G/T mismatch-specific thymine DNA glycosylase

Overview
NameG/T mismatch-specific thymine DNA glycosylase
Smed IDSMED30031331
Length (bp)4440
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G/T mismatch-specific thymine DNA glycosylase (SMED30031331) t-SNE clustered cells

Violin plots show distribution of expression levels for G/T mismatch-specific thymine DNA glycosylase (SMED30031331) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G/T mismatch-specific thymine DNA glycosylase (SMED30031331) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G/T mismatch-specific thymine DNA glycosylase (SMED30031331) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031331

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30031331SMESG000078127.1 dd_Smed_v4_3479_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031331SMESG000067021.1 SMESG000000954.1 dd_Smed_v4_4053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031331SMESG000067021.1 SMESG000000954.1 dd_Smed_v4_4053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031331SMESG000078127.1 dd_Smed_v4_3479_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031331SMESG000058206.1 SMESG000013025.1 dd_Smed_v4_5062_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031331SMESG000076347.1 dd_Smed_v4_5535_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 205.297 bits (521), Expect = 4.636e-57
Identity = 99/227 (43.61%), Postives = 148/227 (65.20%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMV-DYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSL 1017
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL    +   DD+ +   YGIGFTN+  R T G+ ++S KE + G  ++++K++KY+P+IAVFNGK IYE F      +  KN   G QP  +  T+ + +VMPSSSARCAQ PRA+DK+ ++I L+ LRD + G    +  QEV ++   + ++ Q D K +
Sbjct:  103 KVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYT--FDLQLAQEDAKKM 327          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 205.297 bits (521), Expect = 5.255e-57
Identity = 99/227 (43.61%), Postives = 148/227 (65.20%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMV-DYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSL 1017
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL    +   DD+ +   YGIGFTN+  R T G+ ++S KE + G  ++++K++KY+P+IAVFNGK IYE F      +  KN   G QP  +  T+ + +VMPSSSARCAQ PRA+DK+ ++I L+ LRD + G    +  QEV ++   + ++ Q D K +
Sbjct:   99 KVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYT--FDLQLAQEDAKKM 323          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 157.918 bits (398), Expect = 2.778e-42
Identity = 79/185 (42.70%), Postives = 116/185 (62.70%), Query Frame = 1
Query:  484 SACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMV-DYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSL 1017
            +A  GHHY G GNHFW C+  +GL    +   DD+ +   YGIGFTN+  R T G+ ++S KE + G  ++++K++KY+P+IAVFNGK IYE F      +  KN   G QP  +  T+ + +VMPSSSARCAQ PRA+DK+ ++I L+ LRD + G    +  QEV ++   + ++ Q D K +
Sbjct:    2 AAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYT--FDLQLAQEDAKKM 184          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 141.739 bits (356), Expect = 7.291e-37
Identity = 70/161 (43.48%), Postives = 103/161 (63.98%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMV-DYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTD 819
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW  ++E  L        DD+ +   YGIGFTN+  R T G+ ++S KE + G  ++++K++KY+P+IAVFNGK IYE F      +  KN   G QP  +  T+
Sbjct:  103 KVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFW--LSEVQL-----NHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTE 256          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Human
Match: TDG (thymine DNA glycosylase [Source:HGNC Symbol;Acc:HGNC:11700])

HSP 1 Score: 108.227 bits (269), Expect = 4.815e-27
Identity = 48/103 (46.60%), Postives = 70/103 (67.96%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMV-DYGIGFTNVCSRPTKGAAEISR 663
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL    +   DD+ +   YGIGFTN+  R T G+ ++SR
Sbjct:    7 KVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSR 109          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Fly
Match: Thd1 (gene:FBgn0026869 transcript:FBtr0333706)

HSP 1 Score: 275.789 bits (704), Expect = 1.196e-74
Identity = 113/212 (53.30%), Postives = 165/212 (77.83%), Query Frame = 1
Query:  340 ENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSD 975
            +  A  K R   DR+NG+SEEEV++RT+PD+L +NLD+++VGINP + +A  GHHYAG GNHFW C+  AGL  E ++  +D++++  GIGFTN+ +R TKG+A+++RKE+K G+ ++LEK+++++PK+AVFNGK I+E F G K F+ G+QP  +DGTD  ++VMPSSSARCAQLPRA DK+PF+ AL+K RD +NG +P + + E +F+D
Sbjct:  752 DQAAKPKERKKHDRFNGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGKKEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNGQIPHIDESECVFTD 963          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Fly
Match: Thd1 (gene:FBgn0026869 transcript:FBtr0345197)

HSP 1 Score: 275.789 bits (704), Expect = 1.196e-74
Identity = 113/212 (53.30%), Postives = 165/212 (77.83%), Query Frame = 1
Query:  340 ENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSD 975
            +  A  K R   DR+NG+SEEEV++RT+PD+L +NLD+++VGINP + +A  GHHYAG GNHFW C+  AGL  E ++  +D++++  GIGFTN+ +R TKG+A+++RKE+K G+ ++LEK+++++PK+AVFNGK I+E F G K F+ G+QP  +DGTD  ++VMPSSSARCAQLPRA DK+PF+ AL+K RD +NG +P + + E +F+D
Sbjct:  752 DQAAKPKERKKHDRFNGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGKKEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNGQIPHIDESECVFTD 963          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Fly
Match: Thd1 (gene:FBgn0026869 transcript:FBtr0089106)

HSP 1 Score: 275.789 bits (704), Expect = 1.196e-74
Identity = 113/212 (53.30%), Postives = 165/212 (77.83%), Query Frame = 1
Query:  340 ENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSD 975
            +  A  K R   DR+NG+SEEEV++RT+PD+L +NLD+++VGINP + +A  GHHYAG GNHFW C+  AGL  E ++  +D++++  GIGFTN+ +R TKG+A+++RKE+K G+ ++LEK+++++PK+AVFNGK I+E F G K F+ G+QP  +DGTD  ++VMPSSSARCAQLPRA DK+PF+ AL+K RD +NG +P + + E +F+D
Sbjct:  752 DQAAKPKERKKHDRFNGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMSADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIFEVFSGKKEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNGQIPHIDESECVFTD 963          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Zebrafish
Match: tdg.1 (thymine DNA glycosylase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-050522-44])

HSP 1 Score: 200.675 bits (509), Expect = 2.729e-55
Identity = 96/217 (44.24%), Postives = 142/217 (65.44%), Query Frame = 1
Query:  352 IKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVD-YGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGH------KNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYT 981
             KK +  +DR+ G+SEEEV++RTLPD L  NLD +++GINP + +A +G  + G GNHFW C+  +G   + +   DD  + + YGIGFTN+ +R T G+ ++S KE++ G  +++EK++++KP IAVFNGK IYE F         K    G QP  +  +D  +++MPSSSARCAQ PRA+DK+ F+I LR+LRD + G    +  +EV   +YT
Sbjct:  129 FKKVKRKVDRFKGMSEEEVMKRTLPDILIPNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTEKLLNHMDDQSLPEKYGIGFTNMVARATPGSKDLSSKELREGGKILVEKIKQFKPLIAVFNGKCIYEMFCRELFGKKPKTLEFGLQPHKIPDSDTALYLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLKG---VIKQKEVEEVNYT 342          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Zebrafish
Match: tdg.1 (thymine DNA glycosylase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-050522-44])

HSP 1 Score: 200.675 bits (509), Expect = 2.729e-55
Identity = 96/217 (44.24%), Postives = 142/217 (65.44%), Query Frame = 1
Query:  352 IKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVD-YGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGH------KNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYT 981
             KK +  +DR+ G+SEEEV++RTLPD L  NLD +++GINP + +A +G  + G GNHFW C+  +G   + +   DD  + + YGIGFTN+ +R T G+ ++S KE++ G  +++EK++++KP IAVFNGK IYE F         K    G QP  +  +D  +++MPSSSARCAQ PRA+DK+ F+I LR+LRD + G    +  +EV   +YT
Sbjct:  129 FKKVKRKVDRFKGMSEEEVMKRTLPDILIPNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTEKLLNHMDDQSLPEKYGIGFTNMVARATPGSKDLSSKELREGGKILVEKIKQFKPLIAVFNGKCIYEMFCRELFGKKPKTLEFGLQPHKIPDSDTALYLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLKG---VIKQKEVEEVNYT 342          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Zebrafish
Match: tdg.2 (thymine DNA glycosylase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131121-30])

