Protein tyrosine phosphatase receptor type B

Overview
NameProtein tyrosine phosphatase receptor type B
Smed IDSMED30031329
Length (bp)1284
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein tyrosine phosphatase receptor type B (SMED30031329) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein tyrosine phosphatase receptor type B (SMED30031329) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein tyrosine phosphatase receptor type B (SMED30031329) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein tyrosine phosphatase receptor type B (SMED30031329) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031329

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30031329SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30031329SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031329SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30031329SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30031329SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30031329SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031329SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30031329SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30031329SMESG000050003.1 SMESG000005247.1 dd_Smed_v4_5794_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 171.785 bits (434), Expect = 6.371e-46
Identity = 114/306 (37.25%), Postives = 157/306 (51.31%), Query Frame = 2
Query:  278 NFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNND-----RIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD----FMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            NF  +F+  + DSN    ++++D+K  V   Q +     AE    KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  I+ LT+  E GR KC +YWP K         +A +S   L E T+ +F   +I T              ++Q H TSW DH  P T+D    F      Y +   P   I+VHCSAGVGRTG+FI ID  + +IEN  + V++Y  + +LR  R  MVQTE QY F    +++C++
Sbjct: 1025 NFEAYFKKQQADSNCGFAEEYEDLK-LVGISQPKYAAELAENR-GKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPL-------PNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSE---------SHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVF----LNQCVL 1296          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 171.785 bits (434), Expect = 7.206e-46
Identity = 114/306 (37.25%), Postives = 157/306 (51.31%), Query Frame = 2
Query:  278 NFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNND-----RIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD----FMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            NF  +F+  + DSN    ++++D+K  V   Q +     AE    KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  I+ LT+  E GR KC +YWP K         +A +S   L E T+ +F   +I T              ++Q H TSW DH  P T+D    F      Y +   P   I+VHCSAGVGRTG+FI ID  + +IEN  + V++Y  + +LR  R  MVQTE QY F    +++C++
Sbjct: 1026 NFEAYFKKQQADSNCGFAEEYEDLK-LVGISQPKYAAELAENR-GKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPL-------PNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSE---------SHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVF----LNQCVL 1297          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 171.785 bits (434), Expect = 7.421e-46
Identity = 114/306 (37.25%), Postives = 157/306 (51.31%), Query Frame = 2
Query:  278 NFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNND-----RIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD----FMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            NF  +F+  + DSN    ++++D+K  V   Q +     AE    KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  I+ LT+  E GR KC +YWP K         +A +S   L E T+ +F   +I T              ++Q H TSW DH  P T+D    F      Y +   P   I+VHCSAGVGRTG+FI ID  + +IEN  + V++Y  + +LR  R  MVQTE QY F    +++C++
Sbjct: 1030 NFEAYFKKQQADSNCGFAEEYEDLK-LVGISQPKYAAELAENR-GKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPL-------PNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSE---------SHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVF----LNQCVL 1301          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 163.31 bits (412), Expect = 6.038e-43
Identity = 104/270 (38.52%), Postives = 140/270 (51.85%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMN--KYKKTIKQLHMTSWLDHSCPT-TSDFMEFYAAYTRSKVP-SEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQR---GLSQVPER 1186
            KNRY N+  Y H+RV L  ++     DYINA+ +         +G    C + YIATQGPL E       T GDFWRMV E     IV +TR EE  R KC QYWP +  +   F      ++VT+ +  E + F  R  ++  N    K+ ++Q   T+W DH  P   + F+ F         P +  I+VHCSAGVGRTG FI+ID  L RI+     V++Y  +  +R  R  MVQTE QY F    IHE L++    G ++VP R
Sbjct: 1419 KNRYANVIAYDHSRVILQPIEGIMGSDYINANYV---------DG--YRCQNAYIATQGPLPE-------TFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGF------IQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPE-KTVDVYGHVTLMRSQRNYMVQTEDQYSF----IHEALLEAVGCGNTEVPAR 1659          

HSP 2 Score: 145.206 bits (365), Expect = 9.422e-37
Identity = 97/256 (37.89%), Postives = 127/256 (49.61%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSK---VPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNR  NI PY+  RV L  +      DYINAS I         +G        YIATQGPL E  E       DFWRM+ ENN  I+V LT+  E GREKC QYWP + + R  +   D + E  M  +    I  E  +T + +   +T++Q   T W +   P + + F++F     ++K        I VHCSAGVGRTG FI +   L R+      V+I+ T+  LR  R  MVQTE +Y F Y    E L
Sbjct: 1708 KNRLVNIMPYESTRVCLQPIRGVEGSDYINASFI---------DG--YRQQKAYIATQGPLAETTE-------DFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQY----ILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYE-GVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1940          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 163.31 bits (412), Expect = 6.243e-43
Identity = 104/270 (38.52%), Postives = 140/270 (51.85%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMN--KYKKTIKQLHMTSWLDHSCPT-TSDFMEFYAAYTRSKVP-SEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQR---GLSQVPER 1186
            KNRY N+  Y H+RV L  ++     DYINA+ +         +G    C + YIATQGPL E       T GDFWRMV E     IV +TR EE  R KC QYWP +  +   F      ++VT+ +  E + F  R  ++  N    K+ ++Q   T+W DH  P   + F+ F         P +  I+VHCSAGVGRTG FI+ID  L RI+     V++Y  +  +R  R  MVQTE QY F    IHE L++    G ++VP R
Sbjct: 1381 KNRYANVIAYDHSRVILQPIEGIMGSDYINANYV---------DG--YRCQNAYIATQGPLPE-------TFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGF------IQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPE-KTVDVYGHVTLMRSQRNYMVQTEDQYSF----IHEALLEAVGCGNTEVPAR 1621          

HSP 2 Score: 144.821 bits (364), Expect = 1.090e-36
Identity = 97/256 (37.89%), Postives = 127/256 (49.61%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSK---VPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNR  NI PY+  RV L  +      DYINAS I         +G        YIATQGPL E  E       DFWRM+ ENN  I+V LT+  E GREKC QYWP + + R  +   D + E  M  +    I  E  +T + +   +T++Q   T W +   P + + F++F     ++K        I VHCSAGVGRTG FI +   L R+      V+I+ T+  LR  R  MVQTE +Y F Y    E L
Sbjct: 1670 KNRLVNIMPYESTRVCLQPIRGVEGSDYINASFI---------DG--YRQQKAYIATQGPLAETTE-------DFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQY----ILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYE-GVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1902          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 150.984 bits (380), Expect = 3.538e-39
Identity = 108/314 (34.39%), Postives = 155/314 (49.36%), Query Frame = 2
Query:  266 PLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSM--NKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVP 1180
            P+A     H E ++ ++N     +F+ I+         +    A+ + HKNRY N+  Y H+RV L+ ++     DYINA+ +       D    P +    YIATQGPL E       T  DFWRMV E     IV LT  EE  R KC QYWP +       + GD  +EVT+      + +T R + + M      + IK L  T+W DH  P        +    ++  P++A  II HCSAG+GRTG+FI+ID  L R+    + V+IY  +  LR  R  MVQTE QY F +  + +  +  G ++VP
Sbjct: 1413 PIA-ELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSS---ADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV-------DGYDKPRS----YIATQGPLPE-------TFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTA----TYGD--IEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLR-YDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDA-VNSGSTEVP 1696          

HSP 2 Score: 113.235 bits (282), Expect = 1.622e-26
Identity = 96/314 (30.57%), Postives = 135/314 (42.99%), Query Frame = 2
Query:  272 ALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVH--KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTN-----FRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEF-------YAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            A   H H   + + S  +L     + +H        N    A   V+  KNR  +  PY  NRV +  L      DYINAS      W   ++G        YIATQ P  E       T  DFWR + E+N  II  L R+ E G+E+CS YWP +   ++     + + E  M +     FR + I T  V         +T++Q H   W D   P T+D F++F       YA +  +      I VHC +G GRT  FI +   L R+      V+++ T+  LR  R  M+Q   QY F Y   +E L
Sbjct: 1697 ASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINAS------W---IDG--YKERGAYIATQAPTNE-------TAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREV---------RTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTG----PITVHCCSGAGRTAVFIALSIILDRMRAE-HVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYL 1978          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 150.984 bits (380), Expect = 3.542e-39
Identity = 108/314 (34.39%), Postives = 155/314 (49.36%), Query Frame = 2
Query:  266 PLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSM--NKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVP 1180
            P+A     H E ++ ++N     +F+ I+         +    A+ + HKNRY N+  Y H+RV L+ ++     DYINA+ +       D    P +    YIATQGPL E       T  DFWRMV E     IV LT  EE  R KC QYWP +       + GD  +EVT+      + +T R + + M      + IK L  T+W DH  P        +    ++  P++A  II HCSAG+GRTG+FI+ID  L R+    + V+IY  +  LR  R  MVQTE QY F +  + +  +  G ++VP
Sbjct: 1628 PIA-ELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSS---ADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV-------DGYDKPRS----YIATQGPLPE-------TFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTA----TYGD--IEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLR-YDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDA-VNSGSTEVP 1911          

HSP 2 Score: 113.235 bits (282), Expect = 1.668e-26
Identity = 96/314 (30.57%), Postives = 135/314 (42.99%), Query Frame = 2
Query:  272 ALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVH--KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTN-----FRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEF-------YAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            A   H H   + + S  +L     + +H        N    A   V+  KNR  +  PY  NRV +  L      DYINAS      W   ++G        YIATQ P  E       T  DFWR + E+N  II  L R+ E G+E+CS YWP +   ++     + + E  M +     FR + I T  V         +T++Q H   W D   P T+D F++F       YA +  +      I VHC +G GRT  FI +   L R+      V+++ T+  LR  R  M+Q   QY F Y   +E L
Sbjct: 1912 ASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINAS------W---IDG--YKERGAYIATQAPTNE-------TAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREV---------RTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTG----PITVHCCSGAGRTAVFIALSIILDRMRAE-HVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYL 2193          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 150.599 bits (379), Expect = 3.865e-39
Identity = 108/314 (34.39%), Postives = 155/314 (49.36%), Query Frame = 2
Query:  266 PLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSM--NKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVP 1180
            P+A     H E ++ ++N     +F+ I+         +    A+ + HKNRY N+  Y H+RV L+ ++     DYINA+ +       D    P +    YIATQGPL E       T  DFWRMV E     IV LT  EE  R KC QYWP +       + GD  +EVT+      + +T R + + M      + IK L  T+W DH  P        +    ++  P++A  II HCSAG+GRTG+FI+ID  L R+    + V+IY  +  LR  R  MVQTE QY F +  + +  +  G ++VP
Sbjct:  915 PIA-ELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSS---ADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV-------DGYDKPRS----YIATQGPLPE-------TFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTA----TYGD--IEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLR-YDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDA-VNSGSTEVP 1198          

HSP 2 Score: 112.849 bits (281), Expect = 2.274e-26
Identity = 94/310 (30.32%), Postives = 133/310 (42.90%), Query Frame = 2
Query:  272 ALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVH--KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTN-----FRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSKVP---SEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            A   H H   + + S  +L     + +H        N    A   V+  KNR  +  PY  NRV +  L      DYINAS      W   ++G        YIATQ P  E       T  DFWR + E+N  II  L R+ E G+E+CS YWP +   ++     + + E  M +     FR + I T  V         +T++Q H   W D   P T+D F++F      +      +  I VHC +G GRT  FI +   L R+      V+++ T+  LR  R  M+Q   QY F Y   +E L
Sbjct: 1199 ASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINAS------W---IDG--YKERGAYIATQAPTNE-------TAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREV---------RTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAE-HVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYL 1480          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 150.984 bits (380), Expect = 3.980e-39
Identity = 108/314 (34.39%), Postives = 155/314 (49.36%), Query Frame = 2
Query:  266 PLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSM--NKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVP 1180
            P+A     H E ++ ++N     +F+ I+         +    A+ + HKNRY N+  Y H+RV L+ ++     DYINA+ +       D    P +    YIATQGPL E       T  DFWRMV E     IV LT  EE  R KC QYWP +       + GD  +EVT+      + +T R + + M      + IK L  T+W DH  P        +    ++  P++A  II HCSAG+GRTG+FI+ID  L R+    + V+IY  +  LR  R  MVQTE QY F +  + +  +  G ++VP
Sbjct: 1676 PIA-ELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSS---ADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV-------DGYDKPRS----YIATQGPLPE-------TFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGT----ATYGD--IEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLR-YDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDA-VNSGSTEVP 1959          

