DDE_Tnp_IS1595 domain-containing protein

Overview
NameDDE_Tnp_IS1595 domain-containing protein
Smed IDSMED30031330
Length (bp)881
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DDE_Tnp_IS1595 domain-containing protein (SMED30031330) t-SNE clustered cells

Violin plots show distribution of expression levels for DDE_Tnp_IS1595 domain-containing protein (SMED30031330) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DDE_Tnp_IS1595 domain-containing protein (SMED30031330) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DDE_Tnp_IS1595 domain-containing protein (SMED30031330) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031330

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30031330h1SMcG0010140 dd_Smed_v4_18947_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30031330h1SMcG0010140 dd_Smed_v4_18947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30031330h1SMcG0010140 dd_Smed_v4_18947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30031330h1SMcG0010140 dd_Smed_v4_18947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30031330h1SMcG0010140 dd_Smed_v4_18947_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30031330h1SMcG0010140 dd_Smed_v4_18947_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-17m8.2 (si:dkey-17m8.2 [Source:ZFIN;Acc:ZDB-GENE-110411-234])

HSP 1 Score: 47.7506 bits (112), Expect = 7.241e-6
Identity = 24/55 (43.64%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  551 VTDRSAATLMPLITQ*ILSATAIMSDQWSAYNERTAAAGMSYSHETVNNSLRFID 715
            V DRS  TL+P+IT+ I   + + SD W AY    A   + Y H TVN+S  F+D
Sbjct:  200 VKDRSRTTLVPIITRHIRRGSTVYSDNWRAYL--NALQPLRYRHLTVNHSENFVD 252          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-6f10.4 (si:dkey-6f10.4 [Source:ZFIN;Acc:ZDB-GENE-041210-340])

HSP 1 Score: 47.7506 bits (112), Expect = 8.324e-6
Identity = 24/55 (43.64%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  551 VTDRSAATLMPLITQ*ILSATAIMSDQWSAYNERTAAAGMSYSHETVNNSLRFID 715
            V DRS  TL+P+IT+ I   + + SD W AY    A   + Y H TVN+S  F+D
Sbjct:  219 VKDRSRTTLVPIITRHIRRGSTVYSDNWRAYL--NALQPLRYRHLTVNHSENFVD 271          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-6f10.4 (si:dkey-6f10.4 [Source:ZFIN;Acc:ZDB-GENE-041210-340])

HSP 1 Score: 47.7506 bits (112), Expect = 8.324e-6
Identity = 24/55 (43.64%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  551 VTDRSAATLMPLITQ*ILSATAIMSDQWSAYNERTAAAGMSYSHETVNNSLRFID 715
            V DRS  TL+P+IT+ I   + + SD W AY    A   + Y H TVN+S  F+D
Sbjct:  219 VKDRSRTTLVPIITRHIRRGSTVYSDNWRAYL--NALQPLRYRHLTVNHSENFVD 271          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A085LRT0 (DDE_Tnp_IS1595 domain-containing protein OS=Trichuris suis OX=68888 GN=M513_11467 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.781e-32
Identity = 41/92 (44.57%), Postives = 61/92 (66.30%), Query Frame = 3
Query:  252 IEVIFQEVILFIYSWSKELTSIKFCENELDISKSAVINWNMYMREVCVNSLLRNPVIIGGPNTIVEINESFFTRCKNHVRR---QQWVFGGI 518
            +++ F+  +LFIYSWS +  S KFC  EL +S +  ++W   +REV   SLL NP++IGGPN  VE++E+ + + K H  R   +QWVFGG+
Sbjct:   75 LKLDFRTAVLFIYSWSNDYCSTKFCSKELGLSTNCSVSWKRLLREVAAESLLSNPLVIGGPNCTVEVDETLYAKSKFHRGRRYLKQWVFGGV 166          

HSP 2 Score: 45.4394 bits (106), Expect = 1.781e-32
Identity = 22/63 (34.92%), Postives = 37/63 (58.73%), Query Frame = 2
Query:  524 DSGESSMFAVTDRSAATLMPLITQ*ILSATAIMSDQWSAYNERTAAAGMSYSHETVNNSLRFI 712
            ++ ES +  V + S+ TL+PLI Q I   T +M+D W+ Y    + +   Y+H  VN+S+ F+
Sbjct:  169 ETRESFLVPVANHSSQTLIPLIRQYIRPGTTVMTDCWAGYR---SLSREDYTHLRVNHSINFV 228          