HSP 1 Score: 197.593 bits (501), Expect = 1.072e-54
Identity = 96/218 (44.04%), Postives = 140/218 (64.22%), Query Frame = 1
Query:  349 AIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVD-YGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYT 981
            + KK++  +DR+NG+S EEV+ R LPD +  NLD++++GINP + SA  G HY   GNHFW C+  +GL  E +    D  + + YGIGFTN+  R T G+ ++S KE++ G   +LEK++ Y+P IAVFNGK IYE F      +  KN   G QP  +  T+ + ++MPSSS RCAQ PRA+DK+ F+I L++LRD + G       QE+  ++Y+
Sbjct:  108 SAKKAKRTLDRFNGMSVEEVMARKLPDVITHNLDMLIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTNEQLNHMHDQTLPEHYGIGFTNMVERTTPGSKDLSNKEIREGGHQLLEKLQTYRPLIAVFNGKCIYEIFCKEIFGVKAKNLEFGLQPYKVPETETVCYLMPSSSPRCAQFPRAQDKVHFYIKLKELRDQLKG---VTKTQEIQETNYS 322          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Zebrafish
Match: tdg.2 (thymine DNA glycosylase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131121-30])

HSP 1 Score: 197.593 bits (501), Expect = 1.176e-54
Identity = 96/218 (44.04%), Postives = 140/218 (64.22%), Query Frame = 1
Query:  349 AIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVD-YGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYT 981
            + KK++  +DR+NG+S EEV+ R LPD +  NLD++++GINP + SA  G HY   GNHFW C+  +GL  E +    D  + + YGIGFTN+  R T G+ ++S KE++ G   +LEK++ Y+P IAVFNGK IYE F      +  KN   G QP  +  T+ + ++MPSSS RCAQ PRA+DK+ F+I L++LRD + G       QE+  ++Y+
Sbjct:  109 SAKKAKRTLDRFNGMSVEEVMARKLPDVITHNLDMLIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTNEQLNHMHDQTLPEHYGIGFTNMVERTTPGSKDLSNKEIREGGHQLLEKLQTYRPLIAVFNGKCIYEIFCKEIFGVKAKNLEFGLQPYKVPETETVCYLMPSSSPRCAQFPRAQDKVHFYIKLKELRDQLKG---VTKTQEIQETNYS 323          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Zebrafish
Match: tdg.2 (thymine DNA glycosylase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131121-30])

HSP 1 Score: 105.531 bits (262), Expect = 4.956e-25
Identity = 47/105 (44.76%), Postives = 69/105 (65.71%), Query Frame = 1
Query:  349 AIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVD-YGIGFTNVCSRPTKGAAEIS 660
            + KK++  +DR+NG+S EEV+ R LPD +  NLD++++GINP + SA  G HY   GNHFW C+  +GL  E +    D  + + YGIGFTN+  R T G+ ++S
Sbjct:  108 SAKKAKRTLDRFNGMSVEEVMARKLPDVITHNLDMLIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTNEQLNHMHDQTLPEHYGIGFTNMVERTTPGSKDLS 212          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Xenopus
Match: tdg (thymine DNA glycosylase [Source:NCBI gene;Acc:448432])

HSP 1 Score: 207.608 bits (527), Expect = 1.660e-57
Identity = 101/225 (44.89%), Postives = 146/225 (64.89%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVD-YGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPK 1011
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL    +   DD+ + + YGIGFTN+  R T G+ ++S KE + G  ++LEK++KYKP++A FNGK IYE F      +  K F  G QP  +  TD + +VMPSSSARCAQ PRA+DK+  +I L++LR+ + G       QEV +S   + ++ Q D K
Sbjct:  138 KVKRKVDRFNGVSEAELMTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFLSGLSDMQLNHLDDHSLPEKYGIGFTNMVERTTPGSKDLSSKEFREGGRILLEKLQKYKPRVAAFNGKCIYEIFSKEIFGVKIKKFEFGIQPHRVPETDTVCYVMPSSSARCAQFPRAQDKVHHYIKLKELRNQLKGVESSREVQEVQYS--FDLQLAQADAK 360          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Xenopus
Match: tdg (thymine DNA glycosylase [Source:NCBI gene;Acc:448432])

HSP 1 Score: 207.608 bits (527), Expect = 2.712e-57
Identity = 101/225 (44.89%), Postives = 146/225 (64.89%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVD-YGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPK 1011
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL    +   DD+ + + YGIGFTN+  R T G+ ++S KE + G  ++LEK++KYKP++A FNGK IYE F      +  K F  G QP  +  TD + +VMPSSSARCAQ PRA+DK+  +I L++LR+ + G       QEV +S   + ++ Q D K
Sbjct:  151 KVKRKVDRFNGVSEAELMTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFLSGLSDMQLNHLDDHSLPEKYGIGFTNMVERTTPGSKDLSSKEFREGGRILLEKLQKYKPRVAAFNGKCIYEIFSKEIFGVKIKKFEFGIQPHRVPETDTVCYVMPSSSARCAQFPRAQDKVHHYIKLKELRNQLKGVESSREVQEVQYS--FDLQLAQADAK 373          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Xenopus
Match: tdg (thymine DNA glycosylase [Source:NCBI gene;Acc:448432])

HSP 1 Score: 205.682 bits (522), Expect = 1.224e-56
Identity = 101/225 (44.89%), Postives = 146/225 (64.89%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVD-YGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPK 1011
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL    +   DD+ + + YGIGFTN+  R T G+ ++S KE + G  ++LEK++KYKP++A FNGK IYE F      +  K F  G QP  +  TD + +VMPSSSARCAQ PRA+DK+  +I L++LR+ + G       QEV +S   + ++ Q D K
Sbjct:  138 KVKRKVDRFNGVSEAELMTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFLSGLSDMQLNHLDDHSLPEKYGIGFTNMVERTTPGSKDLSSKEFREGGRILLEKLQKYKPRVAAFNGKCIYEIFSKEIFGVKIKKFEFGIQPHRVPETDTVCYVMPSSSARCAQFPRAQDKVHHYIKLKELRNQLKGVESSREVQEVQYS--FDLQLAQADAK 360          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 203.756 bits (517), Expect = 9.139e-57
Identity = 99/227 (43.61%), Postives = 147/227 (64.76%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMV-DYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSL 1017
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL    +   DD+ +   YGIGFTN+  R T G+ ++S KE + G  ++++K++KY+P+IAVFNGK IYE F      +  KN   G QP  +  T+ + +VMPSSSARCAQ PRA+DK+ ++I L+ LRD + G       QEV ++   + ++ Q D K +
Sbjct:   90 KVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNADVQEVQYT--FDLQLAQEDAKKM 314          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 204.142 bits (518), Expect = 1.415e-56
Identity = 99/227 (43.61%), Postives = 147/227 (64.76%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMV-DYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSL 1017
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL    +   DD+ +   YGIGFTN+  R T G+ ++S KE + G  ++++K++KY+P+IAVFNGK IYE F      +  KN   G QP  +  T+ + +VMPSSSARCAQ PRA+DK+ ++I L+ LRD + G       QEV ++   + ++ Q D K +
Sbjct:  114 KVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNADVQEVQYT--FDLQLAQEDAKKM 338          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 151.369 bits (381), Expect = 5.515e-41
Identity = 71/161 (44.10%), Postives = 105/161 (65.22%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMV-DYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTD 819
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL    +   DD+ +   YGIGFTN+  R T G+ ++S KE + G  ++++K++KY+P+IAVFNGK IYE F      +  KN   G QP  +  T+
Sbjct:    6 KVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTE 166          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 108.227 bits (269), Expect = 3.274e-27
Identity = 48/103 (46.60%), Postives = 70/103 (67.96%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMV-DYGIGFTNVCSRPTKGAAEISR 663
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL    +   DD+ +   YGIGFTN+  R T G+ ++SR
Sbjct:    7 KVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSR 109          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Mouse
Match: Tdg (thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI:108247])

HSP 1 Score: 105.916 bits (263), Expect = 2.301e-25
Identity = 46/97 (47.42%), Postives = 65/97 (67.01%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMV-DYGIGFTNVCSRPTKG 645
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL    +   DD+ +   YGIGFTN+  R T G
Sbjct:   90 KVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPG 186          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. UniProt/SwissProt
Match: sp|Q13569|TDG_HUMAN (G/T mismatch-specific thymine DNA glycosylase OS=Homo sapiens OX=9606 GN=TDG PE=1 SV=2)

