      S        +  +PL +G+
Sbjct:   15 TSAMMSERVSGLASSIYREFERLIGKYDEDVVKELMPLVVAVLENLDSVFAENQEHEVELELLKEDNEQLITQYEREKALRKHAEERFMEFEDTHEQEKKDLQNHVDRMESHSRQLELKIKNYSDQISRLEERELELKKDFNTLHQRHSEMIHNYMEHVERIKMQQVSETSESSAVGRVRRERPLSLGI 203          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Medaka
Match: mapk8ip3 (mitogen-activated protein kinase 8 interacting protein 3 [Source:NCBI gene;Acc:101157621])

HSP 1 Score: 137.117 bits (344), Expect = 3.135e-32
Identity = 78/164 (47.56%), Postives = 113/164 (68.90%), Query Frame = 1
Query:   97 NNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKL 588
            +  +MSE+V  MAN IYREFERL+ SYD  VVK LMPL+V VLENL+ +      +++E+ELL+EDN  L+ QY++EK+ R+  EEK +  E   E EKK    ++E LE   + LELK++N +D + RLEE+E + KKEY  LH+R+T++ + + + +ER KL
Sbjct:   15 SGTVMSERVSGMANSIYREFERLIRSYDEEVVKELMPLVVNVLENLDAVLIENQEHEVELELLKEDNEQLITQYEREKALRKQAEEKFIEFEDALEAEKKDLQMQVEFLELQGKQLELKTKNYSDQITRLEERESDLKKEYNALHQRHTEMIQTYVEHIERSKL 178          

HSP 2 Score: 137.117 bits (344), Expect = 3.504e-32
Identity = 77/171 (45.03%), Postives = 114/171 (66.67%), Query Frame = 1
Query:  973 EF-GVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIK-----------DLRHQNEDFKSKLENADEP-NDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLL 1446
            EF G+G+E+EN++ EN++L+ETKNALNIVK+DLI K+D L+ E ++LR  L++    +  + ARI  +E+EIK           D + + +DF S +++ D      +RFTRVEMA +L ERNQ+KE+ +ELQEA+R+TEM+RASR+ P      + K +S I +FF  L 
Sbjct:  361 EFSGMGKEVENLLTENKQLLETKNALNIVKNDLIAKVDELSGEQEVLREELEAVRQSKNKVDARIKELEEEIKRLKAEALGASRDSKDEGDDFSSPIQDGDMTMTQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRESPPI----QEKKKSTIWQFFARLF 527          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Planmine SMEST
Match: SMESG000055134.1 (SMESG000055134.1)

HSP 1 Score: 1928.68 bits (4995), Expect = 0.000e+0
Identity = 1001/1005 (99.60%), Postives = 1003/1005 (99.80%), Query Frame = 1
Query:   37 MSIITETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRSLETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIXXXXXXXXXXXFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIIXXXXXXXXXXXXXXXXXXXXIKTKSLSKEIFQSTDSIVTSKSISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI 3051
            MSIITETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLEEKEKEQKKEYQKLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRS ETDSNIFDELTSDDMKSPKSPTIYFMKD+DNDSDIDNDSEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIVVVYSVTVNNVFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFR SLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIINANSSSLASTPNSSKSLSPAIKTKSLSKEIFQSTDSIVTSK+ISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI
Sbjct:    1 MSIITETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLEEKEKEQKKEYQKLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRSQETDSNIFDELTSDDMKSPKSPTIYFMKDYDNDSDIDNDSEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIVVVYSVTVNNVFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRASLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIINANSSSLASTPNSSKSLSPAIKTKSLSKEIFQSTDSIVTSKTISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI 1005          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Planmine SMEST
Match: SMESG000055134.1 (SMESG000055134.1)

HSP 1 Score: 1919.82 bits (4972), Expect = 0.000e+0
Identity = 988/1005 (98.31%), Postives = 989/1005 (98.41%), Query Frame = 1