HSP 3 Score: 38.1206 bits (87), Expect = 1.781e-32
Identity = 16/35 (45.71%), Postives = 24/35 (68.57%), Query Frame = 1
Query:  733 IDSYFREYVWINHVKMRHDDPFDTIMEDIVRFWPP 837
            +DSY  E++W   ++  ++DPFD I+ DI R WPP
Sbjct:  262 LDSYLCEFMWRRRLRP-NEDPFDKILGDIARNWPP 295          

HSP 4 Score: 30.8018 bits (68), Expect = 1.781e-32
Identity = 18/71 (25.35%), Postives = 34/71 (47.89%), Query Frame = 1
Query:   70 IHDISSSVRFLQLRSILHNPRI*SNN*CMVLSL--TNIHDHLQCSRRSCRETIHVPRDI*MQGSKLSFRKS 276
            + D  +++RFLQ + ILH  R+ +    M L++         +C +  C+  + +      +G KL FR +
Sbjct:   12 LSDEDTAIRFLQEKGILHQQRLCTRGHAMKLTVERNGKTPRWRCRKAECKTEVPLRTGTWFEGLKLDFRTA 82          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A0A9YMJ9 (Putative transposase-like protein HI_1328.1 OS=Lygus hesperus OX=30085 GN=CM83_19026 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.246e-29
Identity = 50/97 (51.55%), Postives = 66/97 (68.04%), Query Frame = 3
Query:  270 EVILFIYSWSKELTSIKFCENELDISKSAVINWNMYMREVCVNSLLRNPVIIGGPNTIVEINESFFTRCKNHVRR---QQWVFGGIVVIREKVPCSL 551
            +++LFIY+W+ E+ S+KFCE EL ++ + V++W  YM EVC NS+LR    IGGPN  VEI+ES F+R KNH  R   QQ +FGGI   RE   C L
Sbjct:   77 DIVLFIYAWANEMVSVKFCEKELSMNHNTVVDWCNYMHEVCANSILRIQSRIGGPNMTVEIDESLFSRRKNHTGRQLPQQRIFGGIC--RETKECFL 171          

HSP 2 Score: 58.151 bits (139), Expect = 1.246e-29
Identity = 30/64 (46.88%), Postives = 41/64 (64.06%), Query Frame = 2
Query:  524 DSGESSMFAVTDRSAATLMPLITQ*ILSATAIMSDQWSAYNERTAAAGMSYSHETVNNSLRFID 715
            ++ E  + AV DR++ATLM +I   I+  T IMSDQWSAY     A   ++ H TVN+SL F+D
Sbjct:  165 ETKECFLVAVPDRTSATLMSVIKDRIMPGTTIMSDQWSAYG--ALARDPNFRHFTVNHSLNFVD 226          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A146LFY4 (Putative transposase-like protein HI_1328.1 OS=Lygus hesperus OX=30085 GN=HI_1328.1_3 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.929e-29
Identity = 50/97 (51.55%), Postives = 65/97 (67.01%), Query Frame = 3
Query:  270 EVILFIYSWSKELTSIKFCENELDISKSAVINWNMYMREVCVNSLLRNPVIIGGPNTIVEINESFFTRCKNHVRR---QQWVFGGIVVIREKVPCSL 551
            +++LFIY+W+ E+ S+KFCE EL ++ + V+ W  YM EVC NS+LR    IGGPN  VEI+ES F+R KNH  R   QQ +FGGI   RE   C L
Sbjct:   77 DIVLFIYAWADEMVSVKFCEKELSMNHNTVVGWCNYMHEVCANSILRIQSRIGGPNMTVEIDESLFSRRKNHTGRQLPQQRIFGGIC--RETKECFL 171          