HSP 1 Score: 205.297 bits (521), Expect = 2.226e-56
Identity = 99/227 (43.61%), Postives = 148/227 (65.20%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMV-DYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSL 1017
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL    +   DD+ +   YGIGFTN+  R T G+ ++S KE + G  ++++K++KY+P+IAVFNGK IYE F      +  KN   G QP  +  T+ + +VMPSSSARCAQ PRA+DK+ ++I L+ LRD + G    +  QEV ++   + ++ Q D K +
Sbjct:  103 KVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYT--FDLQLAQEDAKKM 327          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. UniProt/SwissProt
Match: sp|P56581|TDG_MOUSE (G/T mismatch-specific thymine DNA glycosylase OS=Mus musculus OX=10090 GN=Tdg PE=1 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 9.894e-56
Identity = 99/227 (43.61%), Postives = 147/227 (64.76%), Query Frame = 1
Query:  358 KSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMV-DYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSL 1017
            K +  +DR+NG+SE E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL    +   DD+ +   YGIGFTN+  R T G+ ++S KE + G  ++++K++KY+P+IAVFNGK IYE F      +  KN   G QP  +  T+ + +VMPSSSARCAQ PRA+DK+ ++I L+ LRD + G       QEV ++   + ++ Q D K +
Sbjct:  114 KVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNADVQEVQYT--FDLQLAQEDAKKM 338          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. UniProt/SwissProt
Match: sp|O59825|TDG_SCHPO (G/U mismatch-specific uracil DNA glycosylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=thp1 PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.951e-24
Identity = 57/157 (36.31%), Postives = 92/157 (58.60%), Query Frame = 1
Query:  421 LPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVP--ETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVF-NGKGIYEAFIGH-------KNFYMGKQPKPLDGTDIIVFVMPSSSARCA 861
            +PDY+ EN   I+VG+NP +TS+  GH +A   N FW  + ++ L+      T  +D  +  +G+G TN+C+RP+   A++ ++EM+ GA ++ EK+++Y+P++ +F +GKGI+E            K F  G QP+     D  VFV  SSS R A
Sbjct:  142 VPDYICENPYAIIVGLNPGITSSLKGHAFASPSNRFWKMLNKSKLLEGNAEFTYLNDKDLPAHGLGITNLCARPSSSGADLRKEEMQDGARILYEKVKRYRPQVGLFISGKGIWEEMYKMLTGKKLPKTFVFGWQPEKFG--DANVFVGISSSGRAA 296          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. UniProt/SwissProt
Match: sp|Q6D9D7|MUG_PECAS (G/U mismatch-specific DNA glycosylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=mug PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.618e-21
Identity = 47/146 (32.19%), Postives = 74/146 (50.68%), Query Frame = 1
Query:  421 LPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARC 858
            + D L  NL ++  GINP +++A  G+H+A   N FW  I +AG     +T  ++  ++D G G T +  RPT  A E+ R E+  G   ++EKM +Y+P+     GK  +    G K    G+Q + +  T + V   PS   R 
Sbjct:    2 ITDILAMNLQVVFCGINPGLSTAHHGYHFANPNNRFWKVIHQAGFTERLLTPAEEQHLLDTGCGITMLVERPTVEATELGRDELLQGGNAIVEKMTRYQPRALAVLGKQAFSQAFGIKKVSWGRQERRIGETQVWVLPNPSGLNRA 147          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. UniProt/SwissProt
Match: sp|A8A4M5|MUG_ECOHS (G/U mismatch-specific DNA glycosylase OS=Escherichia coli O9:H4 (strain HS) OX=331112 GN=mug PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.157e-19
Identity = 47/145 (32.41%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  427 DYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCA 861
            D L   L ++  GINP ++SA  G  +A   N FW  I +AG     +   +   ++DY  G T +  RPT  A+E+S++E+ AG   ++EK+  Y+P+     GK  YE     +    GKQ   +  T I V   PS  +R +
Sbjct:    4 DILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLLDYRCGVTKLVDRPTVQASEVSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQRGAQWGKQTLTIGSTQIWVLPNPSGLSRVS 148          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. TrEMBL
Match: A0A3R7CLJ3 (G/T mismatch-specific thymine DNA glycosylase (Fragment) OS=Clonorchis sinensis OX=79923 GN=TDG PE=4 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 5.497e-119
Identity = 167/215 (77.67%), Postives = 195/215 (90.70%), Query Frame = 1
Query:  373 IDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSL 1017
            ++R+NGL+EE+V  + LPD+LKE LD+++VGINPS+ SA VGHHYAG GNHFWTCI++AGLVPE VTCYDD RM+DYGIGFTNVC+RPTKGAAE++RKEMKAGA +MLEKMRKY+PKIAVFNGKGIYEA++GHKNF MG+QP  LDGTD  +FVMPSSSARCAQLPRAEDKLPFF+ALRKLRD++ GDL  L D EV+F+DYTEFRVTQPDPKSL
Sbjct:   38 VERFNGLTEEDVKDKVLPDHLKEGLDIVIVGINPSLASASVGHHYAGPGNHFWTCISQAGLVPEMVTCYDDERMLDYGIGFTNVCTRPTKGAAELTRKEMKAGAAIMLEKMRKYRPKIAVFNGKGIYEAYVGHKNFSMGRQPTTLDGTDTTIFVMPSSSARCAQLPRAEDKLPFFVALRKLRDYIRGDLSELPDSEVVFADYTEFRVTQPDPKSL 252          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. TrEMBL
Match: A0A1S8WRA8 (Uracil-DNA glycosylase family protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_07237 PE=4 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 1.394e-118
Identity = 169/227 (74.45%), Postives = 200/227 (88.11%), Query Frame = 1
Query:  337 TENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSL 1017
            +++V    S   ++R+NGL+EE+V  + LPD+LKE LD+++VGINPS+ SA VGHHYAG GNHFWTCI++AGLVPE VTCYDD RM+DYGIGFTNVC+RPTKGAAE++RKEMKAGA +MLEKMRKY+PKIAVFNGKGIYEA++GHKNF MG+QP  LDGTD  +FVMPSSSARCAQLPRAEDKLPFF+ALRKLRD++ GDL  L D EV+F+DYTEFRVTQPDPKSL
Sbjct:   65 SDSVLGSPSSKDVERFNGLTEEDVKDKVLPDHLKEGLDIVIVGINPSLASASVGHHYAGPGNHFWTCISQAGLVPEMVTCYDDERMLDYGIGFTNVCTRPTKGAAELTRKEMKAGAAIMLEKMRKYRPKIAVFNGKGIYEAYVGHKNFSMGRQPTTLDGTDTTIFVMPSSSARCAQLPRAEDKLPFFVALRKLRDYIRGDLSELPDSEVVFADYTEFRVTQPDPKSL 291          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. TrEMBL
Match: A0A074ZXA2 (UDG domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_11500 PE=4 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 4.189e-118
Identity = 169/227 (74.45%), Postives = 200/227 (88.11%), Query Frame = 1
Query:  337 TENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSL 1017
            +++V    S   ++R+NGL+EE+V  + LPD+LKE LD+++VGINPS+ SA VGHHYAG GNHFWTCI++AGLVPE VTCYDD RM+DYGIGFTNVC+RPTKGAAE++RKEMKAGA +MLEKMRKY+PKIAVFNGKGIYEA++GHKNF MG+QP  LDGTD  +FVMPSSSARCAQLPRAEDKLPFF+ALRKLRD++ GDL  L D EV+F+DYTEFRVTQPDPKSL
Sbjct:   44 SDSVLGSPSSKDVERFNGLTEEDVKDKVLPDHLKEGLDIVIVGINPSLASASVGHHYAGPGNHFWTCISQAGLVPEMVTCYDDERMLDYGIGFTNVCTRPTKGAAELTRKEMKAGAAIMLEKMRKYRPKIAVFNGKGIYEAYVGHKNFSMGRQPTTLDGTDTTIFVMPSSSARCAQLPRAEDKLPFFVALRKLRDYIRGDLSELPDSEVVFADYTEFRVTQPDPKSL 270          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. TrEMBL
Match: A0A183PSR6 (UDG domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS17402 PE=4 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 1.531e-117
Identity = 167/218 (76.61%), Postives = 196/218 (89.91%), Query Frame = 1
Query:  361 SRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKS 1014
            S   I+R+N LSEEE+  ++LPD+LKE LD+++VGINPS+ SA VGHHYAG GNHFWTC+++AGLVP  V+CYDD +M+DYGIGFTNVC+RPTKGAAE++RKEMKAGA +MLEKMRKYKPKIAVFNGKGIYEA++GHKNF MG+QP  LDGTDI++FVMPSSSARCAQLPRAEDKLPFF+ALRKLRD+V GDL  L D EV+F+DYTEFRVTQPDPKS
Sbjct:    5 SAKEIERFNNLSEEELKNKSLPDHLKEGLDIVIVGINPSLASAHVGHHYAGPGNHFWTCLSQAGLVPMAVSCYDDSKMLDYGIGFTNVCTRPTKGAAELTRKEMKAGAAIMLEKMRKYKPKIAVFNGKGIYEAYVGHKNFCMGRQPTTLDGTDIVIFVMPSSSARCAQLPRAEDKLPFFLALRKLRDYVRGDLAELPDSEVVFADYTEFRVTQPDPKS 222          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. TrEMBL
Match: A0A4S2LXJ4 (UDG domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004173 PE=4 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 5.307e-115
Identity = 175/258 (67.83%), Postives = 211/258 (81.78%), Query Frame = 1
Query:  247 MLKIEAT-IDNNKSLRNDQNQDSQILSATTKTENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSL 1017
            ML + +T +  N ++   Q   S        +++V    S   ++R+NGL+EE+V  + LPD+LKE LD+++VGINPS+ SA VGHHYAG GNHFWTCI++AGLVPE VTCYDD RM+DYGIGFTNVC+RPTKGAAE++RKEMKAGA +MLEKMRKY+PKIAVFNGKGIYEA++GHKNF MG+QP  LDGTD  +FVMPSSSARCAQLPRAEDKLPFF+ALRKLRD++ GDL  L D EV+F+DYTEFRVTQPDPKSL
Sbjct:   34 MLPLSSTQLQTNDTITFSQTDISNGSVHAPSSDSVLGSPSSKDVERFNGLTEEDVKDKVLPDHLKEGLDIVIVGINPSLASASVGHHYAGPGNHFWTCISQAGLVPEMVTCYDDERMLDYGIGFTNVCTRPTKGAAELTRKEMKAGAAIMLEKMRKYRPKIAVFNGKGIYEAYVGHKNFSMGRQPTTLDGTDTTIFVMPSSSARCAQLPRAEDKLPFFVALRKLRDYIRGDLSELPDSEVVFADYTEFRVTQPDPKSL 291          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Cavefish
Match: tdg.2 (G/T mismatch-specific thymine DNA glycosylase-like [Source:NCBI gene;Acc:103045467])