Query:   37 MSIITETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRSLETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIXXXXXXXXXXXFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIIXXXXXXXXXXXXXXXXXXXXIKTKSLSKEIFQSTDSIVTSKSISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI 3051
            MSIITETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLEEKEKEQKKEYQKLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRS ETDSNIFDELTSDDMKSPKSPTIYFMK              GVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIVVVYSVTVNNVFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFR SLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIINANSSSLASTPNSSKSLSPAIKTKSLSKEIFQSTDSIVTSK+ISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI
Sbjct:    1 MSIITETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLEEKEKEQKKEYQKLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRSQETDSNIFDELTSDDMKSPKSPTIYFMK--------------GVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIVVVYSVTVNNVFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRASLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIINANSSSLASTPNSSKSLSPAIKTKSLSKEIFQSTDSIVTSKTISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI 991          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Planmine SMEST
Match: SMESG000055134.1 (SMESG000055134.1)

HSP 1 Score: 1894.01 bits (4905), Expect = 0.000e+0
Identity = 988/1005 (98.31%), Postives = 990/1005 (98.51%), Query Frame = 1
Query:   37 MSIITETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRSLETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIXXXXXXXXXXXFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIIXXXXXXXXXXXXXXXXXXXXIKTKSLSKEIFQSTDSIVTSKSISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI 3051
            MSIITETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLEEKEKEQKKEYQKLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRS ETDSNIFDELTSDDM             +DNDSDIDNDSEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIVVVYSVTVNNVFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFR SLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIINANSSSLASTPNSSKSLSPAIKTKSLSKEIFQSTDSIVTSK+ISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI
Sbjct:    1 MSIITETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLEEKEKEQKKEYQKLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRSQETDSNIFDELTSDDMN------------YDNDSDIDNDSEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIVVVYSVTVNNVFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRASLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIINANSSSLASTPNSSKSLSPAIKTKSLSKEIFQSTDSIVTSKTISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI 993          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Planmine SMEST
Match: SMESG000055134.1 (SMESG000055134.1)

HSP 1 Score: 1878.99 bits (4866), Expect = 0.000e+0
Identity = 977/981 (99.59%), Postives = 979/981 (99.80%), Query Frame = 1
Query:  109 MSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRSLETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIXXXXXXXXXXXFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIIXXXXXXXXXXXXXXXXXXXXIKTKSLSKEIFQSTDSIVTSKSISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI 3051
            MSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLEEKEKEQKKEYQKLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRS ETDSNIFDELTSDDMKSPKSPTIYFMKD+DNDSDIDNDSEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIVVVYSVTVNNVFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFR SLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIINANSSSLASTPNSSKSLSPAIKTKSLSKEIFQSTDSIVTSK+ISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI
Sbjct:    1 MSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLEEKEKEQKKEYQKLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRSQETDSNIFDELTSDDMKSPKSPTIYFMKDYDNDSDIDNDSEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIVVVYSVTVNNVFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRASLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIINANSSSLASTPNSSKSLSPAIKTKSLSKEIFQSTDSIVTSKTISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI 981          
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Planmine SMEST
Match: SMESG000055134.1 (SMESG000055134.1)

HSP 1 Score: 1870.9 bits (4845), Expect = 0.000e+0
Identity = 964/981 (98.27%), Postives = 965/981 (98.37%), Query Frame = 1
Query:  109 MSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLXXXXXXXXXXXXXLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRSLETDSNIFDELTSDDMKSPKSPTIYFMKXXXXXXXXXXXXEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIXXXXXXXXXXXFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIIXXXXXXXXXXXXXXXXXXXXIKTKSLSKEIFQSTDSIVTSKSISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI 3051
            MSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLEEKEKEQKKEYQKLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRS ETDSNIFDELTSDDMKSPKSPTIYFMK              GVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIVVVYSVTVNNVFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFR SLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIINANSSSLASTPNSSKSLSPAIKTKSLSKEIFQSTDSIVTSK+ISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI
Sbjct:    1 MSEKVQSMANGIYREFERLMESYDSAVVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSNRRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRLEEKEKEQKKEYQKLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISKFAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPECAADIIKENFDGQTEPNVLIDRSQETDSNIFDELTSDDMKSPKSPTIYFMK--------------GVGREIENMIKENQELVETKNALNIVKDDLIKKLDYLTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENADEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDFVLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSHTKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKDSIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTISYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISDNVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIVVVYSVTVNNVFDGRLATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEMSHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEHMCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRASLFDIIESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQRNIYVSCHGFSGSLVSIVSLPIINANSSSLASTPNSSKSLSPAIKTKSLSKEIFQSTDSIVTSKTISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNVLIWKI 967          
The following BLAST results are available for this feature:
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPAG92.105e-3343.59sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
SPAG92.246e-3343.59sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
SPAG92.578e-3343.59sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
SPAG92.743e-3343.59sperm associated antigen 9 [Source:HGNC Symbol;Acc... [more]