HSP 2 Score: 112.849 bits (281), Expect = 1.921e-26
Identity = 96/314 (30.57%), Postives = 135/314 (42.99%), Query Frame = 2
Query:  272 ALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVH--KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTN-----FRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEF-------YAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            A   H H   + + S  +L     + +H        N    A   V+  KNR  +  PY  NRV +  L      DYINAS      W   ++G        YIATQ P  E       T  DFWR + E+N  II  L R+ E G+E+CS YWP +   ++     + + E  M +     FR + I T  V         +T++Q H   W D   P T+D F++F       YA +  +      I VHC +G GRT  FI +   L R+      V+++ T+  LR  R  M+Q   QY F Y   +E L
Sbjct: 1960 ASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINAS------W---IDG--YKERGAYIATQAPTNE-------TAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREV---------RTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTG----PITVHCCSGAGRTAVFIALSIILDRMRAE-HVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYL 2241          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 150.599 bits (379), Expect = 4.087e-39
Identity = 108/314 (34.39%), Postives = 155/314 (49.36%), Query Frame = 2
Query:  266 PLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSM--NKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVP 1180
            P+A     H E ++ ++N     +F+ I+         +    A+ + HKNRY N+  Y H+RV L+ ++     DYINA+ +       D    P +    YIATQGPL E       T  DFWRMV E     IV LT  EE  R KC QYWP +       + GD  +EVT+      + +T R + + M      + IK L  T+W DH  P        +    ++  P++A  II HCSAG+GRTG+FI+ID  L R+    + V+IY  +  LR  R  MVQTE QY F +  + +  +  G ++VP
Sbjct: 1655 PIA-ELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSS---ADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV-------DGYDKPRS----YIATQGPLPE-------TFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTA----TYGD--IEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLR-YDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDA-VNSGSTEVP 1938          

HSP 2 Score: 113.235 bits (282), Expect = 1.815e-26
Identity = 96/314 (30.57%), Postives = 135/314 (42.99%), Query Frame = 2
Query:  272 ALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVH--KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTN-----FRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEF-------YAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            A   H H   + + S  +L     + +H        N    A   V+  KNR  +  PY  NRV +  L      DYINAS      W   ++G        YIATQ P  E       T  DFWR + E+N  II  L R+ E G+E+CS YWP +   ++     + + E  M +     FR + I T  V         +T++Q H   W D   P T+D F++F       YA +  +      I VHC +G GRT  FI +   L R+      V+++ T+  LR  R  M+Q   QY F Y   +E L
Sbjct: 1939 ASRLHQHLHILSQPSADQLSGIDMEFRHLTTLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINAS------W---IDG--YKERGAYIATQAPTNE-------TAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREV---------RTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTG----PITVHCCSGAGRTAVFIALSIILDRMRAE-HVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYL 2220          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0073522)

HSP 1 Score: 169.474 bits (428), Expect = 2.009e-45
Identity = 110/311 (35.37%), Postives = 158/311 (50.80%), Query Frame = 2
Query:  251 ENDKSPLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVH--KNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            E ++  L  NF  H+  M  DS+ R  ++F+++KH            FA+   +  KNR+ NI PY H+R KL  +DD     YINA+ +              N    +I TQGPL   R+       DFWRM  E+N   IV LTR  E GREKC QYWP   ND +    GD  V++   +   + + TE +L       ++ ++  H T+W D   P     +  +    R ++ +E   I+VHCSAGVGR+G+FI +D  L +I N +D V+I+  +  +RK R  MVQTE QY      IH+CL+
Sbjct: 1247 EQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGRDQPCT----FADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGH-----------NSPREFIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGDIKVQILNDSHYADWVMTEFML--CRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQI-NTSDYVDIFGIVYAMRKERVWMVQTEQQYI----CIHQCLL 1525          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0273235)

HSP 1 Score: 169.474 bits (428), Expect = 2.022e-45
Identity = 110/311 (35.37%), Postives = 158/311 (50.80%), Query Frame = 2
Query:  251 ENDKSPLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVH--KNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            E ++  L  NF  H+  M  DS+ R  ++F+++KH            FA+   +  KNR+ NI PY H+R KL  +DD     YINA+ +              N    +I TQGPL   R+       DFWRM  E+N   IV LTR  E GREKC QYWP   ND +    GD  V++   +   + + TE +L       ++ ++  H T+W D   P     +  +    R ++ +E   I+VHCSAGVGR+G+FI +D  L +I N +D V+I+  +  +RK R  MVQTE QY      IH+CL+
Sbjct: 1247 EQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGRDQPCT----FADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGH-----------NSPREFIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGDIKVQILNDSHYADWVMTEFML--CRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQI-NTSDYVDIFGIVYAMRKERVWMVQTEQQYI----CIHQCLL 1525          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0331406)

HSP 1 Score: 169.474 bits (428), Expect = 2.022e-45
Identity = 110/311 (35.37%), Postives = 158/311 (50.80%), Query Frame = 2
Query:  251 ENDKSPLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVH--KNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            E ++  L  NF  H+  M  DS+ R  ++F+++KH            FA+   +  KNR+ NI PY H+R KL  +DD     YINA+ +              N    +I TQGPL   R+       DFWRM  E+N   IV LTR  E GREKC QYWP   ND +    GD  V++   +   + + TE +L       ++ ++  H T+W D   P     +  +    R ++ +E   I+VHCSAGVGR+G+FI +D  L +I N +D V+I+  +  +RK R  MVQTE QY      IH+CL+
Sbjct: 1247 EQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGRDQPCT----FADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGH-----------NSPREFIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGDIKVQILNDSHYADWVMTEFML--CRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQI-NTSDYVDIFGIVYAMRKERVWMVQTEQQYI----CIHQCLL 1525          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0330394)

HSP 1 Score: 169.474 bits (428), Expect = 2.055e-45
Identity = 110/311 (35.37%), Postives = 158/311 (50.80%), Query Frame = 2
Query:  251 ENDKSPLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVH--KNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            E ++  L  NF  H+  M  DS+ R  ++F+++KH            FA+   +  KNR+ NI PY H+R KL  +DD     YINA+ +              N    +I TQGPL   R+       DFWRM  E+N   IV LTR  E GREKC QYWP   ND +    GD  V++   +   + + TE +L       ++ ++  H T+W D   P     +  +    R ++ +E   I+VHCSAGVGR+G+FI +D  L +I N +D V+I+  +  +RK R  MVQTE QY      IH+CL+
Sbjct: 1269 EQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGRDQPCT----FADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGH-----------NSPREFIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGDIKVQILNDSHYADWVMTEFML--CRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQI-NTSDYVDIFGIVYAMRKERVWMVQTEQQYI----CIHQCLL 1547          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0330393)

HSP 1 Score: 169.088 bits (427), Expect = 3.221e-45
Identity = 110/311 (35.37%), Postives = 158/311 (50.80%), Query Frame = 2
Query:  251 ENDKSPLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVH--KNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            E ++  L  NF  H+  M  DS+ R  ++F+++KH            FA+   +  KNR+ NI PY H+R KL  +DD     YINA+ +              N    +I TQGPL   R+       DFWRM  E+N   IV LTR  E GREKC QYWP   ND +    GD  V++   +   + + TE +L       ++ ++  H T+W D   P     +  +    R ++ +E   I+VHCSAGVGR+G+FI +D  L +I N +D V+I+  +  +RK R  MVQTE QY      IH+CL+
Sbjct: 1247 EQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGRDQPCT----FADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGH-----------NSPREFIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGDIKVQILNDSHYADWVMTEFML--CRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQI-NTSDYVDIFGIVYAMRKERVWMVQTEQQYI----CIHQCLL 1525          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Zebrafish
Match: ptprb (protein tyrosine phosphatase receptor type b [Source:ZFIN;Acc:ZDB-GENE-101108-3])

HSP 1 Score: 161.77 bits (408), Expect = 1.252e-42
Identity = 116/328 (35.37%), Postives = 167/328 (50.91%), Query Frame = 2
Query:  260 KSPL-ALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDY-YIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTN-FRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCP-TTSDFMEFYAAY----TRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVPERDRPANP 1204
            +SP+ A NF +H   ++ DS+  L ++F+ +K            +   G+ +KNRY NI PY   RV+L+ L+D     YINA+ I            P N   + YIATQGPL   ++       DFWRMV E NV  +V +T+  E G  KC  YWP    D      GD +V++     F E +I   ++   S  +Y + ++Q H T W DH  P TT   ++F         R+  P  + +VHCSAGVGRTG+FI++D  L +++ R   V+IY  + +LR  R  MVQTE QY + +  + + L  R L    ERD P  P
Sbjct: 1587 RSPVQAANFESHLAKLQSDSSYLLSEEFEGLKDVGRIQTQNAARLL--GNRNKNRYNNILPYDSTRVRLSCLEDDPCSDYINANYI------------PGNNFRWEYIATQGPLPGTKD-------DFWRMVWEQNVHSLVMVTQCVERGMVKCDHYWP---TDSEPLCYGDIVVQLLSEKVFPEWTIRDFKISCESQLRYPRMVRQFHYTIWPDHGVPDTTQSLIQFVRTVRDFINRTNSPGIS-VVHCSAGVGRTGTFIVLDRALQQLD-RNCTVDIYGCVFDLRLHRSYMVQTECQYAYIHQCVRDVLRARKLGC--ERDNPLFP 1886          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Zebrafish
Match: ptprb (protein tyrosine phosphatase receptor type b [Source:ZFIN;Acc:ZDB-GENE-101108-3])

HSP 1 Score: 161.77 bits (408), Expect = 1.252e-42
Identity = 116/328 (35.37%), Postives = 167/328 (50.91%), Query Frame = 2
Query:  260 KSPL-ALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDY-YIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTN-FRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCP-TTSDFMEFYAAY----TRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVPERDRPANP 1204
            +SP+ A NF +H   ++ DS+  L ++F+ +K            +   G+ +KNRY NI PY   RV+L+ L+D     YINA+ I            P N   + YIATQGPL   ++       DFWRMV E NV  +V +T+  E G  KC  YWP    D      GD +V++     F E +I   ++   S  +Y + ++Q H T W DH  P TT   ++F         R+  P  + +VHCSAGVGRTG+FI++D  L +++ R   V+IY  + +LR  R  MVQTE QY + +  + + L  R L    ERD P  P
Sbjct: 1587 RSPVQAANFESHLAKLQSDSSYLLSEEFEGLKDVGRIQTQNAARLL--GNRNKNRYNNILPYDSTRVRLSCLEDDPCSDYINANYI------------PGNNFRWEYIATQGPLPGTKD-------DFWRMVWEQNVHSLVMVTQCVERGMVKCDHYWP---TDSEPLCYGDIVVQLLSEKVFPEWTIRDFKISCESQLRYPRMVRQFHYTIWPDHGVPDTTQSLIQFVRTVRDFINRTNSPGIS-VVHCSAGVGRTGTFIVLDRALQQLD-RNCTVDIYGCVFDLRLHRSYMVQTECQYAYIHQCVRDVLRARKLGC--ERDNPLFP 1886          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Zebrafish
Match: ptprjb.1 (protein tyrosine phosphatase receptor type Jb, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-090304-1])

HSP 1 Score: 148.673 bits (374), Expect = 6.087e-41
Identity = 105/308 (34.09%), Postives = 148/308 (48.05%), Query Frame = 2
Query:  272 ALNFHTHFEFMKR---DSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGK----NNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTS----DFMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHEC 1150
            AL    + E+ KR   DSN    ++++++K      Q       A  +  KNRY N+ PY  +RVKL+      DDYINA+ +              N    +IA QGPL         T+ +FWRM+ E NV  IV LT+  E GR KC +YWP      NN  +  +S   L + T+ +FR  ++ T            + ++Q H T+W DH  P T+    DF      +          +VHCSAGVGRTG+FI ID    +IE R   V+IY  + ++R  R  MVQTE QY +    +H+C
Sbjct:    4 ALKVEDYEEYFKRNSADSNCGFAEEYEELK--SVGTQQSKAAALAIENKAKNRYSNVLPYDASRVKLSMCGSPFDDYINANHV-----------PGYNSRKEFIAAQGPLP-------VTLNEFWRMIWEKNVYTIVMLTKCNEMGRVKCEKYWPSATSHYNNISVTTTSEIELDDWTIRDFRIKNVKTAET---------RYVRQFHFTAWPDHGVPETTEILIDFRHLVREHMDQYSRHSPTVVHCSAGVGRTGTFIAIDHLSFQIE-RDSMVDIYGIVHDMRMHRALMVQTEDQYVY----LHQC 277          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Zebrafish
Match: ptprjb.2 (protein tyrosine phosphatase receptor type Jb, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131120-137])