HSP 1 Score: 202.216 bits (513), Expect = 3.289e-56
Identity = 97/217 (44.70%), Postives = 141/217 (64.98%), Query Frame = 1
Query:  352 IKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVD-YGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYT 981
            +KK +  +DR+NG+S EEV+ R LPD +  +LD++++GINP + SA  G HY   GNHFW C+  +GL  E +    D  + D +GIGFTN+  R T G+ ++S KE++ G   +LEK++ Y+P+IA FNGKGIYE F      +  KN   G QP  + GT+ + ++MPSSS RCAQ PRA+DK+ F+I L++LRD + G    + + EV  + YT
Sbjct:  112 VKKPKRTLDRFNGMSVEEVMARKLPDIITYDLDILIIGINPGLLSAYKGRHYPNPGNHFWKCLFLSGLTEEQLNYMHDQTLPDRHGIGFTNMVERTTPGSKDLSNKEIREGGKQLLEKLQMYRPRIAAFNGKGIYEIFCKEIFGVKAKNLEFGLQPYKVPGTETVCYLMPSSSPRCAQFPRAQDKVHFYIRLKELRDQMKG---VVKNPEVEETQYT 325          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Cavefish
Match: tdg.1 (G/T mismatch-specific thymine DNA glycosylase [Source:NCBI gene;Acc:103043944])

HSP 1 Score: 199.134 bits (505), Expect = 9.087e-55
Identity = 92/218 (42.20%), Postives = 142/218 (65.14%), Query Frame = 1
Query:  301 NQDSQILSATTKTENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVD-YGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGH------KNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNG 933
            ++D Q +    +  + + KK +  IDR+ G+SEEEV+++TLPD L  NLD +++GINP + +A +G  + G GNHFW C+  +G   + +    D  + + YGIGFTN+ +R T G+ ++S KE++ G  +++EK++++KP IAVFNGK IYE F         K    G QP  +  ++  +++MPSSSARCAQ PRA+DK+ F+I LR+LRD + G
Sbjct:  116 DKDGQPIEGAQEKIDESFKKVKRKIDRFKGMSEEEVMKKTLPDILTPNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTDQLLNHMHDQTLPEKYGIGFTNMVARATPGSKDLSSKELREGGKILVEKIKQFKPLIAVFNGKCIYEMFCREIFGKKPKTLEFGLQPHKIPDSETALYLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLKG 333          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Sea Lamprey
Match: tdg.2 (thymine DNA glycosylase, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131121-30])

HSP 1 Score: 211.46 bits (537), Expect = 6.613e-60
Identity = 99/218 (45.41%), Postives = 149/218 (68.35%), Query Frame = 1
Query:  349 AIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVD-YGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGH------KNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYT 981
            + +K +  +DR+NG++E E++ +TLPD L  NLD++++GINP + +A  GHHY G GNHFW C+  +GL  + +   DD  + + YGIGFTN+  R T G+ ++  KE++ G  ++L+K++K+KP IAVFNGK I+E F         KNF  G+QP  +  TDIIV+VMPSSSARCAQ PRA+DK+ F+I +++LR+   G  P   ++E+  ++YT
Sbjct:  149 SFQKVKRKVDRFNGVTEAELLLKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFLSGLTDQLLNHLDDKSLPEKYGIGFTNMVERTTPGSKDLKSKEIREGGKILLQKLQKFKPTIAVFNGKCIFEIFFKEVFGEKIKNFQFGEQPNKIPETDIIVYVMPSSSARCAQFPRAQDKVHFYIKMKELRNSTKGVTP---NEEIQETEYT 363          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Nematostella
Match: EDO42559 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S194])

HSP 1 Score: 205.682 bits (522), Expect = 8.346e-60
Identity = 95/197 (48.22%), Postives = 135/197 (68.53%), Query Frame = 1
Query:  337 TENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHV 927
            + N +  + R   ++Y G+SEE+V++  LPD + ENLD++ +GINP +TSA  GHHYAG  NHFW C+ ++GLVPE +T  DD +   YGIG TN+  R T+G++++SRKE+K G   ++ K+++ KP +A FNGKGIYE F   K   +G+Q K + GT+++V+VMPSSS R    PRA DKL FF  L+ LRD  
Sbjct:   28 SNNGSPARKRARPNKYGGMSEEDVMKLLLPDRVAENLDILFIGINPGLTSAYKGHHYAGPNNHFWPCLYDSGLVPEKLTFRDDEKCPAYGIGLTNIVERTTRGSSDLSRKEIKDGVDALIVKVKRLKPLVACFNGKGIYEIFSKSK-CEIGRQTKCIPGTNVVVYVMPSSSGRTMTYPRASDKLKFFTELKSLRDEA 223          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Medaka
Match: tdg.2 (G/T mismatch-specific thymine DNA glycosylase [Source:NCBI gene;Acc:101162834])

HSP 1 Score: 210.305 bits (534), Expect = 5.048e-58
Identity = 104/232 (44.83%), Postives = 151/232 (65.09%), Query Frame = 1
Query:  346 VAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVD-YGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF------IGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYT-EFRVTQPDPKSL 1017
            VA KK++  ++R+NG+S EEV+ +TLPD +  NLD++++GINP + SA  GHHY   GNHFW C+  +GL  E +    D  + + Y IGFTN+  R T G+ ++S KE++ G   +LEK++KYKP IA FNGKGIYE F      +  KN   G QP  +  T+ + ++MPSSS RCAQ PRA+DK+ F+I L++LRD + G LP     EV+ + Y+ + ++ + D K L
Sbjct:  251 VAAKKAKRTLNRFNGMSVEEVMAKTLPDVITYNLDILIIGINPGLLSAFKGHHYPNPGNHFWKCLFLSGLTEEQLNYMHDQNLPEKYSIGFTNMVERTTPGSKDLSSKEIREGGRQLLEKLQKYKPLIAAFNGKGIYEIFCKEIFGVKAKNLEFGLQPYKIPETETVCYLMPSSSPRCAQFPRAQDKVHFYIKLKELRDQMKGLLP---GGEVVETQYSFDLQLAKEDAKRL 479          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Medaka
Match: tdg.1 (thymine DNA glycosylase [Source:NCBI gene;Acc:101155844])

HSP 1 Score: 201.06 bits (510), Expect = 2.586e-55
Identity = 102/241 (42.32%), Postives = 152/241 (63.07%), Query Frame = 1
Query:  325 ATTKTENV--AIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRM-VDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF----IGHK--NFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYT-EFRVTQPDPKSL 1017
            A  K E +  + KK +  +DR+ G+SEEEV+++TLPD L  NLD +++GINP + +A +G  + G GNHFW C+  +G   + +    D  + V Y +GFTN+ +R T G+ ++S KE++ G  +++EK++KYKP IAVFNGK IYE F     G K      G QP  +   D+ +F+MPSSSARCAQ PRA+DK+ F+I LR+LRD + G      + E+   DY+ + ++ + D K L
Sbjct:  133 ADGKQEKIDESFKKVKRKVDRFKGMSEEEVMKKTLPDLLDHNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTEDQLNHMHDTTLPVKYKMGFTNMVARATPGSKDLSSKELREGGKILVEKLKKYKPLIAVFNGKCIYEMFCRELFGKKPQKLEFGLQPHKIPDCDVALFLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLKG---VRRNTEIEEVDYSFDLQLAKEDAKRL 370          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Medaka
Match: tdg.1 (thymine DNA glycosylase [Source:NCBI gene;Acc:101155844])