MAPK8IP39.592e-3232.89mitogen-activated protein kinase 8 interacting pro... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-162.951e-6534.19JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-163.616e-6534.19JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-162.597e-6433.18JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-166.592e-6334.04JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
unc-163.312e-6136.65JNK-interacting protein [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syd3.471e-7037.50gene:FBgn0024187 transcript:FBtr0332790[more]
syd4.081e-7037.50gene:FBgn0024187 transcript:FBtr0332792[more]
syd5.664e-7037.50gene:FBgn0024187 transcript:FBtr0332791[more]
syd4.089e-6937.45gene:FBgn0024187 transcript:FBtr0332787[more]
syd4.343e-6937.45gene:FBgn0024187 transcript:FBtr0332789[more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk8ip31.498e-3345.56mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip31.761e-3345.56mitogen-activated protein kinase 8 interacting pro... [more]
SPAG94.706e-3033.21sperm associated antigen 9b [Source:NCBI gene;Acc:... [more]
SPAG91.220e-2933.21sperm associated antigen 9b [Source:NCBI gene;Acc:... [more]
spag9a1.253e-2943.90sperm associated antigen 9a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cldn23.047e-3243.43claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn23.501e-3242.26claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn23.604e-3242.26claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn21.661e-3147.83claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
cldn21.947e-3147.83claudin 2 [Source:Xenbase;Acc:XB-GENE-994508][more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spag99.879e-3443.59sperm associated antigen 9 [Source:MGI Symbol;Acc:... [more]
Spag98.370e-3349.64sperm associated antigen 9 [Source:MGI Symbol;Acc:... [more]
Mapk8ip39.007e-3333.67mitogen-activated protein kinase 8 interacting pro... [more]
Mapk8ip32.604e-3232.24mitogen-activated protein kinase 8 interacting pro... [more]
Mapk8ip32.604e-3232.24mitogen-activated protein kinase 8 interacting pro... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29EP6|JIP3_DROPS1.501e-6736.12JNK-interacting protein 3 OS=Drosophila pseudoobsc... [more]
sp|Q9GQF1|JIP3_DROME9.758e-6736.99JNK-interacting protein 3 OS=Drosophila melanogast... [more]
sp|P34609|JIP_CAEEL3.303e-6333.18JNK-interacting protein OS=Caenorhabditis elegans ... [more]
sp|Q58A65|JIP4_MOUSE7.036e-3343.59C-Jun-amino-terminal kinase-interacting protein 4 ... [more]
sp|O60271|JIP4_HUMAN1.238e-3243.59C-Jun-amino-terminal kinase-interacting protein 4 ... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A139WM952.568e-7534.04JNK-interacting protein 3-like Protein OS=Triboliu... [more]
A0A139WLX91.334e-7337.85JNK-interacting protein 3-like Protein OS=Triboliu... [more]
A0A139WLQ94.986e-7337.72JNK-interacting protein 3-like Protein OS=Triboliu... [more]
A0A182E1562.088e-7134.99Uncharacterized protein OS=Onchocerca ochengi OX=4... [more]
A0A0V1I0944.163e-7134.92C-Jun-amino-terminal kinase-interacting protein 4 ... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk8ip39.591e-3343.79mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip39.980e-3343.79mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip31.026e-3243.79mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip31.155e-3243.79mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip37.047e-3243.20mitogen-activated protein kinase 8 interacting pro... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO470392.017e-5128.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapk8ip37.073e-3345.11mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip38.089e-3345.11mitogen-activated protein kinase 8 interacting pro... [more]