HSP 1 Score: 148.288 bits (373), Expect = 1.119e-40
Identity = 105/315 (33.33%), Postives = 154/315 (48.89%), Query Frame = 2
Query:  272 ALNFHTHFEFMKR---DSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKL----NKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGK----NNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVP----SEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLS 1171
            AL    + E+ K+   DSN     ++++++       N      A  +  KNRY N+ PY  +RVKL    N  DDYINA+ +              N    +IA QGPL         TI  FWRM+ EN V  IV LT+  E G+ KC +YWP +    +N  +  +S   L + T+ +F   ++ TE    V         +Q H T+W DH  P T++ +  +    R  +     +   +VHCSAGVGRTG+FI ID  +S+IE R   V+IY  + ++R  R  MVQTE QY + Y   ++ +  R +S
Sbjct:    2 ALRIEEYEEYFKQKCADSNHGFAIEYEELRFVGTAQANTAA--LALENKEKNRYLNVLPYDASRVKLLKCENPFDDYINANYV-----------PGYNSRKEFIAAQGPLP-------VTINKFWRMIWENKVYTIVMLTKCNELGKVKCEKYWPSETDFYHNISVTTTSETELDDWTIRDFSIKNVETEETCNV---------RQFHFTAWPDHGVPETTEVLIEFRHLVREHMNQYSCTSPTVVHCSAGVGRTGTFIAIDHLISQIE-RDSMVDIYGIVHDMRMHRALMVQTEDQYVYLYQCAYDLIQSRTMS 286          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 154.451 bits (389), Expect = 3.384e-40
Identity = 108/316 (34.18%), Postives = 154/316 (48.73%), Query Frame = 2
Query:  245 PDENDKSPLALN-FHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMN--KYKKTIKQLHMTSWLDHSCPT-TSDFMEFYAAYTRSKVP-SEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQ 1159
            P   +  P+ ++    H E +K + N +L  +++ I          + L   E +  KNRY N+  Y H+RV L  ++     DYIN++ I   R  N             YIATQGPL E       T GDFWRMV E     +V +TR EE  R KC QYWP +  +         +++VT+ +  E + F  R  ++  N    K+ ++Q   T+W DH  P   + F+ F         P +  II HCSAGVGRTG FI+ID  L RI++    V+IY  +  +R  R  MVQTE QY F    IH+ L++
Sbjct: 1214 PGMMNHPPIPISELAEHTELLKANDNLKLSQEYESIDPGQQFTWEHSNL---EVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINSNYIDGYRKQNA------------YIATQGPLPE-------TFGDFWRMVWEQRAATVVMMTRLEEKSRIKCDQYWPSRGTETYG------MIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHE-KTVDIYGHVTLMRSQRNYMVQTEDQYSF----IHDALLE 1496          

HSP 2 Score: 142.124 bits (357), Expect = 6.172e-36
Identity = 96/257 (37.35%), Postives = 126/257 (49.03%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNR  NI PY+  RV L  +      DYIN+S I   R                YIATQGPL E  E       DFWRM+ ENN  I+V LT+  E GREKC QYWP + + R  +   D + E  M  +    I  E  +T + +   +T++Q   T W +   P + + F++F     ++K        I VHCSAGVGRTG FI +   L R+      V+I+ T+  LR  R  MVQTE +Y F Y    E L
Sbjct: 1557 KNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKA------------YIATQGPLAETTE-------DFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQY----ILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYE-GVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1789          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Xenopus
Match: mfsd14b (major facilitator superfamily domain containing 14B [Source:Xenbase;Acc:XB-GENE-5783273])

HSP 1 Score: 161.77 bits (408), Expect = 1.631e-42
Identity = 106/280 (37.86%), Postives = 145/280 (51.79%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMN--KYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQR---GLSQVPERDRPANPQSI 1213
            KNRY N+  Y H+RV L  +D     DYINA+ I   R  N             YIATQGPL E       TI DFWRMV E     IV +TR EE  R KC QYWPG+ ++         +++VT+ +  E + +T R  T+  N    K+ ++Q    +W DH  P     +  +    +   P +A  ++VHCSAGVGRTG FI+ID  L R++     V+IY  +  +R  R  MVQTE QY F    IHE L++    G+++VP R   A+ Q +
Sbjct: 1320 KNRYANVIAYDHSRVILTSVDGVPGSDYINANYIDGYRKQNA------------YIATQGPLPE-------TITDFWRMVWEQRTATIVMMTRLEEKSRVKCDQYWPGRGSETYG------MIQVTLMDTVELATYTVRTFTLYKNGSSEKRDVRQFQFMAWPDHGVPEYPTPILGFLRRVKGCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERVK-LEKTVDIYGHVTCMRSQRNYMVQTEDQYIF----IHEALLEAVMCGITEVPARSLYAHIQKL 1569          

HSP 2 Score: 144.05 bits (362), Expect = 1.944e-36
Identity = 96/256 (37.50%), Postives = 125/256 (48.83%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNR  NI PY+ +RV L  +      DYINAS I                   YIATQGPL E  E       DFWRM+ E+N  I+V LT+  E GREKC QYWP + + R  +   D + E  M  +    I  E  +T + +   +TI+Q   T W +   P T + F++F     ++K        I VHCSAGVGRTG FI +   L R+      V+++ T+  LR  R  MVQTE QY   Y    E L
Sbjct: 1609 KNRLVNIMPYELSRVSLQPIRGVEGSDYINASFIDGYRQQKG-----------YIATQGPLAETTE-------DFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQY----ILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYE-GVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYL 1841          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Xenopus
Match: mfsd14b (major facilitator superfamily domain containing 14B [Source:Xenbase;Acc:XB-GENE-5783273])

HSP 1 Score: 161.77 bits (408), Expect = 1.696e-42
Identity = 106/280 (37.86%), Postives = 145/280 (51.79%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMN--KYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQR---GLSQVPERDRPANPQSI 1213
            KNRY N+  Y H+RV L  +D     DYINA+ I   R  N             YIATQGPL E       TI DFWRMV E     IV +TR EE  R KC QYWPG+ ++         +++VT+ +  E + +T R  T+  N    K+ ++Q    +W DH  P     +  +    +   P +A  ++VHCSAGVGRTG FI+ID  L R++     V+IY  +  +R  R  MVQTE QY F    IHE L++    G+++VP R   A+ Q +
Sbjct: 1259 KNRYANVIAYDHSRVILTSVDGVPGSDYINANYIDGYRKQNA------------YIATQGPLPE-------TITDFWRMVWEQRTATIVMMTRLEEKSRVKCDQYWPGRGSETYG------MIQVTLMDTVELATYTVRTFTLYKNGSSEKRDVRQFQFMAWPDHGVPEYPTPILGFLRRVKGCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERVK-LEKTVDIYGHVTCMRSQRNYMVQTEDQYIF----IHEALLEAVMCGITEVPARSLYAHIQKL 1508          

HSP 2 Score: 144.05 bits (362), Expect = 1.911e-36
Identity = 96/256 (37.50%), Postives = 125/256 (48.83%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNR  NI PY+ +RV L  +      DYINAS I                   YIATQGPL E  E       DFWRM+ E+N  I+V LT+  E GREKC QYWP + + R  +   D + E  M  +    I  E  +T + +   +TI+Q   T W +   P T + F++F     ++K        I VHCSAGVGRTG FI +   L R+      V+++ T+  LR  R  MVQTE QY   Y    E L
Sbjct: 1548 KNRLVNIMPYELSRVSLQPIRGVEGSDYINASFIDGYRQQKG-----------YIATQGPLAETTE-------DFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQY----ILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYE-GVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYL 1780          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Xenopus
Match: mfsd14b (major facilitator superfamily domain containing 14B [Source:Xenbase;Acc:XB-GENE-5783273])

HSP 1 Score: 161.77 bits (408), Expect = 1.780e-42
Identity = 106/280 (37.86%), Postives = 145/280 (51.79%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMN--KYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQR---GLSQVPERDRPANPQSI 1213
            KNRY N+  Y H+RV L  +D     DYINA+ I   R  N             YIATQGPL E       TI DFWRMV E     IV +TR EE  R KC QYWPG+ ++         +++VT+ +  E + +T R  T+  N    K+ ++Q    +W DH  P     +  +    +   P +A  ++VHCSAGVGRTG FI+ID  L R++     V+IY  +  +R  R  MVQTE QY F    IHE L++    G+++VP R   A+ Q +
Sbjct: 1342 KNRYANVIAYDHSRVILTSVDGVPGSDYINANYIDGYRKQNA------------YIATQGPLPE-------TITDFWRMVWEQRTATIVMMTRLEEKSRVKCDQYWPGRGSETYG------MIQVTLMDTVELATYTVRTFTLYKNGSSEKRDVRQFQFMAWPDHGVPEYPTPILGFLRRVKGCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERVKLE-KTVDIYGHVTCMRSQRNYMVQTEDQYIF----IHEALLEAVMCGITEVPARSLYAHIQKL 1591          

HSP 2 Score: 144.05 bits (362), Expect = 2.042e-36
Identity = 97/256 (37.89%), Postives = 127/256 (49.61%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNR  NI PY+ +RV L  +      DYINAS I         +G        YIATQGPL E  E       DFWRM+ E+N  I+V LT+  E GREKC QYWP + + R  +   D + E  M  +    I  E  +T + +   +TI+Q   T W +   P T + F++F     ++K        I VHCSAGVGRTG FI +   L R+      V+++ T+  LR  R  MVQTE QY   Y    E L
Sbjct: 1631 KNRLVNIMPYELSRVSLQPIRGVEGSDYINASFI---------DG--YRQQKGYIATQGPLAETTE-------DFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQY----ILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYE-GVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYL 1863          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Xenopus
Match: mfsd14b (major facilitator superfamily domain containing 14B [Source:Xenbase;Acc:XB-GENE-5783273])

HSP 1 Score: 161.77 bits (408), Expect = 1.817e-42
Identity = 106/280 (37.86%), Postives = 145/280 (51.79%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMN--KYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQR---GLSQVPERDRPANPQSI 1213
            KNRY N+  Y H+RV L  +D     DYINA+ I   R  N             YIATQGPL E       TI DFWRMV E     IV +TR EE  R KC QYWPG+ ++         +++VT+ +  E + +T R  T+  N    K+ ++Q    +W DH  P     +  +    +   P +A  ++VHCSAGVGRTG FI+ID  L R++     V+IY  +  +R  R  MVQTE QY F    IHE L++    G+++VP R   A+ Q +
Sbjct: 1356 KNRYANVIAYDHSRVILTSVDGVPGSDYINANYIDGYRKQNA------------YIATQGPLPE-------TITDFWRMVWEQRTATIVMMTRLEEKSRVKCDQYWPGRGSETYG------MIQVTLMDTVELATYTVRTFTLYKNGSSEKRDVRQFQFMAWPDHGVPEYPTPILGFLRRVKGCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERVKLE-KTVDIYGHVTCMRSQRNYMVQTEDQYIF----IHEALLEAVMCGITEVPARSLYAHIQKL 1605          

HSP 2 Score: 144.05 bits (362), Expect = 1.916e-36
Identity = 96/256 (37.50%), Postives = 125/256 (48.83%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNR  NI PY+ +RV L  +      DYINAS I                   YIATQGPL E  E       DFWRM+ E+N  I+V LT+  E GREKC QYWP + + R  +   D + E  M  +    I  E  +T + +   +TI+Q   T W +   P T + F++F     ++K        I VHCSAGVGRTG FI +   L R+      V+++ T+  LR  R  MVQTE QY   Y    E L
Sbjct: 1645 KNRLVNIMPYELSRVSLQPIRGVEGSDYINASFIDGYRQQKG-----------YIATQGPLAETTE-------DFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQY----ILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYE-GVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYL 1877          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Xenopus
Match: mfsd14b (major facilitator superfamily domain containing 14B [Source:Xenbase;Acc:XB-GENE-5783273])

HSP 1 Score: 161.77 bits (408), Expect = 1.855e-42
Identity = 106/280 (37.86%), Postives = 145/280 (51.79%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMN--KYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQR---GLSQVPERDRPANPQSI 1213
            KNRY N+  Y H+RV L  +D     DYINA+ I   R  N             YIATQGPL E       TI DFWRMV E     IV +TR EE  R KC QYWPG+ ++         +++VT+ +  E + +T R  T+  N    K+ ++Q    +W DH  P     +  +    +   P +A  ++VHCSAGVGRTG FI+ID  L R++     V+IY  +  +R  R  MVQTE QY F    IHE L++    G+++VP R   A+ Q +
Sbjct: 1374 KNRYANVIAYDHSRVILTSVDGVPGSDYINANYIDGYRKQNA------------YIATQGPLPE-------TITDFWRMVWEQRTATIVMMTRLEEKSRVKCDQYWPGRGSETYG------MIQVTLMDTVELATYTVRTFTLYKNGSSEKRDVRQFQFMAWPDHGVPEYPTPILGFLRRVKGCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERVKLE-KTVDIYGHVTCMRSQRNYMVQTEDQYIF----IHEALLEAVMCGITEVPARSLYAHIQKL 1623          

HSP 2 Score: 144.05 bits (362), Expect = 1.993e-36
Identity = 96/256 (37.50%), Postives = 125/256 (48.83%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNR  NI PY+ +RV L  +      DYINAS I                   YIATQGPL E  E       DFWRM+ E+N  I+V LT+  E GREKC QYWP + + R  +   D + E  M  +    I  E  +T + +   +TI+Q   T W +   P T + F++F     ++K        I VHCSAGVGRTG FI +   L R+      V+++ T+  LR  R  MVQTE QY   Y    E L
Sbjct: 1663 KNRLVNIMPYELSRVSLQPIRGVEGSDYINASFIDGYRQQKG-----------YIATQGPLAETTE-------DFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQY----ILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYE-GVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYL 1895          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Mouse
Match: Ptpn20 (protein tyrosine phosphatase, non-receptor type 20 [Source:MGI Symbol;Acc:MGI:1196295])