HSP 1 Score: 201.445 bits (511), Expect = 3.730e-54
Identity = 102/241 (42.32%), Postives = 152/241 (63.07%), Query Frame = 1
Query:  325 ATTKTENV--AIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRM-VDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAF----IGHK--NFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYT-EFRVTQPDPKSL 1017
            A  K E +  + KK +  +DR+ G+SEEEV+++TLPD L  NLD +++GINP + +A +G  + G GNHFW C+  +G   + +    D  + V Y +GFTN+ +R T G+ ++S KE++ G  +++EK++KYKP IAVFNGK IYE F     G K      G QP  +   D+ +F+MPSSSARCAQ PRA+DK+ F+I LR+LRD + G      + E+   DY+ + ++ + D K L
Sbjct:  133 ADGKQEKIDESFKKVKRKVDRFKGMSEEEVMKKTLPDLLDHNLDYVIIGINPGLMAAYIGRWFPGPGNHFWKCLFLSGFTEDQLNHMHDTTLPVKYKMGFTNMVARATPGSKDLSSKELREGGKILVEKLKKYKPLIAVFNGKCIYEMFCRELFGKKPQKLEFGLQPHKIPDCDVALFLMPSSSARCAQFPRAQDKVHFYIKLRELRDQLKG---VRRNTEIEEVDYSFDLQLAKEDAKRL 370          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Planmine SMEST
Match: SMESG000067021.1 (SMESG000067021.1)

HSP 1 Score: 1060.83 bits (2742), Expect = 0.000e+0
Identity = 561/562 (99.82%), Postives = 562/562 (100.00%), Query Frame = 1
Query:  109 MSMLLNENQQFDMNKTNFITTAYSNQSSNYQPIIQSFNKEIVTVSPMLKIEATIDNNKSLRNDQNQDSQILSATTKTENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSLXXXXXXXXXXXXQMLGTNCSADMFVSSSGKSRKNKSIYTNDRQIVKAEGHIGNMMSGTKDSIDLNMSSADLTPVTITDESVPQMDLPIALYNQSTGVISIVPSCDMFGGSNTFAFANGSPVLMLPSNPTNKSGNIIQNKNVSQVVTKPLILQQDANGQTYILTSPXXXXXXXXXXXXXXTATLVPIGTSNGNTTMALLQPSQLLTASGQMIDTGTATLSWGPPAQIHSXXXXXXXXXXXXXXXXXXSNGIVYQKAAVNN 1794
            MSMLLNENQQFDMNKTNFITTAYSNQ+SNYQPIIQSFNKEIVTVSPMLKIEATIDNNKSLRNDQNQDSQILSATTKTENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSLRKAERRRKRKAEQMLGTNCSADMFVSSSGKSRKNKSIYTNDRQIVKAEGHIGNMMSGTKDSIDLNMSSADLTPVTITDESVPQMDLPIALYNQSTGVISIVPSCDMFGGSNTFAFANGSPVLMLPSNPTNKSGNIIQNKNVSQVVTKPLILQQDANGQTYILTSPSQFIQTSNQIQNTQTATLVPIGTSNGNTTMALLQPSQLLTASGQMIDTGTATLSWGPPAQIHSQQQPQQQQQQQTQFITQTSNGIVYQKAAVNN
Sbjct:    1 MSMLLNENQQFDMNKTNFITTAYSNQNSNYQPIIQSFNKEIVTVSPMLKIEATIDNNKSLRNDQNQDSQILSATTKTENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSLRKAERRRKRKAEQMLGTNCSADMFVSSSGKSRKNKSIYTNDRQIVKAEGHIGNMMSGTKDSIDLNMSSADLTPVTITDESVPQMDLPIALYNQSTGVISIVPSCDMFGGSNTFAFANGSPVLMLPSNPTNKSGNIIQNKNVSQVVTKPLILQQDANGQTYILTSPSQFIQTSNQIQNTQTATLVPIGTSNGNTTMALLQPSQLLTASGQMIDTGTATLSWGPPAQIHSQQQPQQQQQQQTQFITQTSNGIVYQKAAVNN 562          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Planmine SMEST
Match: SMESG000067021.1 (SMESG000067021.1)

HSP 1 Score: 1060.06 bits (2740), Expect = 0.000e+0
Identity = 561/562 (99.82%), Postives = 562/562 (100.00%), Query Frame = 1
Query:  109 MSMLLNENQQFDMNKTNFITTAYSNQSSNYQPIIQSFNKEIVTVSPMLKIEATIDNNKSLRNDQNQDSQILSATTKTENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSLXXXXXXXXXXXXQMLGTNCSADMFVSSSGKSRKNKSIYTNDRQIVKAEGHIGNMMSGTKDSIDLNMSSADLTPVTITDESVPQMDLPIALYNQSTGVISIVPSCDMFGGSNTFAFANGSPVLMLPSNPTNKSGNIIQNKNVSQVVTKPLILQQDANGQTYILTSPXXXXXXXXXXXXXXTATLVPIGTSNGNTTMALLQPSQLLTASGQMIDTGTATLSWGPPAQIHSXXXXXXXXXXXXXXXXXXSNGIVYQKAAVNN 1794
            MSMLLNENQQFDMNKTNFITTAYSNQ+SNYQPIIQSFNKEIVTVSPMLKIEATIDNNKSLRNDQNQDSQILSATTKTENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSLRKAERRRKRKAEQMLGTNCSADMFVSSSGKSRKNKSIYTNDRQIVKAEGHIGNMMSGTKDSIDLNMSSADLTPVTITDESVPQMDLPIALYNQSTGVISIVPSCDMFGGSNTFAFANGSPVLMLPSNPTNKSGNIIQNKNVSQVVTKPLILQQDANGQTYILTSPSQFIQTSNQIQNTQTATLVPIGTSNGNTTMALLQPSQLLTASGQMIDTGTATLSWGPPAQIHSQQQPQQQQQQQTQFITQTSNGIVYQKAAVNN
Sbjct:    1 MSMLLNENQQFDMNKTNFITTAYSNQNSNYQPIIQSFNKEIVTVSPMLKIEATIDNNKSLRNDQNQDSQILSATTKTENVAIKKSRGHIDRYNGLSEEEVVQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLVPETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMRKYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARCAQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDPKSLRKAERRRKRKAEQMLGTNCSADMFVSSSGKSRKNKSIYTNDRQIVKAEGHIGNMMSGTKDSIDLNMSSADLTPVTITDESVPQMDLPIALYNQSTGVISIVPSCDMFGGSNTFAFANGSPVLMLPSNPTNKSGNIIQNKNVSQVVTKPLILQQDANGQTYILTSPSQFIQTSNQIQNTQTATLVPIGTSNGNTTMALLQPSQLLTASGQMIDTGTATLSWGPPAQIHSQQQPQQQQQQQTQFITQTSNGIVYQKAAVNN 562          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Planmine SMEST
Match: SMESG000058206.1 (SMESG000058206.1)

HSP 1 Score: 347.051 bits (889), Expect = 1.638e-97
Identity = 313/313 (100.00%), Postives = 313/313 (100.00%), Query Frame = 1
Query: 2332 VNNTFVNAQLNVQQMNYQHLAAPNVNAXXXXXXXXXXXXPASSMNMDASKHQNDMSGINNTAASISSNQPNDNILTXXXXXXXXXXXXXXXXXXGFVNSSVVQIQSKTPHTIQYLPAEPIAAAVXXXXXXXXXXXXQPEMSFASGKYANITVPSLELDELLSSQNKQMMFHPQNHEMSTGMMGNPHTNNMMMMGXXXXXXXXXXXXXXXXXLRLRAAVPGQGMPPGTMIMRXXXXXXXXXXXXXXXXXXXSFSGSGGNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGQLPPQSAHSHYISLEAAN 3270
            VNNTFVNAQLNVQQMNYQHLAAPNVNAQMQIQQQHQISQPASSMNMDASKHQNDMSGINNTAASISSNQPNDNILTNANNMAASNMNAPPASSAGFVNSSVVQIQSKTPHTIQYLPAEPIAAAVPGMGNNGMNNPNQPEMSFASGKYANITVPSLELDELLSSQNKQMMFHPQNHEMSTGMMGNPHTNNMMMMGQQQVESQQFRFQQHQQQLRLRAAVPGQGMPPGTMIMRQAQSQQPQQQQQQQLVLQQSFSGSGGNTMLDQQMKQQQIQRLMMINNNQICQQQQQQQQMIMSGQLPPQSAHSHYISLEAAN
Sbjct: 1343 VNNTFVNAQLNVQQMNYQHLAAPNVNAQMQIQQQHQISQPASSMNMDASKHQNDMSGINNTAASISSNQPNDNILTNANNMAASNMNAPPASSAGFVNSSVVQIQSKTPHTIQYLPAEPIAAAVPGMGNNGMNNPNQPEMSFASGKYANITVPSLELDELLSSQNKQMMFHPQNHEMSTGMMGNPHTNNMMMMGQQQVESQQFRFQQHQQQLRLRAAVPGQGMPPGTMIMRQAQSQQPQQQQQQQLVLQQSFSGSGGNTMLDQQMKQQQIQRLMMINNNQICQQQQQQQQMIMSGQLPPQSAHSHYISLEAAN 1655          