HSP 2 Score: 58.151 bits (139), Expect = 1.929e-29
Identity = 30/64 (46.88%), Postives = 41/64 (64.06%), Query Frame = 2
Query:  524 DSGESSMFAVTDRSAATLMPLITQ*ILSATAIMSDQWSAYNERTAAAGMSYSHETVNNSLRFID 715
            ++ E  + AV DR++ATLM +I   I+  T IMSDQWSAY     A   ++ H TVN+SL F+D
Sbjct:  165 ETKECFLVAVPDRTSATLMSVIKDRIMPGTTIMSDQWSAYG--ALARDPNFRHFTVNHSLNFVD 226          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A0L8G6F6 (DDE_Tnp_IS1595 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22039385mg PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.175e-27
Identity = 45/94 (47.87%), Postives = 62/94 (65.96%), Query Frame = 3
Query:  246 ARIEVIFQEVILFIYSWSKELTSIKFCENELDISKSAVINWNMYMREVCVNSLLRNPVIIGGPNTIVEINESFFTRCKNHVRRQ---QWVFGGI 518
            A   + F +   FIY W+ +L S+ FCE+EL++  S +++WN Y+REVC   +L NP +IGGPN  VEI+ES FT+ K+   RQ   Q VFGGI
Sbjct:   68 ANSRLSFHKAAFFIYCWAHDLASVNFCEHELEMKASCIVDWNNYLREVCAAHILSNPKVIGGPNMTVEIDESLFTKRKSCAGRQPPRQLVFGGI 161          

HSP 2 Score: 55.0694 bits (131), Expect = 1.175e-27
Identity = 29/64 (45.31%), Postives = 38/64 (59.38%), Query Frame = 2
Query:  524 DSGESSMFAVTDRSAATLMPLITQ*ILSATAIMSDQWSAYNERTAAAGMSYSHETVNNSLRFID 715
            ++ E  MF V DRSA TL+P+I   I   T I+S +WS Y E    +G  + H TV NSL F+D
Sbjct:  164 ETKECFMFTVPDRSATTLLPIIENNIRPGTTIISAEWSTY-ENIINSG-RFQHLTVKNSLHFVD 225          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Match: A0A0L8GRY1 (DDE_Tnp_IS1595 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22029068mg PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 7.438e-26
Identity = 40/79 (50.63%), Postives = 55/79 (69.62%), Query Frame = 3
Query:  246 ARIEVIFQEVILFIYSWSKELTSIKFCENELDISKSAVINWNMYMREVCVNSLLRNPVIIGGPNTIVEINESFFTRCKN 482
            A   + F +  LFIY W+  +TSIKF E+EL++  + V++WN Y+REVC   +L NP +IGGPN  VEIN+S FT+ KN
Sbjct:   10 ANSRLSFHKAALFIYRWAYNMTSIKFYEHELEMKANCVVDWNNYLREVCAAHILANPRVIGGPNMTVEINKSVFTKRKN 88          

HSP 2 Score: 41.5874 bits (96), Expect = 7.438e-26
Identity = 22/51 (43.14%), Postives = 29/51 (56.86%), Query Frame = 2
Query:  560 RSAATLMPLITQ*ILSATAIMSDQWSAYNERTAAAGMSYSHETVNNSLRFI 712
             SA TL+P+I   I   T I+SD+WSAY          + H TVN+SL F+
Sbjct:  101 ESATTLLPIIEDNIRLGTTIISDEWSAYKHIINIG--HFQHLTVNHSLHFV 149          

HSP 3 Score: 36.5798 bits (83), Expect = 7.438e-26
Identity = 17/51 (33.33%), Postives = 30/51 (58.82%), Query Frame = 1
Query:  688 SE*QPTFHRS*YPHMIDSYFREYVWINHVKMRHDDPFDTIMEDIVRFWPPE 840
            S+ Q + HR     ++DSY  ++ W   + ++  DP ++I + IV FWPP+
Sbjct:  171 SKRQNSTHRC----LLDSYMCKFKWQQEIGLKVLDPCNSIPQHIVDFWPPQ 217          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Nematostella
Match: EDO42124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2D6])