mapk8ip38.596e-3347.56mitogen-activated protein kinase 8 interacting pro... [more]
ENSORLT00000028893.18.712e-3340.21pep primary_assembly:ASM223467v1:8:13379366:133930... [more]
mapk8ip33.135e-3247.56mitogen-activated protein kinase 8 interacting pro... [more]
back to top
BLAST of C-Jun-amino-terminal kinase-interacting protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055134.10.000e+099.60SMESG000055134.1[more]
SMESG000055134.10.000e+098.31SMESG000055134.1[more]
SMESG000055134.10.000e+098.31SMESG000055134.1[more]
SMESG000055134.10.000e+099.59SMESG000055134.1[more]
SMESG000055134.10.000e+098.27SMESG000055134.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031333 ID=SMED30031333|Name=C-Jun-amino-terminal kinase-interacting protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=3161bp
TATATAAATCTTATATGATTAACTAAATAGAAAAAAATGAGTATTATAAC
AGAGACTATTTACAAAAATTATGAAAAATTAGGGTTACCTGATGAGAATA
ATGTAATAATGTCTGAAAAAGTTCAATCCATGGCTAATGGGATTTATAGA
GAATTTGAAAGACTCATGGAATCCTACGACTCAGCTGTCGTCAAGAATTT
AATGCCTCTCATTGTTACGGTTTTAGAAAACTTAAATGAATTAGATAAAT
CAAAACTTAACAATGATATGGAAATCGAGTTGTTACGTGAAGATAATTCA
GCTTTAATGAATCAATATGATAAAGAAAAATCTAATCGAAGGTTTATTGA
AGAAAAAATAATGAACTTGGAATACACATTTGAAGATGAGAAAAAGACTT
TTATGGAAAAAATAGAAAATTTAGAAGCAAATATTAGGTTGCTTGAATTG
AAATCCCGTAATGCTAATGATAATTTGATTCGGTTGGAAGAGAAAGAAAA
AGAACAAAAGAAAGAATATCAGAAGCTTCACGAGCGCTACACTGACATAT
TCAAATGCCATGCTGATTTATTGGAGAGACTGAAGTTGTCGGGAAATAGA
AACATGTCGTTATTGCAGAAACATTCAATAAGCAAATTTGCGAAACCGCT
TGACATGGGCATGGAATCAAACGAGGTTTGTGATGAGGCTAACTACAAAA
GATATGCCCAAATCGATAATTACGATTTGGATCTCTTGGAACAGACATTA
TCTGCAGATTGGAAAGATTCAGCCCGGCCTGAATGCGCTGCTGACATAAT
TAAGGAGAATTTTGACGGTCAAACTGAGCCCAATGTCCTAATTGATAGAT
CTCTAGAAACTGACAGCAACATATTTGATGAGCTCACATCAGATGATATG
AAATCTCCCAAATCTCCTACAATCTACTTTATGAAAGATTTTGACAATGA
CAGTGATATTGACAATGACAGTGAGTTCGGTGTTGGGCGAGAGATAGAAA
ACATGATTAAAGAAAATCAGGAATTAGTTGAGACAAAAAATGCGCTCAAT
ATTGTTAAAGATGATTTAATAAAAAAATTGGATTATTTAACAAGTGAAAA
TGATATGCTGAGGAGTGTGCTAGATTCCAATAATAATAGAGAAATTGATT
TGAAAGCTCGAATCAATTCTATAGAGCAAGAAATTAAAGATCTCCGGCAT
CAGAATGAAGATTTTAAATCTAAATTGGAAAATGCAGACGAACCAAATGA
TAGCAAAAGGTTTACGAGAGTAGAAATGGCAATTTTACTGAAAGAAAGAA
ATCAATTCAAAGAAAAGTATTTAGAATTACAAGAGGCTTTGCGATATACA
GAAATGGTGAGAGCCAGTCGTCAGCATCCGGATTTCGTTTTAGAACCCAG
GATTAAATCACAGTCAGGGATAATGGAATTTTTCCGAGGATTACTGAAAC
CCGACGAAGAATCAAACACATTAACTGAAGAGAAAAGAAAAGAAAATCCG
TTATCAGACGTATGTAAAGTGGACAAGAAATCCCATACAAAATTCCAAAA
ATGTTTCATATTCAAAGAAGACATTAACCGATCCCAGCTTTATGGTTGGT
CTGTACCTCGAGACTTATTGCAGTCGTCCGTTTCAAGCAACGTTCCAATT
CCTGTCGGGTCTCATTCCATTTTAGAACCTAAAGATTCGATAATTTGTGT
CACTAAATCTCCAAGTATGGAATGTTCCGATGAATTTCTATGGATAATCG
TAGAAAGGCCGGTTCGAGACGGAAGCGCATATTATTTGGCTCAGTTTTCC
TTGGCCAGCAGGCATGAAATTATTCCCAATACAATTTCTTATTTGAAAAT
TGCTAAAAAGCCTCTCGGTATTTTAGCAGTTCCAAAGATTTCCCAAGTAA
TTAGTGACCGTGCAATGCTATCCGAGGACAGTATTATATCTCCAGAACAT
TCGCCGTCAAAAAGACCGAGCTCAACTATTTCAGATAATGTCAAAGTCAG
TCGAGTTCACAATACAAGAGCTAAAGTTAAGCAGACCATCACTGACATAA
CGTACCAGACATTGTGGATTAATTACGACGATAAGATAGTGGTGGTATAT
TCAGTAACTGTCAATAATGTTTTCGACGGTCGCCTAGCTACGATATTTCT
TCCTGGATCAGTTTCGACAATGAAATATTGCCAGGGAAGAATAATAATTG
CTCAAACCGATGGCTGTTTGTGTGTGTTCGATCTCAAGCCTTGTCAAGAT
ACTTGGGAAGTGCAACAGTGTTTGGTGGTTGAAATGTCCCATAGTAGTCC
AATATCAGCTCTAGCTGGTCACAGGGATTCCGAATCTATCTGGTTTGGTT