HSP 2 Score: 180.644 bits (457), Expect = 2.328e-45
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = 1
Query: 1837 ARCPQLCDPSWSMVXXXXXXXXXXXXXXXQNFPNMYPHHRGPTPPAALAASNGPMPSGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQPLTSNDIKPHLSQMNNMALTDQQQRFLTPMMNSIGPHDESAMMNRNLSNFQ 2331
            ARCPQLCDPSWSMVHPNYPHMPSHHHPMHQNFPNMYPHHRGPTPPAALAASNGPMPSGQNVSSNSSTTTTTSTSSKSKSKKRKSNAKATAASSTVSTTTSTATTSVSGSSNSNQPLTSNDIKPHLSQMNNMALTDQQQRFLTPMMNSIGPHDESAMMNRNLSNFQ
Sbjct:  872 ARCPQLCDPSWSMVHPNYPHMPSHHHPMHQNFPNMYPHHRGPTPPAALAASNGPMPSGQNVSSNSSTTTTTSTSSKSKSKKRKSNAKATAASSTVSTTTSTATTSVSGSSNSNQPLTSNDIKPHLSQMNNMALTDQQQRFLTPMMNSIGPHDESAMMNRNLSNFQ 1036          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Planmine SMEST
Match: SMESG000058206.1 (SMESG000058206.1)

HSP 1 Score: 347.436 bits (890), Expect = 1.767e-97
Identity = 313/313 (100.00%), Postives = 313/313 (100.00%), Query Frame = 1
Query: 2332 VNNTFVNAQLNVQQMNYQHLAAPNVNAXXXXXXXXXXXXPASSMNMDASKHQNDMSGINNTAASISSNQPNDNILTXXXXXXXXXXXXXXXXXXGFVNSSVVQIQSKTPHTIQYLPAEPIAAAVXXXXXXXXXXXXQPEMSFASGKYANITVPSLELDELLSSQNKQMMFHPQNHEMSTGMMGNPHTNNMMMMGXXXXXXXXXXXXXXXXXLRLRAAVPGQGMPPGTMIMRXXXXXXXXXXXXXXXXXXXSFSGSGGNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGQLPPQSAHSHYISLEAAN 3270
            VNNTFVNAQLNVQQMNYQHLAAPNVNAQMQIQQQHQISQPASSMNMDASKHQNDMSGINNTAASISSNQPNDNILTNANNMAASNMNAPPASSAGFVNSSVVQIQSKTPHTIQYLPAEPIAAAVPGMGNNGMNNPNQPEMSFASGKYANITVPSLELDELLSSQNKQMMFHPQNHEMSTGMMGNPHTNNMMMMGQQQVESQQFRFQQHQQQLRLRAAVPGQGMPPGTMIMRQAQSQQPQQQQQQQLVLQQSFSGSGGNTMLDQQMKQQQIQRLMMINNNQICQQQQQQQQMIMSGQLPPQSAHSHYISLEAAN
Sbjct: 1386 VNNTFVNAQLNVQQMNYQHLAAPNVNAQMQIQQQHQISQPASSMNMDASKHQNDMSGINNTAASISSNQPNDNILTNANNMAASNMNAPPASSAGFVNSSVVQIQSKTPHTIQYLPAEPIAAAVPGMGNNGMNNPNQPEMSFASGKYANITVPSLELDELLSSQNKQMMFHPQNHEMSTGMMGNPHTNNMMMMGQQQVESQQFRFQQHQQQLRLRAAVPGQGMPPGTMIMRQAQSQQPQQQQQQQLVLQQSFSGSGGNTMLDQQMKQQQIQRLMMINNNQICQQQQQQQQMIMSGQLPPQSAHSHYISLEAAN 1698          

HSP 2 Score: 181.03 bits (458), Expect = 2.263e-45
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = 1
Query: 1837 ARCPQLCDPSWSMVXXXXXXXXXXXXXXXQNFPNMYPHHRGPTPPAALAASNGPMPSGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQPLTSNDIKPHLSQMNNMALTDQQQRFLTPMMNSIGPHDESAMMNRNLSNFQ 2331
            ARCPQLCDPSWSMVHPNYPHMPSHHHPMHQNFPNMYPHHRGPTPPAALAASNGPMPSGQNVSSNSSTTTTTSTSSKSKSKKRKSNAKATAASSTVSTTTSTATTSVSGSSNSNQPLTSNDIKPHLSQMNNMALTDQQQRFLTPMMNSIGPHDESAMMNRNLSNFQ
Sbjct:  915 ARCPQLCDPSWSMVHPNYPHMPSHHHPMHQNFPNMYPHHRGPTPPAALAASNGPMPSGQNVSSNSSTTTTTSTSSKSKSKKRKSNAKATAASSTVSTTTSTATTSVSGSSNSNQPLTSNDIKPHLSQMNNMALTDQQQRFLTPMMNSIGPHDESAMMNRNLSNFQ 1079          
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Planmine SMEST
Match: SMESG000058206.1 (SMESG000058206.1)

HSP 1 Score: 347.051 bits (889), Expect = 1.883e-97
Identity = 313/313 (100.00%), Postives = 313/313 (100.00%), Query Frame = 1
Query: 2332 VNNTFVNAQLNVQQMNYQHLAAPNVNAXXXXXXXXXXXXPASSMNMDASKHQNDMSGINNTAASISSNQPNDNILTXXXXXXXXXXXXXXXXXXGFVNSSVVQIQSKTPHTIQYLPAEPIAAAVXXXXXXXXXXXXQPEMSFASGKYANITVPSLELDELLSSQNKQMMFHPQNHEMSTGMMGNPHTNNMMMMGXXXXXXXXXXXXXXXXXLRLRAAVPGQGMPPGTMIMRXXXXXXXXXXXXXXXXXXXSFSGSGGNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGQLPPQSAHSHYISLEAAN 3270
            VNNTFVNAQLNVQQMNYQHLAAPNVNAQMQIQQQHQISQPASSMNMDASKHQNDMSGINNTAASISSNQPNDNILTNANNMAASNMNAPPASSAGFVNSSVVQIQSKTPHTIQYLPAEPIAAAVPGMGNNGMNNPNQPEMSFASGKYANITVPSLELDELLSSQNKQMMFHPQNHEMSTGMMGNPHTNNMMMMGQQQVESQQFRFQQHQQQLRLRAAVPGQGMPPGTMIMRQAQSQQPQQQQQQQLVLQQSFSGSGGNTMLDQQMKQQQIQRLMMINNNQICQQQQQQQQMIMSGQLPPQSAHSHYISLEAAN
Sbjct: 1368 VNNTFVNAQLNVQQMNYQHLAAPNVNAQMQIQQQHQISQPASSMNMDASKHQNDMSGINNTAASISSNQPNDNILTNANNMAASNMNAPPASSAGFVNSSVVQIQSKTPHTIQYLPAEPIAAAVPGMGNNGMNNPNQPEMSFASGKYANITVPSLELDELLSSQNKQMMFHPQNHEMSTGMMGNPHTNNMMMMGQQQVESQQFRFQQHQQQLRLRAAVPGQGMPPGTMIMRQAQSQQPQQQQQQQLVLQQSFSGSGGNTMLDQQMKQQQIQRLMMINNNQICQQQQQQQQMIMSGQLPPQSAHSHYISLEAAN 1680          