HSP 1 Score: 58.9214 bits (141), Expect = 4.259e-10
Identity = 36/98 (36.73%), Postives = 56/98 (57.14%), Query Frame = 3
Query:  246 ARIEVIFQEVILFIYSWSKEL---TSIKFCENELDISKSAVINWNMYMREVCVNSLLRNPVI-IGGPNTIVEINESFFTRCKNHVR-----RQQWVFG 512
             RIE+   ++++ I+SW+K+L   TS + C    D+S+ AV + +  +R++C   L R PVI  GGP  + +I+ES F     H R     R+ WVFG
Sbjct:  130 PRIEL--SKIVIIIHSWAKKLKQKTSAEMC----DVSERAVGHISARIRDICAEDLRRRPVIPFGGPGVVCQIDESRFNHKPKHNRGRPPMRENWVFG 221          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Nematostella
Match: EDO49358 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG49])

HSP 1 Score: 37.7354 bits (86), Expect = 2.072e-7
Identity = 25/99 (25.25%), Postives = 48/99 (48.48%), Query Frame = 3
Query:  264 FQEVILFIYSWSKELTSIKFCENELDISKSAVINWNMYMREVCVNSLLRNPVI-IGGPNTIVEINESFFTRCKNHVR----RQQWVFGGIVVIREKVPC 545
              ++++ IY WS E+  ++     L ++   V      +R +C   ++  PV   GGPN + + +E+  +  + + R    RQ+WVFG +    +  PC
Sbjct:   79 LSKLVVLIYFWSVEVLQVQ-ASTMLGMTPQMVGKVCRALRLLCSRDVVDRPVYPFGGPNHVCKCDETVISFKRKYGRGRISRQRWVFGQVTTAFQ--PC 174          

HSP 2 Score: 34.2686 bits (77), Expect = 2.072e-7
Identity = 18/56 (32.14%), Postives = 25/56 (44.64%), Query Frame = 2
Query:  548 AVTDRSAATLMPLITQ*ILSATAIMSDQWSAYNERTAAAGMSYSHETVNNSLRFID 715
             V  R+   L P+I + +   +   SD W AY   TA A    SH  V +   F+D
Sbjct:  180 VVNKRTREVLAPIIQEVLQPGSVFHSDDWGAYRNITAHAPNVSSHRVVVHKDYFVD 235          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Nematostella
Match: EDO42125 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2D7])

HSP 1 Score: 46.595 bits (109), Expect = 1.248e-6
Identity = 25/64 (39.06%), Postives = 36/64 (56.25%), Query Frame = 3
Query:  339 DISKSAVINWNMYMREVCVNSLLRNPVI-IGGPNTIVEINESFFTRCKNHVR-----RQQWVFG 512
            D+S+ AV + +  +R++C   L R PVI  GGP  + +I+ES F     H R     R+ WVFG
Sbjct:    3 DVSERAVGHISARIRDICAEDLRRRPVIPFGGPGVVCQIDESRFNHKPKHNRGRPPMRENWVFG 66          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Match: SMESG000036215.1 (SMESG000036215.1)

HSP 1 Score: 100.523 bits (249), Expect = 4.323e-26
Identity = 44/61 (72.13%), Postives = 54/61 (88.52%), Query Frame = 3
Query:  276 ILFIYSWSKELTSIKFCENELDISKSAVINWNMYMREVCVNSLLRNPVIIGGPNTIVEINE 458
            I+FIY WSKELTSI+FCE EL+I KS+VI+WN YMREVC N+L+ NP++IGGPNT VEI+E
Sbjct:   28 IIFIYCWSKELTSIRFCETELEIFKSSVIDWNNYMREVCANTLINNPIVIGGPNTTVEIDE 88          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Match: SMESG000079576.1 (SMESG000079576.1)

HSP 1 Score: 53.1434 bits (126), Expect = 4.983e-11
Identity = 31/69 (44.93%), Postives = 43/69 (62.32%), Query Frame = 1
Query:   67 VIHDISSSVRFLQLRSILHNPRI*SNN*CMVLSLTNIHDHLQCSRRSCRETIHVPRDI*MQGSKLSFRK 273
            VIHD  SS+ FLQ R I+HN R+ SN   M L L++ H   +   R+CR T+ + +   ++GSKL FRK
Sbjct:    9 VIHDERSSMVFLQQRDIIHNKRLCSNGHSMKLDLSDTHCRWRYHIRTCRMTVALRQGTWLKGSKLPFRK 77          