HSP 1 Score: 168.318 bits (425), Expect = 4.182e-47
Identity = 101/249 (40.56%), Postives = 128/249 (51.41%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKT--IKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNRY +I PY   RV L K  DYINAS I + +   +          +YIATQGPL E       TI DFW+MVLENN  +I  +TR  E G  KC  YWP    + + F      +E     F     FT RV  +      K+  +K L  T W DH  P ++DF   Y  Y R    +  ++VHCSAGVGRTG FI +D   S IE +    +I N +  +RK RC M+QT+ QY F Y I+ E L
Sbjct:  192 KNRYRDILPYDSTRVPLGKNKDYINASYIRIVNHEEEY---------FYIATQGPLPE-------TIEDFWQMVLENNCNVIAMITREIECGVIKCYSYWPISLKEPLEFEHFSVFLET----FHVTQYFTVRVFQIVKKSTGKSQCVKHLQFTKWPDHGTPASADFFIKYVRYVRKSHITGPLLVHCSAGVGRTGVFICVDVVFSAIE-KNYSFDIMNIVTQMRKQRCGMIQTKEQYQFCYEIVLEVL 419          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 171.014 bits (432), Expect = 7.961e-46
Identity = 112/301 (37.21%), Postives = 153/301 (50.83%), Query Frame = 2
Query:  278 NFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD----FMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            NF  +F+  + DSN    ++++D+K  +     +     AE    KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  IV LT+  E GR KC +YWP K     A   GD  V +T           + V+    N     ++Q H TSW DH  P T+D    F      Y +   P   I+VHCSAGVGRTG+FI ID  + +IEN  + V++Y  + +LR  R  MVQTE QY F    +++C++
Sbjct: 1038 NFEAYFKKQQADSNCGFAEEYEDLK-LIGISLPKYTAEIAENR-GKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPL-------PNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQ----AQDYGDITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVF----LNQCVL 1309          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 170.629 bits (431), Expect = 9.892e-46
Identity = 112/301 (37.21%), Postives = 153/301 (50.83%), Query Frame = 2
Query:  278 NFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD----FMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            NF  +F+  + DSN    ++++D+K  +     +     AE    KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  IV LT+  E GR KC +YWP K     A   GD  V +T           + V+    N     ++Q H TSW DH  P T+D    F      Y +   P   I+VHCSAGVGRTG+FI ID  + +IEN  + V++Y  + +LR  R  MVQTE QY F    +++C++
Sbjct:  852 NFEAYFKKQQADSNCGFAEEYEDLK-LIGISLPKYTAEIAENR-GKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPLP-------NTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQ----AQDYGDITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVF----LNQCVL 1123          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 170.629 bits (431), Expect = 1.168e-45
Identity = 112/301 (37.21%), Postives = 153/301 (50.83%), Query Frame = 2
Query:  278 NFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD----FMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            NF  +F+  + DSN    ++++D+K  +     +     AE    KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  IV LT+  E GR KC +YWP K     A   GD  V +T           + V+    N     ++Q H TSW DH  P T+D    F      Y +   P   I+VHCSAGVGRTG+FI ID  + +IEN  + V++Y  + +LR  R  MVQTE QY F    +++C++
Sbjct:  945 NFEAYFKKQQADSNCGFAEEYEDLK-LIGISLPKYTAEIAENR-GKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPLP-------NTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQ----AQDYGDITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVF----LNQCVL 1216          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 159.844 bits (403), Expect = 6.717e-42
Identity = 106/277 (38.27%), Postives = 142/277 (51.26%), Query Frame = 2
Query:  398 EGSVHKNRYGNIRPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMN--KYKKTIKQLHMTSWLDHSCPT-TSDFMEFYAAYTRSKVP-SEAIIVHCSAGVGRTGSFILIDEELSRIENRTDK-VEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQR---GLSQVPER 1186
            E +  KNRY N+  Y H+RV L  L+     DYINA+ +   R  N             YIATQGPL E       T GDFWRMV E     +V +TR EE  R KC QYWP +  +   F      ++VT+ +  E + F  R  ++  N    K+ ++    T+W DH  P   + F+ F         P +  I+VHCSAGVGRTG FI+ID  L RI  +T+K V++Y  +  +R  R  MVQTE QY F    IHE L++    G ++VP R
Sbjct: 1373 EANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNA------------YIATQGPLPE-------TFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGF------IQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERI--KTEKTVDVYGHVTLMRSQRNYMVQTEDQYGF----IHEALLEAVGCGNTEVPAR 1618          

HSP 2 Score: 140.969 bits (354), Expect = 1.626e-35
Identity = 95/256 (37.11%), Postives = 127/256 (49.61%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSK---VPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNR  NI PY+ +RV L  +      DYINAS I         +G        YIATQGPL E  E       DFWR + ENN  I+V LT+  E GREKC QYWP + + R  +   D + E  M  +    I  E  +T + +   +T++Q   T W +   P + + F++F     ++K        I VHCSAGVGRTG FI +   L R+      V+I+ T+  LR  R  MVQTE +Y F +    E L
Sbjct: 1667 KNRLVNILPYESSRVCLQPIRGVEGSDYINASFI---------DG--YRQQKAYIATQGPLAETTE-------DFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQY----ILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYE-GVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYL 1899          
BLAST of Protein tyrosine phosphatase receptor type B vs. UniProt/SwissProt
Match: sp|O55082|PTN20_MOUSE (Tyrosine-protein phosphatase non-receptor type 20 OS=Mus musculus OX=10090 GN=Ptpn20 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 2.925e-46
Identity = 101/249 (40.56%), Postives = 128/249 (51.41%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKT--IKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNRY +I PY   RV L K  DYINAS I + +   +          +YIATQGPL E       TI DFW+MVLENN  +I  +TR  E G  KC  YWP    + + F      +E     F     FT RV  +      K+  +K L  T W DH  P ++DF   Y  Y R    +  ++VHCSAGVGRTG FI +D   S IE +    +I N +  +RK RC M+QT+ QY F Y I+ E L
Sbjct:  192 KNRYRDILPYDSTRVPLGKNKDYINASYIRIVNHEEEY---------FYIATQGPLPE-------TIEDFWQMVLENNCNVIAMITREIECGVIKCYSYWPISLKEPLEFEHFSVFLET----FHVTQYFTVRVFQIVKKSTGKSQCVKHLQFTKWPDHGTPASADFFIKYVRYVRKSHITGPLLVHCSAGVGRTGVFICVDVVFSAIE-KNYSFDIMNIVTQMRKQRCGMIQTKEQYQFCYEIVLEVL 419          
BLAST of Protein tyrosine phosphatase receptor type B vs. UniProt/SwissProt
Match: sp|Q12913|PTPRJ_HUMAN (Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens OX=9606 GN=PTPRJ PE=1 SV=3)

HSP 1 Score: 171.785 bits (434), Expect = 3.060e-45
Identity = 114/306 (37.25%), Postives = 157/306 (51.31%), Query Frame = 2
Query:  278 NFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNND-----RIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD----FMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            NF  +F+  + DSN    ++++D+K  V   Q +     AE    KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  I+ LT+  E GR KC +YWP K         +A +S   L E T+ +F   +I T              ++Q H TSW DH  P T+D    F      Y +   P   I+VHCSAGVGRTG+FI ID  + +IEN  + V++Y  + +LR  R  MVQTE QY F    +++C++
Sbjct: 1025 NFEAYFKKQQADSNCGFAEEYEDLK-LVGISQPKYAAELAENR-GKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPL-------PNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSE---------SHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVF----LNQCVL 1296          
BLAST of Protein tyrosine phosphatase receptor type B vs. UniProt/SwissProt
Match: sp|Q64455|PTPRJ_MOUSE (Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 5.712e-45
Identity = 112/301 (37.21%), Postives = 153/301 (50.83%), Query Frame = 2
Query:  278 NFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD----FMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            NF  +F+  + DSN    ++++D+K  +     +     AE    KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  IV LT+  E GR KC +YWP K     A   GD  V +T           + V+    N     ++Q H TSW DH  P T+D    F      Y +   P   I+VHCSAGVGRTG+FI ID  + +IEN  + V++Y  + +LR  R  MVQTE QY F    +++C++
Sbjct:  926 NFEAYFKKQQADSNCGFAEEYEDLK-LIGISLPKYTAEIAENR-GKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPLP-------NTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQ----AQDYGDITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVF----LNQCVL 1197          
BLAST of Protein tyrosine phosphatase receptor type B vs. UniProt/SwissProt
Match: sp|P35992|PTP10_DROME (Tyrosine-protein phosphatase 10D OS=Drosophila melanogaster OX=7227 GN=Ptp10D PE=1 SV=4)

HSP 1 Score: 169.088 bits (427), Expect = 3.228e-44
Identity = 110/311 (35.37%), Postives = 158/311 (50.80%), Query Frame = 2
Query:  251 ENDKSPLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVH--KNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            E ++  L  NF  H+  M  DS+ R  ++F+++KH            FA+   +  KNR+ NI PY H+R KL  +DD     YINA+ +              N    +I TQGPL   R+       DFWRM  E+N   IV LTR  E GREKC QYWP   ND +    GD  V++   +   + + TE +L       ++ ++  H T+W D   P     +  +    R ++ +E   I+VHCSAGVGR+G+FI +D  L +I N +D V+I+  +  +RK R  MVQTE QY      IH+CL+
Sbjct: 1247 EQNRPILIKNFAEHYRLMSADSDFRFSEEFEELKHVGRDQPCT----FADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVPGH-----------NSPREFIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCFEKGREKCDQYWP---NDTVPVFYGDIKVQILNDSHYADWVMTEFML--CRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRIGAEQRPIVVHCSAGVGRSGTFITLDRILQQI-NTSDYVDIFGIVYAMRKERVWMVQTEQQYI----CIHQCLL 1525          
BLAST of Protein tyrosine phosphatase receptor type B vs. UniProt/SwissProt
Match: sp|A1L1L3|PTN20_RAT (Tyrosine-protein phosphatase non-receptor type 20 OS=Rattus norvegicus OX=10116 GN=Ptpn20 PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.474e-43
Identity = 97/249 (38.96%), Postives = 126/249 (50.60%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKT--IKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNRY +I PY   RV L K  DYINAS I + +   +          +YIATQGPL +       TI DFW+MVLENN  +I  +TR  E G  KC  YWP    + + F     L+E    NF+    F  R+  +      K+  +K L    W DH  P ++DF   Y  Y R    +  ++VHCSAGVGRTG FI +D     IE +     I N +  +RK R  M+QT+ QY F Y I+ E L
Sbjct:  187 KNRYRDILPYDSTRVPLGKNKDYINASYIRIVNHEEEY---------FYIATQGPLPD-------TIEDFWQMVLENNCNVIAMITREIEGGVIKCCSYWPVSLKEPLEFKHFHVLLE----NFQITQYFVIRIFQIVKKSTGKSHSVKHLQFIKWPDHGTPASADFFIKYVRYVRKSHITGPLLVHCSAGVGRTGVFICVDVVFCTIE-KNYSFNIMNIVTQMRKQRFGMIQTKEQYQFCYEIVLEVL 414          
BLAST of Protein tyrosine phosphatase receptor type B vs. TrEMBL
Match: A0A5N4DMJ8 (Receptor-type tyrosine-protein phosphatase eta OS=Camelus dromedarius OX=9838 GN=Cadr_000014621 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 5.999e-46
Identity = 115/312 (36.86%), Postives = 158/312 (50.64%), Query Frame = 2
Query:  278 NFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNND-----RIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD----FMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQ 1174
            NF  +F+  + DSN    ++++D+KH    L        AE    KNRY N+ PY  +RV+L+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  IV LT+  E GR KC +YWP K         +A +S   L E T+ +F   +I T              ++Q H TSW DH  P T+D    F      Y +   P   ++VHCSAGVGRTG+FI ID  + +IEN  + V++Y  + +LR  R  MVQTE QY F    +++C++    SQ
Sbjct:   28 NFEAYFKKQQADSNCGFAEEYEDLKHVGISLPKFAAE-LAENR-GKNRYNNVLPYDISRVRLSVQTHSADDYINANYMPGYHSKKD-----------FIATQGPLP-------NTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSE---------SHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPVLVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVF----LNQCVLDIIRSQ 305          
BLAST of Protein tyrosine phosphatase receptor type B vs. TrEMBL
Match: H9F9B3 (Receptor-type tyrosine-protein phosphatase eta isoform 1 (Fragment) OS=Macaca mulatta OX=9544 GN=PTPRJ PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 3.178e-45
Identity = 115/315 (36.51%), Postives = 159/315 (50.48%), Query Frame = 2
Query:  278 NFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVH---KNRYGNIRPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNND-----RIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD----FMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQ 1174
            NF  +F+  + DSN    ++++D+K     L   +   +A G      KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  I+ LT+  E GR KC +YWP K         +A +S   L E T+ +F   +I T              ++Q H TSW DH  P T+D    F      Y +   P   I+VHCSAGVGRTG+FI ID  + +IEN  + V++Y  + +LR  R  MVQTE QY F    +++C++    SQ
Sbjct:   67 NFEAYFKKQQADSNCGFAEEYEDLK-----LVGISQPKYAAGLAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPLP-------NTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSE---------SHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVF----LNQCVLDIVRSQ 344          
BLAST of Protein tyrosine phosphatase receptor type B vs. TrEMBL
Match: K9KG28 (Receptor-type tyrosine-protein phosphatase eta-like protein (Fragment) OS=Equus caballus OX=9796 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.469e-45
Identity = 112/306 (36.60%), Postives = 156/306 (50.98%), Query Frame = 2
Query:  278 NFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNND-----RIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD----FMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            NF  +F+  + DSN    ++++D+K  V     +     AE    KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E N+  IV LT+  E GR KC +YWP K         +A +S   L E T+ +F   +I T              ++Q H TSW DH  P T+D    F      Y +   P   ++VHCSAGVGRTG+FI ID  + +IEN  + V++Y  + +LR  R  MVQTE QY F    +++C++
Sbjct:   34 NFEAYFKKQQADSNCGFAEEYEDLK-IVGINLPKYAAELAENR-GKNRYNNVLPYDISRVKLSIQTHSTDDYINANYMPGYHSKRD-----------FIATQGPLP-------NTLKDFWRMVWEKNIYAIVMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSESVLPEWTIRDFTVKNIQTSE---------SHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPVLVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVF----LNQCVL 305          
BLAST of Protein tyrosine phosphatase receptor type B vs. TrEMBL
Match: Q61373 (Protein tyrosine phosphatase (Fragment) OS=Mus musculus OX=10090 GN=Ptprj PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 5.004e-45
Identity = 112/301 (37.21%), Postives = 153/301 (50.83%), Query Frame = 2
Query:  278 NFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLN----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD----FMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLI 1156
            NF  +F+  + DSN    ++++D+K  +     +     AE    KNRY N+ PY  +RVKL+      DDYINA+ +   H   D           +IATQGPL        +T+ DFWRMV E NV  IV LT+  E GR KC +YWP K     A   GD  V +T           + V+    N     ++Q H TSW DH  P T+D    F      Y +   P   I+VHCSAGVGRTG+FI ID  + +IEN  + V++Y  + +LR  R  MVQTE QY F    +++C++
Sbjct:   49 NFEAYFKKQQADSNCGFAEEYEDLK-LIGISLPKYTAEIAENR-GKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKD-----------FIATQGPLP-------NTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQ----AQDYGDITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPESPILVHCSAGVGRTGTFIAIDRLIYQIENE-NTVDVYGIVYDLRMHRPLMVQTEDQYVF----LNQCVL 320          
BLAST of Protein tyrosine phosphatase receptor type B vs. TrEMBL
Match: T1I801 (Uncharacterized protein (Fragment) OS=Rhodnius prolixus OX=13249 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.564e-43
Identity = 116/332 (34.94%), Postives = 167/332 (50.30%), Query Frame = 2
Query:  266 PLAL-NFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVH--KNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSE--AIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVPERDRPANPQSIYHSQSY 1231
            P+ L NF  H+  M  DS+ R  ++F+++KH   +        FA+ S +  KNR+ NI PY H+R KL  +DD     YINA+   V  WN+            +I TQGPL   R+       DFWRM  E+N   IV LTR  E GREKC  YWP    D +    GD  + VT+ N      ++     ++    ++ I+  H T+W D   P     +  +    R ++  E   I+VHCSAGVGR+G+FI +D  L  + + TD V+I+  +  +RK R  MVQTE QY      IH+CL    L+ +   D    P+ I+H+Q +
Sbjct:  289 PIRLENFAEHYRIMSADSDFRFSEEFEELKHVGREQPCT----FADLSCNRPKNRFTNILPYDHSRFKLQPVDDEEGSDYINANY--VPGWNSPRE---------FIVTQGPLHSTRD-------DFWRMCWESNSRAIVMLTRCIEKGREKCDHYWP---YDTMPVYYGD--ISVTILNDSHYPDWSITEFIMARGDTQRVIRHFHFTTWPDFGVPNPPTTLVRFVRAFRERISPEQRPIVVHCSAGVGRSGTFIALDRILQSLNHGTDHVDIFGIVWAMRKERVWMVQTEQQYI----CIHQCL----LAVLEGEDNQTPPREIHHNQGF 585          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Cavefish
Match: ptprb (receptor-type tyrosine-protein phosphatase beta [Source:NCBI gene;Acc:103042836])