HSP 2 Score: 180.644 bits (457), Expect = 2.359e-45
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = 1
Query: 1837 ARCPQLCDPSWSMVXXXXXXXXXXXXXXXQNFPNMYPHHRGPTPPAALAASNGPMPSGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQPLTSNDIKPHLSQMNNMALTDQQQRFLTPMMNSIGPHDESAMMNRNLSNFQ 2331
            ARCPQLCDPSWSMVHPNYPHMPSHHHPMHQNFPNMYPHHRGPTPPAALAASNGPMPSGQNVSSNSSTTTTTSTSSKSKSKKRKSNAKATAASSTVSTTTSTATTSVSGSSNSNQPLTSNDIKPHLSQMNNMALTDQQQRFLTPMMNSIGPHDESAMMNRNLSNFQ
Sbjct:  897 ARCPQLCDPSWSMVHPNYPHMPSHHHPMHQNFPNMYPHHRGPTPPAALAASNGPMPSGQNVSSNSSTTTTTSTSSKSKSKKRKSNAKATAASSTVSTTTSTATTSVSGSSNSNQPLTSNDIKPHLSQMNNMALTDQQQRFLTPMMNSIGPHDESAMMNRNLSNFQ 1061          
The following BLAST results are available for this feature:
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TDG4.636e-5743.61thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
TDG5.255e-5743.61thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
TDG2.778e-4242.70thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
TDG7.291e-3743.48thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
TDG4.815e-2746.60thymine DNA glycosylase [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Thd11.196e-7453.30gene:FBgn0026869 transcript:FBtr0333706[more]
Thd11.196e-7453.30gene:FBgn0026869 transcript:FBtr0345197[more]
Thd11.196e-7453.30gene:FBgn0026869 transcript:FBtr0089106[more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdg.12.729e-5544.24thymine DNA glycosylase, tandem duplicate 1 [Sourc... [more]
tdg.12.729e-5544.24thymine DNA glycosylase, tandem duplicate 1 [Sourc... [more]
tdg.21.072e-5444.04thymine DNA glycosylase, tandem duplicate 2 [Sourc... [more]
tdg.21.176e-5444.04thymine DNA glycosylase, tandem duplicate 2 [Sourc... [more]
tdg.24.956e-2544.76thymine DNA glycosylase, tandem duplicate 2 [Sourc... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tdg1.660e-5744.89thymine DNA glycosylase [Source:NCBI gene;Acc:4484... [more]
tdg2.712e-5744.89thymine DNA glycosylase [Source:NCBI gene;Acc:4484... [more]
tdg1.224e-5644.89thymine DNA glycosylase [Source:NCBI gene;Acc:4484... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tdg9.139e-5743.61thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
Tdg1.415e-5643.61thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
Tdg5.515e-4144.10thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
Tdg3.274e-2746.60thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
Tdg2.301e-2547.42thymine DNA glycosylase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13569|TDG_HUMAN2.226e-5643.61G/T mismatch-specific thymine DNA glycosylase OS=H... [more]
sp|P56581|TDG_MOUSE9.894e-5643.61G/T mismatch-specific thymine DNA glycosylase OS=M... [more]
sp|O59825|TDG_SCHPO1.951e-2436.31G/U mismatch-specific uracil DNA glycosylase OS=Sc... [more]
sp|Q6D9D7|MUG_PECAS4.618e-2132.19G/U mismatch-specific DNA glycosylase OS=Pectobact... [more]
sp|A8A4M5|MUG_ECOHS1.157e-1932.41G/U mismatch-specific DNA glycosylase OS=Escherich... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7CLJ35.497e-11977.67G/T mismatch-specific thymine DNA glycosylase (Fra... [more]
A0A1S8WRA81.394e-11874.45Uracil-DNA glycosylase family protein (Fragment) O... [more]
A0A074ZXA24.189e-11874.45UDG domain-containing protein OS=Opisthorchis vive... [more]
A0A183PSR61.531e-11776.61UDG domain-containing protein OS=Schistosoma matth... [more]
A0A4S2LXJ45.307e-11567.83UDG domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tdg.23.289e-5644.70G/T mismatch-specific thymine DNA glycosylase-like... [more]
tdg.19.087e-5542.20G/T mismatch-specific thymine DNA glycosylase [Sou... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tdg.26.613e-6045.41thymine DNA glycosylase, tandem duplicate 2 [Sourc... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO425598.346e-6048.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tdg.25.048e-5844.83G/T mismatch-specific thymine DNA glycosylase [Sou... [more]
tdg.12.586e-5542.32thymine DNA glycosylase [Source:NCBI gene;Acc:1011... [more]
tdg.13.730e-5442.32thymine DNA glycosylase [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of G/T mismatch-specific thymine DNA glycosylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067021.10.000e+099.82SMESG000067021.1[more]
SMESG000067021.10.000e+099.82SMESG000067021.1[more]
SMESG000058206.11.638e-97100.00SMESG000058206.1[more]
SMESG000058206.11.767e-97100.00SMESG000058206.1[more]
SMESG000058206.11.883e-97100.00SMESG000058206.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031331 ID=SMED30031331|Name=G/T mismatch-specific thymine DNA glycosylase|organism=Schmidtea mediterranea sexual|type=transcript|length=4440bp
TTTTAACTATAATTTCTAAAGAAATTCTCAAATTGATAATTTTTTATGCT
CAAACTTTTAGAATTTTAGAGGGAAATTTTTTTGACAAAACTTTGTTAAA
AATCAATAATGTCTATGTTGCTAAATGAAAACCAACAATTCGACATGAAC
AAAACCAATTTTATTACCACCGCATATAGCAACCAAAGTTCCAACTATCA
ACCAATCATTCAATCCTTCAATAAAGAAATTGTGACAGTTAGTCCAATGC
TGAAAATAGAAGCAACGATTGATAATAACAAGTCATTAAGAAACGATCAA
AATCAAGATTCACAAATACTGTCTGCAACAACGAAAACAGAGAATGTAGC
TATCAAGAAATCGCGAGGTCATATTGACAGATATAACGGTTTATCAGAAG
AAGAAGTCGTTCAGAGAACTTTACCGGATTATTTGAAAGAAAATCTAGAT
TTAATTGTGGTTGGAATAAATCCGAGTATGACATCAGCTTGTGTAGGACA
TCATTATGCGGGAATCGGAAATCATTTTTGGACATGTATTGCCGAAGCCG
GTCTGGTTCCGGAAACCGTGACATGTTATGATGACTATCGGATGGTTGAT
TATGGAATCGGATTTACAAATGTCTGCAGTCGTCCGACAAAAGGAGCAGC
TGAAATATCCAGAAAAGAAATGAAAGCCGGTGCCCTTGTGATGCTGGAAA
AAATGCGAAAGTATAAACCAAAAATCGCCGTATTTAATGGAAAAGGTATC
TACGAGGCATTTATCGGTCACAAGAATTTCTACATGGGCAAACAACCGAA
GCCATTAGATGGAACTGATATTATCGTATTTGTCATGCCGTCATCGAGTG
CCAGATGTGCTCAATTGCCGAGAGCGGAAGATAAATTACCGTTTTTCATT
GCTTTACGCAAGTTACGAGATCATGTCAATGGAGATCTCCCATTCCTGAG
TGACCAAGAAGTGATTTTTTCTGACTATACCGAATTTCGAGTCACTCAAC
CAGACCCAAAGAGTTTACGGAAAGCAGAACGAAGACGCAAGCGGAAAGCT
GAACAGATGCTTGGTACAAATTGCAGCGCAGATATGTTTGTGTCGTCAAG
TGGAAAATCGAGAAAAAACAAGAGTATTTATACGAATGACAGACAGATTG
TGAAGGCAGAAGGCCATATTGGAAATATGATGTCGGGAACAAAAGACAGT
ATCGATTTGAATATGAGTAGTGCAGATCTGACACCGGTAACGATAACTGA
TGAATCAGTTCCGCAAATGGATCTGCCCATCGCACTCTACAATCAATCAA
CTGGAGTAATTAGTATCGTTCCTAGTTGTGACATGTTTGGAGGTTCCAAC
ACTTTTGCGTTTGCTAATGGTAGTCCTGTTCTGATGTTGCCATCAAATCC
AACCAATAAATCAGGAAACATTATTCAAAACAAAAATGTATCTCAAGTCG
TAACGAAGCCACTAATACTTCAACAAGATGCCAATGGACAGACATATATA
TTAACATCTCCGTCCCAGTTTATCCAAACTTCTAATCAAATCCAAAACAC
TCAAACTGCTACATTAGTGCCAATAGGTACTTCTAATGGAAATACAACTA
TGGCACTTTTACAGCCAAGTCAACTGCTCACAGCTTCAGGTCAAATGATA
GATACTGGAACGGCTACTCTTTCATGGGGACCTCCTGCTCAGATTCACTC
ACAGCAACAACCACAGCAGCAGCAGCAACAACAAACACAATTCATTACTC
AAACATCTAATGGAATTGTATATCAGAAGGCAGCAGTCAATAATACAACC
CAGCAACAACAGCAACAGCAACAACAACAGCAACAAGCCCGTTGTCCACA
ACTATGTGATCCTTCATGGAGTATGGTACATCCTAATTATCCACATATGC
CTTCTCATCATCATCCGATGCATCAAAATTTTCCAAATATGTATCCTCAT
CACAGAGGTCCTACGCCTCCAGCAGCACTTGCAGCTAGTAATGGTCCAAT
GCCCAGTGGTCAAAATGTGTCGTCAAATTCTAGTACAACAACTACAACAT
CAACTTCGTCTAAATCAAAGTCTAAAAAACGCAAATCAAATGCAAAAGCC
ACTGCAGCATCATCGACAGTTTCTACGACTACCAGCACAGCCACAACATC
AGTTTCTGGAAGTTCGAATTCTAACCAACCTTTAACATCAAATGACATCA
AACCTCATCTATCCCAAATGAACAATATGGCTTTAACTGACCAGCAACAA
AGGTTTCTTACTCCAATGATGAATTCGATTGGTCCACATGACGAAAGTGC
CATGATGAATCGAAATTTGTCGAATTTTCAAGTCAACAATACGTTTGTTA
ATGCACAATTGAATGTTCAACAAATGAATTACCAGCATTTAGCAGCACCG
AATGTTAATGCACAAATGCAAATTCAACAACAACATCAAATATCTCAACC
GGCTAGCTCTATGAATATGGATGCTTCTAAACACCAAAATGACATGTCAG
GGATTAACAATACGGCAGCTTCGATTTCAAGCAATCAACCGAATGACAAT
ATACTAACCAATGCAAATAATATGGCCGCCAGTAATATGAATGCTCCCCC
TGCTAGTAGTGCTGGATTTGTTAACAGTAGTGTTGTACAGATCCAATCAA
AAACTCCTCATACTATTCAGTACTTACCTGCTGAACCGATTGCGGCCGCT
GTGCCGGGTATGGGAAATAATGGGATGAATAATCCAAACCAACCTGAAAT
GTCATTTGCATCTGGAAAATATGCCAACATCACGGTACCATCGCTTGAGT
TGGACGAATTACTTTCATCACAAAACAAACAAATGATGTTTCATCCTCAG
AATCACGAAATGTCAACTGGAATGATGGGGAATCCACACACCAATAATAT
GATGATGATGGGTCAACAACAAGTAGAATCTCAGCAATTTCGATTTCAAC
AGCATCAACAACAATTGCGTTTGAGAGCTGCTGTACCTGGCCAGGGAATG
CCTCCTGGAACTATGATCATGCGGCAGGCACAGTCTCAGCAACCGCAACA
ACAGCAGCAACAACAGTTAGTTCTACAGCAGTCATTCTCTGGATCTGGTG
GCAATACAATGCTTGATCAACAAATGAAACAACAGCAAATCCAGCGTTTG
ATGATGATCAACAATAATCAAATATGCCAACAACAACAGCAACAACAGCA
AATGATCATGTCGGGTCAATTGCCTCCTCAGTCGGCACATTCACATTATA
TTTCCCTAGAGGCTGCAAATCAAGATCAACAGCACATATATCAACAGCAA
CAGCTCATGGCAATTCAGCAGCAACAGATTAGACAACAATCACAAACCCA
TCATTGAACTTTAATCTACTTACAATTTATAAGTAGTTGAAACTTTGCCA
GGAGAATGTAAAGACATGCATTTGAAAATATTTTGTTTATCATTTTAGCT
ATCTGAATACTAAACAATACAATAAAACAACAACAACAACAACAATAATA
ATAATCCAAATATTATGCTCAATAATAATGGTAATGTTGATGTAAGACAG
AATTTCGCTGGGATGCCAAATGTCTATGGTAGGTCGATTTCGAAACCACC
AATTTTCCCAATGAACAATTCTGCAATGAATTGGCATGCAGATCCGTCTG
TAATGTCGCCAAATGGTGCTATACCAGATATGAGCCAATTACGTCTTGCC
AAAAATTTGTCTTGTCCCACTATCCCGGATAAAGTGATCGCCATAGTTAT
TAAAAAAGTGCAGCATAAGCATATTGATTTAATCAAATCATTGTGCATGG
AATCTGGAGCAATGATAAATTTTCAACTGAATCCTCAAGCTCAATCGATC
ATTGTTCAATTTACGAATTTTCAAGAGGCCTATCGCTATATAAACATTAT
CCAAAACCAACTTTCTCTTCGCGTAGAGCAAATCAACAGTCAAGATGAAT
ACATGCATTACATGTCCGGTGCTAATTGACATCTCTCTCTCACATTGCGC
ATCTCTCTCTCTCTCTCGCTCTCAGTAACATCACACCGACAACTCGTATC
TTATCCATCTTTTCTTTTCAGCACACACAAAAGCTCACTCAGTAGTCAAT
CAGTGATTCTTGACGCCGCCATATATTATATAGTACTTTCTGGCCGCCGT
CGCGTATCGGGCGCGGTGTCACAGAGCAACGGTGCGCGCGGTGCATGTCA
GACTGTCACTGCTATATATATATATATATACACTGACGTATTTATTATTA
TTTTTGCCTTGGTTCGATTTTTACACAGACCACTCGCTTTCCTCTCTGTC
TGTGTGTGTGCGTGCGTGCGTTCGCACGTTTGCGTGCTTGTGCTATTATT
ATTATTATTACGTTGTTGTTGTTGTTGTTGTCACATTTATCGATTTCAAT
GCCCAAATATCTTTCCTATCCCAACGAAACCTATCTGAAC
back to top