CTGATCAGCAGTGCTATGTTATCGGTGTTTCGAAATTAAGATTAATGAAC
AGCTTCCATATCAATGGCAATCTTAGTGAAGAACACATGTGTCGTATCGA
GACTATTTGCGCGTCTCAAGATTCAGATCTAATGTGGATTAGTATGAGCC
AAGTTGGCACCTTATACGCCTATGACAGCTACAGTTATGAAATGAAACTC
TCTTTTGATTTCCGAACCAGTTTATTCGACATCATAGAATCAATTGATAA
ATGTTCCAAATTTCGATTTTCTTTCCCAATCATTACTGAAGACCGAGACC
GGCTGTGGCTGGGTTCAGACTGCGGGTTTATTGTTTGTTTGTCGAAACGA
CAGTTATTGAACGAGGGTCAAACGACCGAGTCTCAAAGGAACATATATGT
CAGTTGTCATGGATTTTCGGGATCTTTAGTCAGCATTGTTTCGCTACCAA
TTATAAATGCCAACTCGTCCTCATTAGCATCAACTCCAAATTCCTCCAAG
AGTTTGTCTCCAGCAATTAAAACCAAATCTCTGTCCAAAGAAATTTTCCA
GTCAACTGATTCAATTGTTACTAGTAAAAGTATTTCGGCCGTTCCATTAG
TTGTAGCTCTGGGTTCCAGTTACGTCAATCTCAACAGCAGTCCGTCTAAG
GGGGCCCCCGATGATGACATCAATCGTAACAATGTTCTTATATGGAAAAT
TTAATTGCTATTTTCAATATTGATCTCATGTGATTTTCTGCTTTTTGTTT
ATTGAAATTCGTTTTATTGATTTTTTCCAAAATCCTAATTATTATTATTG
ATTATTGATTA
back to top

protein sequence of SMED30031333-orf-1

>SMED30031333-orf-1 ID=SMED30031333-orf-1|Name=SMED30031333-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1006bp
MSIITETIYKNYEKLGLPDENNVIMSEKVQSMANGIYREFERLMESYDSA
VVKNLMPLIVTVLENLNELDKSKLNNDMEIELLREDNSALMNQYDKEKSN
RRFIEEKIMNLEYTFEDEKKTFMEKIENLEANIRLLELKSRNANDNLIRL
EEKEKEQKKEYQKLHERYTDIFKCHADLLERLKLSGNRNMSLLQKHSISK
FAKPLDMGMESNEVCDEANYKRYAQIDNYDLDLLEQTLSADWKDSARPEC
AADIIKENFDGQTEPNVLIDRSLETDSNIFDELTSDDMKSPKSPTIYFMK
DFDNDSDIDNDSEFGVGREIENMIKENQELVETKNALNIVKDDLIKKLDY
LTSENDMLRSVLDSNNNREIDLKARINSIEQEIKDLRHQNEDFKSKLENA
DEPNDSKRFTRVEMAILLKERNQFKEKYLELQEALRYTEMVRASRQHPDF
VLEPRIKSQSGIMEFFRGLLKPDEESNTLTEEKRKENPLSDVCKVDKKSH
TKFQKCFIFKEDINRSQLYGWSVPRDLLQSSVSSNVPIPVGSHSILEPKD
SIICVTKSPSMECSDEFLWIIVERPVRDGSAYYLAQFSLASRHEIIPNTI
SYLKIAKKPLGILAVPKISQVISDRAMLSEDSIISPEHSPSKRPSSTISD
NVKVSRVHNTRAKVKQTITDITYQTLWINYDDKIVVVYSVTVNNVFDGRL
ATIFLPGSVSTMKYCQGRIIIAQTDGCLCVFDLKPCQDTWEVQQCLVVEM
SHSSPISALAGHRDSESIWFGSDQQCYVIGVSKLRLMNSFHINGNLSEEH
MCRIETICASQDSDLMWISMSQVGTLYAYDSYSYEMKLSFDFRTSLFDII
ESIDKCSKFRFSFPIITEDRDRLWLGSDCGFIVCLSKRQLLNEGQTTESQ
RNIYVSCHGFSGSLVSIVSLPIINANSSSLASTPNSSKSLSPAIKTKSLS
KEIFQSTDSIVTSKSISAVPLVVALGSSYVNLNSSPSKGAPDDDINRNNV
LIWKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005078MAP-kinase scaffold activity
GO:0016301kinase activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
GO:0043410positive regulation of MAPK cascade
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039911JIP3/JIP4
IPR034744RH2
IPR034743RH1
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019143JNK/Rab-associated_protein-1_N
IPR032486JIP_LZII
IPR017986WD40_repeat_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 119..167
NoneNo IPR availableCOILSCoilCoilcoord: 80..107
NoneNo IPR availableCOILSCoilCoilcoord: 414..434
NoneNo IPR availableCOILSCoilCoilcoord: 369..396
NoneNo IPR availableCOILSCoilCoilcoord: 320..340
NoneNo IPR availableGENE3DG3DSA:1.20.5.1000coord: 311..385
e-value: 2.7E-22
score: 80.6
NoneNo IPR availablePANTHERPTHR13886:SF4JNK-INTERACTING PROTEIN 3coord: 20..547
coord: 641..985
NoneNo IPR availableSUPERFAMILYSSF101908Putative isomerase YbhEcoord: 674..896
IPR032486JNK-interacting protein, leucine zipper IIPFAMPF16471JIP_LZIIcoord: 314..384
e-value: 1.8E-22
score: 79.3
IPR019143JNK/Rab-associated protein-1, N-terminalPFAMPF09744Jnk-SapK_ap_Ncoord: 29..183
e-value: 4.4E-42
score: 144.0
IPR039911JNK-interacting protein 3/4PANTHERPTHR13886JNK/SAPK-ASSOCIATED PROTEINcoord: 20..547
coord: 641..985
IPR034744RH2 domainPROSITEPS51777RH2coord: 406..488
score: 15.459
IPR034743RH1 domainPROSITEPS51776RH1coord: 12..100
score: 16.922