HSP 1 Score: 157.532 bits (397), Expect = 2.640e-41
Identity = 114/325 (35.08%), Postives = 161/325 (49.54%), Query Frame = 2
Query:  263 SPL-ALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTE-RVLTVSMNKYKKTIKQLHMTSWLDHSCP-TTSDFMEFYAA---YTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVPERDRPANP 1204
            SP+ A +F +H   ++ DSN    ++F+D+K               E    KNRY NI PY   RVKL  L+D     +INAS I    +  +           YIATQGPL   ++       DFWRMV E+NV  IV +T+  E GR KC QYWP    DR     G+ +V +   +     I  E ++       Y + ++  + T W DH  P TT   ++F      Y      S   +VHCSAGVGRTG+FI++D  L ++++R   V+IY ++ +LR  R  MVQTESQY F +  + + L  R L    E++ P  P
Sbjct: 1592 SPIKAAHFESHLSKLQADSNYLFSEEFEDLKDVGRNQTLDAAR-LPENRC-KNRYNNILPYDATRVKLLCLEDDPCSDFINASFIPGNSFGRE-----------YIATQGPLPGTKD-------DFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWP---TDREPLYYGELVVHMLSESVLSEWIIREFKISREGQLSYPRIVRHFNYTVWPDHGVPETTQSLIQFVRTVRDYIDRAPTSGPTVVHCSAGVGRTGTFIVLDRALQQLDSR-GTVDIYGSVRDLRLHRIHMVQTESQYMFLHQCVRDVLRARKLRC--EQENPLYP 1890          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Cavefish
Match: ptprb (receptor-type tyrosine-protein phosphatase beta [Source:NCBI gene;Acc:103042836])

HSP 1 Score: 157.532 bits (397), Expect = 2.689e-41
Identity = 114/325 (35.08%), Postives = 161/325 (49.54%), Query Frame = 2
Query:  263 SPL-ALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTE-RVLTVSMNKYKKTIKQLHMTSWLDHSCP-TTSDFMEFYAA---YTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVPERDRPANP 1204
            SP+ A +F +H   ++ DSN    ++F+D+K               E    KNRY NI PY   RVKL  L+D     +INAS I    +  +           YIATQGPL   ++       DFWRMV E+NV  IV +T+  E GR KC QYWP    DR     G+ +V +   +     I  E ++       Y + ++  + T W DH  P TT   ++F      Y      S   +VHCSAGVGRTG+FI++D  L ++++R   V+IY ++ +LR  R  MVQTESQY F +  + + L  R L    E++ P  P
Sbjct: 1592 SPIKAAHFESHLSKLQADSNYLFSEEFEDLKDVGRNQTLDAAR-LPENRC-KNRYNNILPYDATRVKLLCLEDDPCSDFINASFIPGNSFGRE-----------YIATQGPLPGTKD-------DFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWP---TDREPLYYGELVVHMLSESVLSEWIIREFKISREGQLSYPRIVRHFNYTVWPDHGVPETTQSLIQFVRTVRDYIDRAPTSGPTVVHCSAGVGRTGTFIVLDRALQQLDSR-GTVDIYGSVRDLRLHRIHMVQTESQYMFLHQCVRDVLRARKLRC--EQENPLYP 1890          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Cavefish
Match: ENSAMXT00000012844.2 (receptor-type tyrosine-protein phosphatase S-like [Source:NCBI gene;Acc:103032152])

HSP 1 Score: 155.606 bits (392), Expect = 1.294e-40
Identity = 111/302 (36.75%), Postives = 148/302 (49.01%), Query Frame = 2
Query:  290 HFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKY----KKTIKQLHMTSWLDHSCPT-TSDFMEFYAAYTRSKVP-SEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQ 1159
            H E +K + N RL  +++ +          + L   E +  KNRY N+  Y H RV L  +D     DYINA+ I   R  N             YIATQGPL E       T GDFWRMV E     +V +T+ EE  R KC QYWP +  D         LV+VT+ +  E + F  R  T S++K     ++ ++Q   T+W DH  P   + F+ F         P +  + VHCSAGVGRTG FI+ID  L RI +    V+IY  +  +R  R  MVQTE QY F    IHE L++
Sbjct:  904 HTELLKANDNLRLSQEYESVDPGQQFTWEHSNL---EVNKPKNRYANVIAYDHTRVILAPVDGIMGSDYINANYIDGYRKQNA------------YIATQGPLPE-------TFGDFWRMVWEQRAASVVMMTKLEEKSRIKCDQYWPSRGTDTYG------LVQVTLLDTMELATFCVR--TFSLHKSGCNERREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKACNPPDAGPVAVHCSAGVGRTGCFIVIDAMLERIRHER-TVDIYGHVTLMRSQRNYMVQTEDQYGF----IHEALLE 1170          

HSP 2 Score: 142.124 bits (357), Expect = 4.521e-36
Identity = 96/256 (37.50%), Postives = 127/256 (49.61%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSK---VPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNR  NI PY+  RV L  +      DYINAS I         +G        YIATQGPL E  E       DFWRM+ E+N  I+V LT+  E GREKC QYWP + + R  +   D + E  M  +    I  E  +T + +   +T++Q   T W +   P + + F++F     ++K        I VHCSAGVGRTG FI +   L R+      V+I+ T+  LR  R  MVQTE +Y F Y    E L
Sbjct: 1231 KNRLVNIMPYETTRVCLQPIRGLEGSDYINASFI---------DG--YRQQKAYIATQGPLAETTE-------DFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQY----ILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYE-GAVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1463          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Cavefish
Match: ENSAMXT00000038448.1 (receptor-type tyrosine-protein phosphatase S-like [Source:NCBI gene;Acc:103032152])

HSP 1 Score: 155.221 bits (391), Expect = 1.474e-40
Identity = 111/303 (36.63%), Postives = 148/303 (48.84%), Query Frame = 2
Query:  290 HFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLD------DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKY----KKTIKQLHMTSWLDHSCPT-TSDFMEFYAAYTRSKVP-SEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQ 1159
            H E +K + N RL  +++ +          + L   E +  KNRY N+  Y H RV L  +D      DYINA+ I   R  N             YIATQGPL E       T GDFWRMV E     +V +T+ EE  R KC QYWP +  D         LV+VT+ +  E + F  R  T S++K     ++ ++Q   T+W DH  P   + F+ F         P +  + VHCSAGVGRTG FI+ID  L RI +    V+IY  +  +R  R  MVQTE QY F    IHE L++
Sbjct:  943 HTELLKANDNLRLSQEYESVDPGQQFTWEHSNL---EVNKPKNRYANVIAYDHTRVILAPVDAGIMGSDYINANYIDGYRKQNA------------YIATQGPLPE-------TFGDFWRMVWEQRAASVVMMTKLEEKSRIKCDQYWPSRGTDTYG------LVQVTLLDTMELATFCVR--TFSLHKSGCNERREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKACNPPDAGPVAVHCSAGVGRTGCFIVIDAMLERIRHER-TVDIYGHVTLMRSQRNYMVQTEDQYGF----IHEALLE 1210          

HSP 2 Score: 142.51 bits (358), Expect = 3.474e-36
Identity = 96/256 (37.50%), Postives = 127/256 (49.61%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNR  NI PY+  RV L  +      DYINAS I         +G        YIATQGPL E  E       DFWRM+ E+N  I+V LT+  E GREKC QYWP + + R  +   D + E  M  +    I  E  +T + +   +T++Q   T W +   P + + F++F     ++K        I VHCSAGVGRTG FI +   L R+      V+I+ T+  LR  R  MVQTE +Y F Y    E L
Sbjct: 1271 KNRLVNIMPYETTRVCLQPIRGLEGSDYINASFI---------DG--YRQQKAYIATQGPLAETTE-------DFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQY----ILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYE-GAVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1503          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Cavefish
Match: ENSAMXT00000035527.1 (receptor-type tyrosine-protein phosphatase S-like [Source:NCBI gene;Acc:103032152])

HSP 1 Score: 155.221 bits (391), Expect = 1.699e-40
Identity = 111/303 (36.63%), Postives = 148/303 (48.84%), Query Frame = 2
Query:  290 HFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLD------DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKY----KKTIKQLHMTSWLDHSCPT-TSDFMEFYAAYTRSKVP-SEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQ 1159
            H E +K + N RL  +++ +          + L   E +  KNRY N+  Y H RV L  +D      DYINA+ I   R  N             YIATQGPL E       T GDFWRMV E     +V +T+ EE  R KC QYWP +  D         LV+VT+ +  E + F  R  T S++K     ++ ++Q   T+W DH  P   + F+ F         P +  + VHCSAGVGRTG FI+ID  L RI +    V+IY  +  +R  R  MVQTE QY F    IHE L++
Sbjct:  943 HTELLKANDNLRLSQEYESVDPGQQFTWEHSNL---EVNKPKNRYANVIAYDHTRVILAPVDAGIMGSDYINANYIDGYRKQNA------------YIATQGPLPE-------TFGDFWRMVWEQRAASVVMMTKLEEKSRIKCDQYWPSRGTDTYG------LVQVTLLDTMELATFCVR--TFSLHKSGCNERREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKACNPPDAGPVAVHCSAGVGRTGCFIVIDAMLERIRHE-RTVDIYGHVTLMRSQRNYMVQTEDQYGF----IHEALLE 1210          