HSP 2 Score: 32.3426 bits (72), Expect = 4.983e-11
Identity = 13/25 (52.00%), Postives = 19/25 (76.00%), Query Frame = 3
Query:  264 FQEVILFIYSWSKELTSIKFCENEL 338
            F++VILFIY W+ E+TS+ + E  L
Sbjct:   75 FRKVILFIYCWAHEMTSVDYIECML 99          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Match: SMESG000074868.1 (SMESG000074868.1)

HSP 1 Score: 43.1282 bits (100), Expect = 1.938e-9
Identity = 25/94 (26.60%), Postives = 52/94 (55.32%), Query Frame = 3
Query:  246 ARIEVIFQEVILFIYSWSKELTSIKFCENELDISKSAVINWNMYMREVCVNSLLRNPVIIGGPNTIVEINESFFT-RCKNHVRR----QQWVFG 512
            A   +  + +++  +++S+E+  + F +NELD S++ +I +   +R +C +      +++G   +IVE++ES F  + K H  R    + WV G
Sbjct:   81 ASFNISLKNILVIFWTFSQEIQIVDF-KNELDCSENTIIKFYGALRRLCRDYYAGKRIVLGDTQSIVEVDESLFRHKPKYHRGRATLNEAWVVG 173          

HSP 2 Score: 37.3502 bits (85), Expect = 1.938e-9
Identity = 19/58 (32.76%), Postives = 31/58 (53.45%), Query Frame = 2
Query:  542 MFAVTDRSAATLMPLITQ*ILSATAIMSDQWSAYNERTAAAGMSYSHETVNNSLRFID 715
            M  V  RSA +L+P++ + I   + + +D W AY          + H+TVN+ L F+D
Sbjct:  186 MQLVRSRSAESLLPILLKKIHPESIVRTDMWRAY----FNLNRLFEHQTVNHRLCFVD 239          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Match: SMESG000054196.1 (SMESG000054196.1)

HSP 1 Score: 50.8322 bits (120), Expect = 2.295e-7
Identity = 26/64 (40.62%), Postives = 34/64 (53.12%), Query Frame = 2
Query:  524 DSGESSMFAVTDRSAATLMPLITQ*ILSATAIMSDQWSAYNERTAAAGMSYSHETVNNSLRFID 715
            D+ E  MF V  R AATL+PLI + +   T I+SD W AY        + + HE V +   FID
Sbjct:   94 DTNEMFMFYVEKRDAATLLPLIVEHVEPGTTIVSDGWRAY---LNIISLGFFHEVVKHEENFID 154          
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Match: SMESG000079181.1 (SMESG000079181.1)

HSP 1 Score: 39.6614 bits (91), Expect = 1.223e-6
Identity = 26/65 (40.00%), Postives = 35/65 (53.85%), Query Frame = 3
Query:  378 MREVCVNSLLRNPVIIGGPNTIVEINESFFTRCK---NHVRRQQWVFGGIVVIREKVPCSLSPIE 563
            +REV      +N ++IG    +VEI+ES   R K    H+ R+QWVF G+ V  E     L PIE
Sbjct:    2 LREVMFEYFNQNTIMIGRLGILVEIDESQLVRRKYERGHLVREQWVFDGVEV--ENKIGFLVPIE 64          