protein sequence of SMED30031331-orf-1

>SMED30031331-orf-1 ID=SMED30031331-orf-1|Name=SMED30031331-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
MLNNNGNVDVRQNFAGMPNVYGRSISKPPIFPMNNSAMNWHADPSVMSPN
GAIPDMSQLRLAKNLSCPTIPDKVIAIVIKKVQHKHIDLIKSLCMESGAM
INFQLNPQAQSIIVQFTNFQEAYRYINIIQNQLSLRVEQINSQDEYMHYM
SGAN*
back to top

protein sequence of SMED30031331-orf-2

>SMED30031331-orf-2 ID=SMED30031331-orf-2|Name=SMED30031331-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1083bp
MSMLLNENQQFDMNKTNFITTAYSNQSSNYQPIIQSFNKEIVTVSPMLKI
EATIDNNKSLRNDQNQDSQILSATTKTENVAIKKSRGHIDRYNGLSEEEV
VQRTLPDYLKENLDLIVVGINPSMTSACVGHHYAGIGNHFWTCIAEAGLV
PETVTCYDDYRMVDYGIGFTNVCSRPTKGAAEISRKEMKAGALVMLEKMR
KYKPKIAVFNGKGIYEAFIGHKNFYMGKQPKPLDGTDIIVFVMPSSSARC
AQLPRAEDKLPFFIALRKLRDHVNGDLPFLSDQEVIFSDYTEFRVTQPDP
KSLRKAERRRKRKAEQMLGTNCSADMFVSSSGKSRKNKSIYTNDRQIVKA
EGHIGNMMSGTKDSIDLNMSSADLTPVTITDESVPQMDLPIALYNQSTGV
ISIVPSCDMFGGSNTFAFANGSPVLMLPSNPTNKSGNIIQNKNVSQVVTK
PLILQQDANGQTYILTSPSQFIQTSNQIQNTQTATLVPIGTSNGNTTMAL
LQPSQLLTASGQMIDTGTATLSWGPPAQIHSQQQPQQQQQQQTQFITQTS
NGIVYQKAAVNNTTQQQQQQQQQQQQARCPQLCDPSWSMVHPNYPHMPSH
HHPMHQNFPNMYPHHRGPTPPAALAASNGPMPSGQNVSSNSSTTTTTSTS
SKSKSKKRKSNAKATAASSTVSTTTSTATTSVSGSSNSNQPLTSNDIKPH
LSQMNNMALTDQQQRFLTPMMNSIGPHDESAMMNRNLSNFQVNNTFVNAQ
LNVQQMNYQHLAAPNVNAQMQIQQQHQISQPASSMNMDASKHQNDMSGIN
NTAASISSNQPNDNILTNANNMAASNMNAPPASSAGFVNSSVVQIQSKTP
HTIQYLPAEPIAAAVPGMGNNGMNNPNQPEMSFASGKYANITVPSLELDE
LLSSQNKQMMFHPQNHEMSTGMMGNPHTNNMMMMGQQQVESQQFRFQQHQ
QQLRLRAAVPGQGMPPGTMIMRQAQSQQPQQQQQQQLVLQQSFSGSGGNT
MLDQQMKQQQIQRLMMINNNQICQQQQQQQQMIMSGQLPPQSAHSHYISL
EAANQDQQHIYQQQQLMAIQQQQIRQQSQTHH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036895Uracil-DNA_glycosylase-like_sf
IPR015637MUG/TDG
IPR005122Uracil-DNA_glycosylase-like
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
Vocabulary: molecular function
TermDefinition
GO:0019104DNA N-glycosylase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005122Uracil-DNA glycosylase-likePFAMPF03167UDGcoord: 106..252
e-value: 7.2E-17
score: 61.8
IPR036895Uracil-DNA glycosylase-like domain superfamilyGENE3DG3DSA:3.40.470.10coord: 86..280
e-value: 7.4E-71
score: 239.9
IPR036895Uracil-DNA glycosylase-like domain superfamilySUPERFAMILYSSF52141Uracil-DNA glycosylase-likecoord: 104..270
IPR015637G/U mismatch-specific DNA glycosylasePANTHERPTHR12159G/T AND G/U MISMATCH-SPECIFIC DNA GLYCOSYLASEcoord: 38..542
IPR015637G/U mismatch-specific DNA glycosylaseCDDcd10028UDG_F2_MUGcoord: 105..267
e-value: 2.52939E-68
score: 216.234
NoneNo IPR availablePANTHERPTHR12159:SF9G/T MISMATCH-SPECIFIC THYMINE DNA GLYCOSYLASEcoord: 38..542