HSP 2 Score: 135.576 bits (340), Expect = 7.772e-34
Identity = 93/247 (37.65%), Postives = 123/247 (49.80%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSKV---PSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCF 1126
            KNR  NI PY+  RV L  +      DYINAS I         +G        YIATQGPL E  E       DFWRM+ E+N  I+V LT+  E GREKC QYWP + + R  +   D + E  M  +    I  E  +T + +   +T++Q   T W +   P + + F++F     ++K        I VHCSAGVGRTG FI +   L R+      V+I+ T+  LR  R  MVQTE   CF
Sbjct: 1271 KNRLVNIMPYETTRVCLQPIRGLEGSDYINASFI---------DG--YRQQKAYIATQGPLAETTE-------DFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQY----ILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYE-GAVDIFQTVKMLRTQRPAMVQTE--VCF 1492          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 142.51 bits (358), Expect = 3.900e-37
Identity = 96/262 (36.64%), Postives = 131/262 (50.00%), Query Frame = 2
Query:  398 EGSVHKNRYGNIRPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGK-----NNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHE 1147
            E +  KNRY NI PY + RV L  L+     DYINAS +         NG      + +IA QG     + PK  T+ D+WRM+ E N   IV +T  +E    KC+QYWP +      N R++      LV+ T+  F       + V  +   K  + I Q H TSW D   P     M  +    ++  P  A  I+VHCSAGVGRTG+FI+ID  L  I+    KV+++  +  +R  RCQMVQT+ QY F Y  + E
Sbjct:  209 EENKEKNRYVNILPYDNFRVHLTSLEGVPDSDYINASYV---------NGY--QEKNKFIAAQG-----KGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWPDQGCWTYGNLRVSVEDVTVLVDYTIRKF-----LIQVVGDIPNKKPPRLITQFHFTSWPDFGVPFAPIGMLKFLKKVKTCNPPYAGPIVVHCSAGVGRTGTFIVIDAMLDMIQTE-RKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQALLE 448          

HSP 2 Score: 122.865 bits (307), Expect = 1.675e-30
Identity = 88/259 (33.98%), Postives = 128/259 (49.42%), Query Frame = 2
Query:  401 GSVHKNRYGNIRPYQHNRVKL-----NKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKT--IKQLHMTSWLDHSCPTTSDFM-EFYAAYTRSK--VPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHE 1147
             ++ KNR   I PY  NRV +      +  DYIN S I         +G      D ++A QGPL +       T+ DFWRMV E   C IV LT  EE G+EKC++YWP +       + GD ++E+   N  ++  +T R  +VS  +  K+  I+Q H   W +   P     M    AA  + +    +  I VHCSAG GRTG+F  +   L R++     ++++ T+ +LR  R  MVQT  QY F Y ++ E
Sbjct:  505 ANMKKNRVLQIIPYDFNRVIIPMKRGEEFTDYINGSFI---------DGY--RQKDAFLAGQGPLQQ-------TVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYWPTEGT----ITYGDIIIELKQENSHDS--YTVRDFSVSNTRENKSRQIRQFHFHGWPEIGIPEDGKGMISLIAAVQKQQQHTGNHPITVHCSAGAGRTGTFCALCTILERVKTE-GILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQE 738          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008162.1 (pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-1 gene:ENSPMAG00000007379.1 transcript:ENSPMAT00000008162.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.346 bits (342), Expect = 1.723e-36
Identity = 92/247 (37.25%), Postives = 125/247 (50.61%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGK-----NNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQ 1117
            KNRY NI PY  +RV+L+ ++     DYINAS I         NG      + +IA QGP       K  TI DFWRM+ E N   IV +T  +E    KCSQYWP K      + R++      LV+ T+  F       + V         + + Q H TSW D   P T   M  +    ++  PS +  I+VHCSAGVGRTG+FI+ID  L  I+    +V+++  +  +R  RCQMVQT+ Q
Sbjct:   62 KNRYINILPYDQSRVQLSPIESVPGSDYINASYI---------NGY--REKNKFIAAQGP-------KEETINDFWRMIWEQNTSTIVMVTNLQERKHTKCSQYWPDKGCWTYGSVRVSVEDITVLVDYTIRKF-----CVQLVGEGPGKHQARLVTQFHFTSWPDFGVPFTPIGMLKFLKKVKTSNPSYSGPIVVHCSAGVGRTGTFIVIDAMLDMIQAE-QRVDVFGFVSRIRAQRCQMVQTDLQ 284          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Sea Lamprey
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 137.502 bits (345), Expect = 2.858e-35
Identity = 90/263 (34.22%), Postives = 131/263 (49.81%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNND----RIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGL 1168
            KNRYGNI  Y H+RV LN LD     DYINA+ +   +            T +YIATQGPL +       T+G FWRM+ +     I+ +T   E GR KC +YWP  ++     ++  +  + L E  +  FR      E +         + ++Q H T W DH  P  +  +  +    ++  P  A  ++VHCSAG GRTG +++ID  L   E+    ++IYN +  LR  R  MVQTE QY F    IH+ +++  L
Sbjct:  944 KNRYGNIIAYDHSRVMLNVLDEEQNSDYINANYVDGYYR-----------THHYIATQGPLPD-------TVGGFWRMIWQERSASIIMVTNLVEVGRIKCCKYWPDGSDVYGDIKVTLADTEMLSEYIIRTFRVERAGQEDI---------REVRQFHFTGWPDHGVPYHATGLLAFIRRIKALDPPHAGPLVVHCSAGAGRTGCYMVIDIMLDMAESE-GVIDIYNCVRELRTRRVNMVQTEEQYVF----IHDAMLEACL 1174          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006037.1 (pep scaffold:Pmarinus_7.0:GL477253:2:79428:1 gene:ENSPMAG00000005380.1 transcript:ENSPMAT00000006037.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.502 bits (345), Expect = 2.961e-35
Identity = 95/271 (35.06%), Postives = 137/271 (50.55%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLDD----YINASRICVR----HWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENS-IFTERVLTVS--MNKYKKTIKQLHMTSWLDHSCPT-TSDFMEFYAA------YTRSKVP----SEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQ 1159
            +NR+G++ PY+  RV+L    D    YINAS + VR     W             +YIATQGPL        +T  DFW+M+ E  V +I  +T  +E+GR+KC +YWP   + R + + GDY V    T FR +S  +    L V    +  ++T   LH   W DH CP     F+ F         +T S +P    S  ++VHCSAGVGR+G  IL +  ++ +E+   ++++   L  LR  R  MVQT +QY F Y    + LIQ
Sbjct:  898 RNRFGDVLPYEQTRVELLPSKDNPTGYINASHVRVRVGGEQW-------------HYIATQGPL-------PNTCQDFWQMIWEQGVSVIAMVTPEQESGRQKCHRYWPKLGSKRNSANYGDYRV---TTKFRTDSGSYATTGLKVKHLPSGQERTAWHLHYPDWPDHGCPEDVQRFLAFLEEVQSVRRHTNSMLPPHTASPPVVVHCSAGVGRSGVLILTEITIAGLEHNV-QLDVPQALGVLRGQRMLMVQTLAQYQFVY----QALIQ 1140          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003525.1 (pep scaffold:Pmarinus_7.0:GL477320:686:22463:-1 gene:ENSPMAG00000003196.1 transcript:ENSPMAT00000003525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.65 bits (335), Expect = 3.356e-34
Identity = 90/255 (35.29%), Postives = 135/255 (52.94%), Query Frame = 2
Query:  398 EGSVHKNRYGNIRPYQHNRVKLNKL--DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKT----IKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPS------EAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCF 1126
            E +  KNRY +I PY HNRVKL+     DYINAS   V  + + +          YIA QGPL        +T GDFW+M+ E    +IV +T+ EE G+ KC QYWP  + D+ A+  GD  V VT+ + +  +    R L++S +K++      +  + + SW DH  P   + +       R +V S       A++VHCSAGVGR+G++I +D  + ++EN    V++Y  +  LR  R  MVQ E ++  
Sbjct:  427 EYNTKKNRYSDILPYDHNRVKLSGEGESDYINASY--VDGYKSSIR---------YIAAQGPL-------ENTAGDFWQMIWEKKSSVIVMVTKCEEMGKVKCFQYWPHPDEDKRAY--GD--VTVTIMDEKPYADIVIRTLSISHSKHRGFGAHWVTHVQLVSWPDHGVPEDPNLL----LKLRRRVNSFNGAGCTAVVVHCSAGVGRSGTYIGLDCLVRQLENE-GHVDVYGCVFRLRHQRPLMVQVEVRFAI 654          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 105.916 bits (263), Expect = 4.493e-26
Identity = 94/283 (33.22%), Postives = 124/283 (43.82%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL--DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLEN---NVCIIVNLTRSEENGREKCSQYWP-----------------GKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVS--MNKYKKTIKQLHMTSWLDHSCPT-TSDFMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDE------------ELSRIENRT------DKVEIYNTLINLRKSRCQMVQTESQYCFTY 1132
            +NRY NI PY+ NRV L  L  +DYINAS + V     ++ G       YYIATQGP  +       T   FW+M   N   +  +IV +T   E  REKC QYWP                 G  ND   F S   +  V +   ++    T+  LT +  +    KT+   +   W D + P      ME  A           IIVHCSAGVGRTG+FI +D             E SR  +R       D +E    ++ LR  R +MVQT+ Q+ F Y
Sbjct:   55 RNRYVNIMPYERNRVHLKTLSGNDYINASYVKV-----NVPGQSIE-PGYYIATQGPTRK-------TWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCAHSHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIE--QIVLQLRSQRMKMVQTKDQFLFIY 322          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Yeast
Match: PTP3 (Phosphotyrosine-specific protein phosphatase; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm [Source:SGD;Acc:S000000877])

HSP 1 Score: 69.3218 bits (168), Expect = 4.989e-13
Identity = 50/158 (31.65%), Postives = 77/158 (48.73%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNK-------------------LDDYINASRICVRHWNTDLNGSPCNCTDY-----YIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNND--RIAFSSGDYLVEVTMTNFRENSIFTE 808
            KNRY +I PY+H+RV L K                   LD+YINA+ + +  ++ + N S    T       YIATQ P+        ST+ DF+  +L N V ++++LT   ENG EKC +YW   N +   +       L   + T+ R+N++ T+
Sbjct:  530 KNRYKDIFPYEHSRVILKKGLQSSKGIKHSHSTSDGGILDNYINANYLSLPRFSVEQNSSFQTTTTTTRRVRYIATQAPMP-------STVHDFYTCILNNGVPLVLSLTNDFENGIEKCYRYWQEGNYNGIHVKLLEKKILKMPSTTSMRKNTMGTQ 680          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 56.9954 bits (136), Expect = 2.848e-9
Identity = 78/351 (22.22%), Postives = 122/351 (34.76%), Query Frame = 2
Query:  392 FAEG--SVHKNRYGNIRPYQHNRVKLN----------------------------------KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKK--------------------------TIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEAIIVHCSAGVGR-------------------------------TGSFILIDEELSRIE---NRTDKVEIYNT-------LIN-LRKSRCQMVQTESQYCFTY 1132
              EG  S  KNRY NI PY+H+RVKL                                   K +DYINA+ + +   N D           YIATQ PL        ST+ DFW+++  N V +I++L   +E    K   YW     + +++S+    ++ T  N    +    RV  V     +                            + QL   +WLD      +D ++ +          ++ I      V +                               TG F+ +D  LS +    N ++K++++N        ++N LRK R  MVQ  +QY   Y
Sbjct:  402 LTEGIQSFTKNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFK---------YIATQAPLP-------STMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYW-----NNLSYSNHTIKLQNTWENICNINGCVLRVFQVKKTAPQNDNISQDCDLPHNGDLTSITMAVSEPFIVYQLQYKNWLDSCGVDMNDIIKLHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNSELHLDTANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACY 731          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Nematostella
Match: EDO48187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK45])

HSP 1 Score: 150.214 bits (378), Expect = 4.183e-40
Identity = 107/265 (40.38%), Postives = 139/265 (52.45%), Query Frame = 2
Query:  410 HKNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTD-YYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYK--KTIKQLHMTSWLDHSCPTT-SDFMEFYAAYTRSKVPSEA-IIVHCSAGVGRTGSFILIDEELSRI-ENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLS 1171
            HKNRY NI  Y H+RVKL   +D     YINA            N  P    D  YIA QGPL E       T  DFWRMV E N   I+ LT  +E  R+KC+QYWP +     + S  D  + VT+ +  E + +  R L+V        + +KQ H TSW DH  PT+  + + F    TR+  P    ++VHCSAGVGRTG+FI+ID  L +I E +T  V+I   +  LR+ R  MVQTE QY F    IH+ L+   +S
Sbjct:   46 HKNRYINIVAYDHSRVKLQDFEDEPGSDYINA------------NFLPGYRRDNAYIAAQGPLAE-------TCRDFWRMVWEQNSRTIIMLTNLKERCRDKCAQYWPSRG----SLSYED--ITVTLDSVTELTPYIVRTLSVQREGCDDVRQVKQFHFTSWPDHGVPTSVCNLLAFVRDSTRADPPGAGPMVVHCSAGVGRTGTFIVIDVMLQQIHEEKT--VDILGFVSTLRRHRNLMVQTEQQYIF----IHDALLDAIIS 279          