HSP 2 Score: 31.187 bits (69), Expect = 1.223e-6
Identity = 17/55 (30.91%), Postives = 27/55 (49.09%), Query Frame = 2
Query:  551 VTDRSAATLMPLITQ*ILSATAIMSDQWSAYNERTAAAGMSYSHETVNNSLRFID 715
            +  R+  TL  +I + I   + I SD W+AY + T    + Y H  VN    ++D
Sbjct:   63 IEKRNRETLQCMIRKFIRPGSIIHSDFWAAYGDLTV---LGYFHFKVNLEENYVD 114          
The following BLAST results are available for this feature:
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:dkey-17m8.27.241e-643.64si:dkey-17m8.2 [Source:ZFIN;Acc:ZDB-GENE-110411-23... [more]
si:dkey-6f10.48.324e-643.64si:dkey-6f10.4 [Source:ZFIN;Acc:ZDB-GENE-041210-34... [more]
si:dkey-6f10.48.324e-643.64si:dkey-6f10.4 [Source:ZFIN;Acc:ZDB-GENE-041210-34... [more]
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A085LRT01.781e-3244.57DDE_Tnp_IS1595 domain-containing protein OS=Trichu... [more]
A0A0A9YMJ91.246e-2951.55Putative transposase-like protein HI_1328.1 OS=Lyg... [more]
A0A146LFY41.929e-2951.55Putative transposase-like protein HI_1328.1 OS=Lyg... [more]
A0A0L8G6F61.175e-2747.87DDE_Tnp_IS1595 domain-containing protein OS=Octopu... [more]
A0A0L8GRY17.438e-2650.63DDE_Tnp_IS1595 domain-containing protein OS=Octopu... [more]
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO421244.259e-1036.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493582.072e-725.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421251.248e-639.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_IS1595 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036215.14.323e-2672.13SMESG000036215.1[more]
SMESG000079576.14.983e-1144.93SMESG000079576.1[more]
SMESG000074868.11.938e-926.60SMESG000074868.1[more]
SMESG000054196.12.295e-740.63SMESG000054196.1[more]
SMESG000079181.11.223e-640.00SMESG000079181.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031330 ID=SMED30031330|Name=DDE_Tnp_IS1595 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=881bp
ACCATCTTGTTTATTGTTTTGTTTTTTTAATTTTAAATTCAATCGATAAA
AAATAATGAAAAAGCAGTCATACACGACATATCTAGTAGCGTTCGCTTTC
TACAGCTGCGTAGTATTTTACACAATCCACGCATATGAAGCAACAATTAA
TGTATGGTACTGTCGTTGACGAATATTCACGATCACTTGCAGTGCAGTCG
AAGAAGTTGCAGAGAGACGATCCATGTGCCACGAGACATATAGATGCAAG
GATCGAAGTTATCTTTCAGGAAGTCATCCTATTTATCTACAGTTGGAGCA
AGGAGCTGACTAGCATCAAGTTCTGTGAAAATGAATTGGATATTTCGAAA
TCTGCTGTGATCAATTGGAACATGTACATGCGTGAGGTATGTGTAAACAG
TCTTCTACGGAATCCTGTAATTATTGGAGGGCCTAACACAATAGTTGAAA
TAAACGAAAGCTTCTTCACAAGATGTAAAAACCACGTGCGCAGGCAACAG
TGGGTTTTTGGCGGAATAGTTGTGATTCGGGAGAAAGTTCCATGTTCGCT
GTCACCGATAGAAGTGCTGCCACTCTGATGCCTTTAATTACGCAATAAAT
TCTTTCCGCAACAGCAATTATGTCTGATCAGTGGAGTGCTTACAACGAAA
GAACTGCTGCCGCTGGAATGAGTTACAGTCACGAAACAGTGAATAACAGC
CTACGTTTCATCGATCATAATATCCTCATATGATAGACTCCTATTTTCGT
GAGTACGTGTGGATAAATCATGTGAAAATGAGACACGATGATCCCTTCGA
CACCATCATGGAAGACATTGTAAGATTCTGGCCACCTGAATAATTTAACA
TTAATTATAACTGACTATATTCGTAGTTAAT
back to top

protein sequence of SMED30031330-orf-1

>SMED30031330-orf-1 ID=SMED30031330-orf-1|Name=SMED30031330-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=148bp
MKQQLMYGTVVDEYSRSLAVQSKKLQRDDPCATRHIDARIEVIFQEVILF
IYSWSKELTSIKFCENELDISKSAVINWNMYMREVCVNSLLRNPVIIGGP
NTIVEINESFFTRCKNHVRRQQWVFGGIVVIREKVPCSLSPIEVLPL*
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR47163:SF2coord: 45..128
NoneNo IPR availablePANTHERPTHR47163FAMILY NOT NAMEDcoord: 45..128