HSP 2 Score: 123.635 bits (309), Expect = 9.355e-31
Identity = 90/261 (34.48%), Postives = 128/261 (49.04%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLN-----KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERV--LTVSMNKYKKTIKQLHMTSWLDHSCPTTSDF-------MEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNRY N+ PY   RV+L+     +  DYINA+ I         +G     T  +IATQ P+ E       TI DFWRMV E N C IV L +  E  + K  +YWPGK    I F S    + V M +  ++     R+  LT +     + ++Q H TSW + + P            +     Y +++     IIVHCSAGVGRTG F  +   + R++     V+++ T+  LR+ R  MVQT+ QY F Y ++ E L
Sbjct:  336 KNRYANVLPYDVTRVRLSMQVGVEGSDYINANYI---------DGYMAKRT--FIATQAPIPE-------TIPDFWRMVWEQNCCTIVTLAQEVEQAKAKMHRYWPGKQP--ITFGS----LVVEMQDKVKSGHLVVRIFKLTNTEVSASRDVRQFHYTSWTEEN-PLEDGLSRCQLIDLIGQVQYWQAESGRHPIIVHCSAGVGRTGVFCAVSILIERLKAEA-MVDVFQTVKQLREQRPAMVQTKGQYDFCYQVVLEYL 570          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Nematostella
Match: EDO46961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP0])

HSP 1 Score: 152.525 bits (384), Expect = 4.757e-40
Identity = 106/318 (33.33%), Postives = 151/318 (47.48%), Query Frame = 2
Query:  245 PDENDKSPLA-LNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDY-----YIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMN--KYKKTIKQLHMTSWLDHSCPT-TSDFMEFYAAYTRSKVP-SEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            P   D  P++ L+   H   +K D+N +   +++ I+       + + +   +G   KNRY NI  Y H+RV+L+ ++     DYINA+                 C  Y     YIATQGP+         T  DFWRMV E     IV LTR EE GR KC QYWP    D          +EV++ ++ E + +T   L +        + +K    T W DH  P   + F+ F         P +  I+VHCSAGVGRTG FI+ID  L R+ +  + V+IY  +  LR  R  MVQT+ QY F++  I E +
Sbjct: 1292 PAMIDHPPISVLDLPKHIAILKADNNSQFTQEYESIEPGQTFTADSSQMECNKG---KNRYPNIHAYDHSRVRLSYINGIEGSDYINAN----------------FCDGYRKERAYIATQGPMQH-------TAADFWRMVWEQRTFTIVMLTREEERGRVKCDQYWPTDGTDVYEG------IEVSLVDWVELANYTISTLQICKEGASQPREVKHFQFTGWPDHGVPAHPTPFLAFLRRVKFYNPPDAGPIVVHCSAGVGRTGCFIVIDSMLERLRHE-ETVDIYGHVTVLRTQRNYMVQTQEQYIFSHDAILEAV 1576          

HSP 2 Score: 115.931 bits (289), Expect = 1.064e-27
Identity = 88/258 (34.11%), Postives = 121/258 (46.90%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNF--RENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSD-FMEFYAAYTRSKVPSE---AIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNR  NI PY+  RV ++ +      DYINAS I         +G        +IATQGPL +       T+ DFWRM++E N  IIV LT+  E   EKC +YWP   + R  +   D + E     F  R+  +   R  TV      + IKQ H   W +   P + +  ++      R+    E    I VHCS GVGRTG F  +   L R+ +    V+++ T+  LR  R  MVQ++ QY F Y    E L
Sbjct: 1634 KNRLANILPYETTRVHISPVRGVEGSDYINASFI---------DG--YRQRGLFIATQGPLQD-------TVDDFWRMLMEQNSNIIVMLTQLHEGEWEKCYKYWPTDRSARHQYYIVDPIAEHEYPQFVIRDFKVKDARSDTV------RNIKQFHFLGWPETGVPKSGEGIIDLIGQVQRAYEQQEEEGPITVHCSDGVGRTGVFTALFIVLERMRSE-GVVDLFQTVKLLRTQRPAMVQSQEQYLFCYKTALEYL 1866          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Nematostella
Match: EDO38304 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC7])

HSP 1 Score: 142.51 bits (358), Expect = 2.460e-39
Identity = 91/257 (35.41%), Postives = 135/257 (52.53%), Query Frame = 2
Query:  398 EGSVHKNRYGNIRPYQHNRVKLN--KLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHM--TSWLDHSCPTTSDFMEFYAAYTRSKVPSEA-IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            + +  KNRY N+ PY+  RV+L+    +DYINA+ I V     D      + T +YIATQGPL        +T  DFW+M+ E  V ++  +T  +E G+ KC +YWP   N  +       +  +  TN+     F +R + V   +  K+I+  H+    W DH  P +   M  + AY RS   S+A ++VHCSAG+GRTG+ I +D  L  +E R    +I  T+ +LR+ R  M+QT+ QY F Y    E L
Sbjct:   54 QANTDKNRYRNVLPYEATRVRLSGSSGEDYINANHIRVL---VD------DDTYHYIATQGPLP-------NTTKDFWQMIWEQGVEVVAMVTLDKEGGKVKCHRYWPDNTNQPLKLGGRFEVSLLKQTNYDS---FVQRDIAVKHLQSGKSIEIAHLNFVKWPDHGVPRSPVEMVQFVAYMRSLATSQAPVVVHCSAGIGRTGALIAVDVALGLME-RDKPFDINQTIRDLREQRQGMIQTKDQYIFCYKACLEVL 290          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Nematostella
Match: EDO43854 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI9])

HSP 1 Score: 147.132 bits (370), Expect = 5.673e-39
Identity = 101/270 (37.41%), Postives = 135/270 (50.00%), Query Frame = 2
Query:  410 HKNRYGNIRPYQHNRVKLNKLD-----DYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYK---KTIKQLHMTSWLDHSCPT-TSDFMEFYAAYTRSKVPSEA-IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVPERD 1189
            +KNRY NI  Y H+RV L  L+     DYINA+ I              N +  +IA+QGPL E       T  DFWRMV E    IIV LT+ EE GR KC QYWP    DR   + G   + VT       S +  R   VS  + +   + ++Q H TSW DH  P   +  +      + +  P+   +IVHCSAGVGRTG+FI +D  L R       ++++  +  +R  R  MVQTESQY F    IH+ L++  +  V E D
Sbjct:   48 YKNRYANIVAYDHSRVLLTPLEGVLESDYINANYI-----------DGYNRSGAFIASQGPLPE-------TFDDFWRMVWEQGSAIIVMLTQLEERGRRKCDQYWP----DRGTRNYG--ALRVTANETFHMSYYVLRTFLVSHMQEEEEPRQVRQYHYTSWPDHGVPAHPAPLLSMVRTVSSANPPTAGPMIVHCSAGVGRTGTFITLDSMLQRAAQE-GTIDVFGFVRQMRNKRNLMVQTESQYVF----IHDALVEAVICGVTEVD 288          

HSP 2 Score: 126.716 bits (317), Expect = 1.006e-31
Identity = 90/258 (34.88%), Postives = 124/258 (48.06%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNN---DRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTS-DFMEFYAAYTRSKVPS--EAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNRY NI PY+  RV L+        DYINAS I   H               YIATQ P+     P+  T  DFWRM+ E    +IV LTR EE G+ KC +YWP   +   D+I       LVE+T      + +  +  LT +  K  + ++Q   T W D   P +    ++      + +  S    I VHCS GVGRTG F  +   + R++     ++++ T+ +LR  R  MVQT+ QY F YT I E L
Sbjct:  339 KNRYANILPYERTRVALHMRPGEVGSDYINASFIDGNH-----------RLKAYIATQAPV-----PR--TFEDFWRMLWEQESAVIVMLTREEEAGKLKCHRYWPSDGSRLYDKI-------LVELTEELTYSDYVLRQFSLTHTEEKSSRIVRQFQCTDWPDSGLPESGVGLIDLIGQVEKWQQQSGNTCITVHCSGGVGRTGVFCAVSILIERVKAE-GLIDVFQTVQHLRLQRPAMVQTKDQYEFCYTTIQEYL 570          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Nematostella
Match: EDO35062 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMI4])

HSP 1 Score: 142.895 bits (359), Expect = 1.465e-37
Identity = 100/269 (37.17%), Postives = 142/269 (52.79%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKL------NKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKY--KKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVP--SEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVPERD 1189
            KNRY NI  Y H+RV L      +K+ DYINAS +         +GS       YIATQGP+       V++  DFWRM+ +    +IV LT  +E+ + KC QYWP      ++   GD  V V  T    +  +T+RVL ++      K+ + QLH T W D   P  +  +  +     +  P  S  I+VHCSAGVGRTG++I ID  L++  +R  KV+IY  +  +R+ R  MVQTE QY F +  I E  +  G ++VP +D
Sbjct:    3 KNRYANIIAYDHSRVILEPDSAGDKICDYINASYL------HGFDGS----FKAYIATQGPV-------VASFVDFWRMIWQEKSAVIVMLTNLKESEKVKCHQYWPD-----VSREYGDITVSVHSTEVFAD--YTKRVLFLAKRSEADKRHVVQLHFTVWPDKGVPQHATAVLGFRKKVNANNPYGSGPIVVHCSAGVGRTGAYIAIDAMLNQ-AHREKKVDIYKYVEMMRRDRIHMVQTEEQYIFVHMAILEATVC-GNTEVPVQD 245          

HSP 2 Score: 65.4698 bits (158), Expect = 1.715e-11
Identity = 59/202 (29.21%), Postives = 95/202 (47.03%), Query Frame = 2
Query:  551 DYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVE-VTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMT--SWLDHSCPTT-SDFMEFYAAYTRS--KVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTI 1138
            D +I TQ P+ +       T  +FWRMV++     IV L   EE G +  ++YWP ++ +      G  LVE ++  N+ +   FT R L VS    +  +   H +  +W D S P      +E  +   RS  +  +  IIV CS G  R+G+F  I   L R++     V+++  +  +R  R Q V + +QY   Y +
Sbjct:  335 DLFIMTQAPMTQ-------TTVEFWRMVMQYKAGTIVMLNTLEETG-QTYTEYWPTEHPE----IYGSVLVEPLSNDNYGD---FTMRRLKVSSYTEQSHVIVRHFSYFNWPDKSGPANYQSALELMSEVQRSQQQAKNRPIIVQCSNGTTRSGAFCAIYSILERLKIE-QVVDVFQVIKVIRIKRPQSVTSLAQYVSCYEM 520          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Medaka
Match: PTPRB (protein tyrosine phosphatase receptor type B [Source:NCBI gene;Acc:101171375])

HSP 1 Score: 164.466 bits (415), Expect = 1.345e-43
Identity = 114/337 (33.83%), Postives = 173/337 (51.34%), Query Frame = 2
Query:  239 MGPDENDK--SPL-ALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVE-VTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCP-TTSDFMEFYAA---YTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL--IQRGLSQVPERDRPANP 1204
            MG   N +  SP+ A +F +H   ++ DSN  L ++F+D+K            +    +  KNRY NI PY   R+KL+ L+D     +INAS I   ++  +           YIATQGPL   ++       DFWRMV E+NV  IV +T+  E GR KC QYWP    D      GD +++ ++ +   E +I   +V++ S   Y + ++  H T W DH  P TT   ++F      Y      + A +VHCSAGVGRTG+FI +D  L +++++   +++Y  + +LR  R  MVQTE QY F    +H+C+  + R      E++ P  P
Sbjct: 1621 MGVRSNRRVTSPIKACHFESHLAKLQADSNYLLSEEFEDLKDVGRNQTMDVARL--PENRGKNRYNNILPYDSTRLKLSYLEDDPCSDFINASYIPGNNYRRE-----------YIATQGPLPGTKD-------DFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWPA---DTEPLYYGDLVIQMLSESVLPEWTIREFKVISESSCSYPRMLRHFHYTVWPDHGVPETTQSLIQFVRTVRDYVDRSPSTGATVVHCSAGVGRTGTFIALDRVLQQLDSK-GTIDLYGIVFDLRLHRQHMVQTECQYAF----LHQCVRDVLRARKHRSEQENPLYP 1929          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Medaka
Match: PTPRB (protein tyrosine phosphatase receptor type B [Source:NCBI gene;Acc:101171375])

HSP 1 Score: 164.081 bits (414), Expect = 1.735e-43
Identity = 114/337 (33.83%), Postives = 173/337 (51.34%), Query Frame = 2
Query:  239 MGPDENDK--SPL-ALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVE-VTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCP-TTSDFMEFYAA---YTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL--IQRGLSQVPERDRPANP 1204
            MG   N +  SP+ A +F +H   ++ DSN  L ++F+D+K            +    +  KNRY NI PY   R+KL+ L+D     +INAS I   ++  +           YIATQGPL   ++       DFWRMV E+NV  IV +T+  E GR KC QYWP    D      GD +++ ++ +   E +I   +V++ S   Y + ++  H T W DH  P TT   ++F      Y      + A +VHCSAGVGRTG+FI +D  L +++++   +++Y  + +LR  R  MVQTE QY F    +H+C+  + R      E++ P  P
Sbjct: 1710 MGVRSNRRVTSPIKACHFESHLAKLQADSNYLLSEEFEDLKDVGRNQTMDVARL--PENRGKNRYNNILPYDSTRLKLSYLEDDPCSDFINASYIPGNNYRRE-----------YIATQGPLPGTKD-------DFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWPA---DTEPLYYGDLVIQMLSESVLPEWTIREFKVISESSCSYPRMLRHFHYTVWPDHGVPETTQSLIQFVRTVRDYVDRSPSTGATVVHCSAGVGRTGTFIALDRVLQQLDSK-GTIDLYGIVFDLRLHRQHMVQTECQYAF----LHQCVRDVLRARKHRSEQENPLYP 2018          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Medaka
Match: PTPRB (protein tyrosine phosphatase receptor type B [Source:NCBI gene;Acc:101171375])

HSP 1 Score: 164.081 bits (414), Expect = 1.840e-43
Identity = 114/337 (33.83%), Postives = 173/337 (51.34%), Query Frame = 2
Query:  239 MGPDENDK--SPL-ALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVE-VTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCP-TTSDFMEFYAA---YTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL--IQRGLSQVPERDRPANP 1204
            MG   N +  SP+ A +F +H   ++ DSN  L ++F+D+K            +    +  KNRY NI PY   R+KL+ L+D     +INAS I   ++  +           YIATQGPL   ++       DFWRMV E+NV  IV +T+  E GR KC QYWP    D      GD +++ ++ +   E +I   +V++ S   Y + ++  H T W DH  P TT   ++F      Y      + A +VHCSAGVGRTG+FI +D  L +++++   +++Y  + +LR  R  MVQTE QY F    +H+C+  + R      E++ P  P
Sbjct: 1730 MGVRSNRRVTSPIKACHFESHLAKLQADSNYLLSEEFEDLKDVGRNQTMDVARL--PENRGKNRYNNILPYDSTRLKLSYLEDDPCSDFINASYIPGNNYRRE-----------YIATQGPLPGTKD-------DFWRMVWEHNVYNIVMVTQCVEKGRVKCDQYWPA---DTEPLYYGDLVIQMLSESVLPEWTIREFKVISESSCSYPRMLRHFHYTVWPDHGVPETTQSLIQFVRTVRDYVDRSPSTGATVVHCSAGVGRTGTFIALDRVLQQLDSK-GTIDLYGIVFDLRLHRQHMVQTECQYAF----LHQCVRDVLRARKHRSEQENPLYP 2038          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Medaka
Match: ptprfa (protein tyrosine phosphatase receptor type F [Source:NCBI gene;Acc:101157606])

HSP 1 Score: 161.384 bits (407), Expect = 1.295e-42
Identity = 105/282 (37.23%), Postives = 142/282 (50.35%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKLD-----DYINASRI-CVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKY--KKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEA--IIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQR---GLSQVPERDRPANPQSIYH 1219
            KNRY N+  Y H+RV L  +D     DYINA+ I   R  N             YIATQGPL E       T+ DFWRMV E   C IV +TR EE  R KC QYWP +  +         +++VT+ +  E +    R  T+S N    K+ ++Q    +W DH  P        +    ++  P  A  ++VHCSAGVGRTG FI+ID  L R++ R   V+IY  +  +R  R  MVQTE QY F    IH+ L++    G ++VP     A+ Q + H
Sbjct: 1273 KNRYANVIAYDHSRVTLTAVDGVPGSDYINANYIDGYRRQNA------------YIATQGPLPE-------TLADFWRMVWEQKTCTIVMMTRLEEKSRVKCDQYWPSRGTETYG------MIQVTLLDTVELAAHVIRTFTISKNNSSDKREVRQFQFLAWPDHGVPEYPTPFLAFVHRVKACNPQRAGPMVVHCSAGVGRTGCFIVIDAMLDRLK-REKSVDIYGQVTCMRAQRNYMVQTEDQYVF----IHDVLLEAAMCGSTEVPAHGLYAHVQKLSH 1524          

HSP 2 Score: 138.658 bits (348), Expect = 6.613e-35
Identity = 95/256 (37.11%), Postives = 124/256 (48.44%), Query Frame = 2
Query:  413 KNRYGNIRPYQHNRVKLNKL-----DDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPT-TSDFMEFYAAYTRSK---VPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECL 1153
            KNR  NI P++  RV L+ +      DYINAS I         +G        YIATQGPL E  E       D WRM+ E+N  I+V LT+  E GREKC QYWP + + R  + + D + E  M  +    I  E  +T S +   KTI+Q   T W +   P     F++F     ++K        I VHCS GVGRTG FI +   L RI      ++++ T+  LR  R  MVQTE QY   Y    E L
Sbjct: 1562 KNRLMNILPFESTRVCLHPIRGLEGSDYINASFI---------DG--YRKQKAYIATQGPLPETTE-------DLWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFTVDPMAEYNMPEY----ILREFKVTNSRDGQSKTIRQFQFTGWPEQGVPQRVEGFIDFIGQVHKTKEQFGQDGPITVHCSTGVGRTGVFITLSIVLERIRQE-GVIDVFQTVKVLRTQRPAMVQTEEQYQLCYRAALEYL 1794          
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Medaka
Match: ENSORLT00000023638.2 (receptor-type tyrosine-protein phosphatase beta [Source:NCBI gene;Acc:101169916])

HSP 1 Score: 160.229 bits (404), Expect = 3.793e-42
Identity = 105/308 (34.09%), Postives = 158/308 (51.30%), Query Frame = 2
Query:  275 LNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLDD-----YINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVE-VTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCP-TTSDFMEFYAA---YTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGL 1168
            +NF +HF  ++ DS+  L ++++D+K         +       +  KNRY NI PY   RVKL+ +DD     YINAS I   ++  +           YIATQGPL   ++       DFW+MV E NV  +V +T+  E GR KC  YWP    D+     GD +V+ ++ +   E +I   R+ +     + + ++Q H T W DH  P  T   ++F      Y      S   +VHCSAGVGR+G+FI++D  L +++ R D V+IY  + +LR  R  MVQTE QY + +  + + L  R L
Sbjct: 1372 MNFESHFNKLQADSHYLLSEEYEDLKDVGRNQPLDSA--LLPENRGKNRYNNILPYDSTRVKLSYVDDDPCSDYINASYIPGNNFRRE-----------YIATQGPLPGTKD-------DFWKMVWEQNVHNVVMVTQCVEKGRVKCDHYWP---FDQDPLYYGDLIVQMLSESVLSEWTIREFRICSEEQLSFSRLVRQFHYTVWPDHGIPDNTQSLIQFVRTVRDYVNRSPGSGPTVVHCSAGVGRSGTFIVLDRVLQQLDVR-DTVDIYGAVFDLRLHRSHMVQTEGQYSYLHHCVRDVLRARKL 1655          
BLAST of Protein tyrosine phosphatase receptor type B vs. Planmine SMEST
Match: SMESG000005237.1 (SMESG000005237.1)

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 374/405 (92.35%), Postives = 387/405 (95.56%), Query Frame = 2
Query:   35 IGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNRSDSDIVVIHGDMGPDENDKSPLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVPERDRPANPQSIYHSQSYINPIFS 1249
            IGFRVYTTAGFTTEGVITVRTAINWAILVGFF+FLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGD+ PD+NDKSPL  NFH HFEFMKRDSNGRLIDQFQDIK QV QL+ QNVLVF+ G++HKNRYGNI+PYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENG+EKCSQYWP KNNDRIAFSSGD LVEV MTN RENSIFTERVLTVSMNKY+KT+KQLHMTSWLDHSCPTTSDFMEFYAAY RSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIE RTDKVEIYNTL NLRK RCQMVQTESQYCF YTIIHECLIQRGLS+VPERDRPANPQSI HSQSYINPIF+
Sbjct: 1136 IGFRVYTTAGFTTEGVITVRTAINWAILVGFFIFLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSAGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIEKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFA 1540          
BLAST of Protein tyrosine phosphatase receptor type B vs. Planmine SMEST
Match: SMESG000005237.1 (SMESG000005237.1)

HSP 1 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 374/405 (92.35%), Postives = 387/405 (95.56%), Query Frame = 2
Query:   35 IGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNRSDSDIVVIHGDMGPDENDKSPLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVPERDRPANPQSIYHSQSYINPIFS 1249
            IGFRVYTTAGFTTEGVITVRTAINWAILVGFF+FLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGD+ PD+NDKSPL  NFH HFEFMKRDSNGRLIDQFQDIK QV QL+ QNVLVF+ G++HKNRYGNI+PYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENG+EKCSQYWP KNNDRIAFSSGD LVEV MTN RENSIFTERVLTVSMNKY+KT+KQLHMTSWLDHSCPTTSDFMEFYAAY RSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIE RTDKVEIYNTL NLRK RCQMVQTESQYCF YTIIHECLIQRGLS+VPERDRPANPQSI HSQSYINPIF+
Sbjct: 1006 IGFRVYTTAGFTTEGVITVRTAINWAILVGFFIFLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSAGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIEKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFA 1410          
BLAST of Protein tyrosine phosphatase receptor type B vs. Planmine SMEST
Match: SMESG000005237.1 (SMESG000005237.1)

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 374/405 (92.35%), Postives = 387/405 (95.56%), Query Frame = 2
Query:   35 IGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNRSDSDIVVIHGDMGPDENDKSPLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVPERDRPANPQSIYHSQSYINPIFS 1249
            IGFRVYTTAGFTTEGVITVRTAINWAILVGFF+FLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGD+ PD+NDKSPL  NFH HFEFMKRDSNGRLIDQFQDIK QV QL+ QNVLVF+ G++HKNRYGNI+PYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENG+EKCSQYWP KNNDRIAFSSGD LVEV MTN RENSIFTERVLTVSMNKY+KT+KQLHMTSWLDHSCPTTSDFMEFYAAY RSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIE RTDKVEIYNTL NLRK RCQMVQTESQYCF YTIIHECLIQRGLS+VPERDRPANPQSI HSQSYINPIF+
Sbjct: 1103 IGFRVYTTAGFTTEGVITVRTAINWAILVGFFIFLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSAGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIEKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFA 1507          
BLAST of Protein tyrosine phosphatase receptor type B vs. Planmine SMEST
Match: SMESG000005237.1 (SMESG000005237.1)

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 374/405 (92.35%), Postives = 387/405 (95.56%), Query Frame = 2
Query:   35 IGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNRSDSDIVVIHGDMGPDENDKSPLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVPERDRPANPQSIYHSQSYINPIFS 1249
            IGFRVYTTAGFTTEGVITVRTAINWAILVGFF+FLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGD+ PD+NDKSPL  NFH HFEFMKRDSNGRLIDQFQDIK QV QL+ QNVLVF+ G++HKNRYGNI+PYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENG+EKCSQYWP KNNDRIAFSSGD LVEV MTN RENSIFTERVLTVSMNKY+KT+KQLHMTSWLDHSCPTTSDFMEFYAAY RSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIE RTDKVEIYNTL NLRK RCQMVQTESQYCF YTIIHECLIQRGLS+VPERDRPANPQSI HSQSYINPIF+
Sbjct: 1294 IGFRVYTTAGFTTEGVITVRTAINWAILVGFFIFLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSAGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIEKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFA 1698          
BLAST of Protein tyrosine phosphatase receptor type B vs. Planmine SMEST
Match: SMESG000005237.1 (SMESG000005237.1)

HSP 1 Score: 705.286 bits (1819), Expect = 0.000e+0
Identity = 374/405 (92.35%), Postives = 387/405 (95.56%), Query Frame = 2
Query:   35 IGFRVYTTAGFTTEGVITVRTAINWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNRSDSDIVVIHGDMGPDENDKSPLALNFHTHFEFMKRDSNGRLIDQFQDIKHXXXXXXXXXXXXFAEGSVHKNRYGNIRPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGREKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKYKKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTIIHECLIQRGLSQVPERDRPANPQSIYHSQSYINPIFS 1249
            IGFRVYTTAGFTTEGVITVRTAINWAILVGFF+FLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGD+ PD+NDKSPL  NFH HFEFMKRDSNGRLIDQFQDIK QV QL+ QNVLVF+ G++HKNRYGNI+PYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENG+EKCSQYWP KNNDRIAFSSGD LVEV MTN RENSIFTERVLTVSMNKY+KT+KQLHMTSWLDHSCPTTSDFMEFYAAY RSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIE RTDKVEIYNTL NLRK RCQMVQTESQYCF YTIIHECLIQRGLS+VPERDRPANPQSI HSQSYINPIF+
Sbjct:  973 IGFRVYTTAGFTTEGVITVRTAINWAILVGFFIFLLLSGGIGFAAFYFYRRYRRLNRSDSDIVVIHGDICPDDNDKSPLTFNFHAHFEFMKRDSNGRLIDQFQDIKQQVKQLETQNVLVFSAGNIHKNRYGNIKPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSPCNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENGKEKCSQYWPDKNNDRIAFSSGDDLVEVIMTNSRENSIFTERVLTVSMNKYEKTVKQLHMTSWLDHSCPTTSDFMEFYAAYIRSKVPSEAIIVHCSAGVGRTGSFILIDEELSRIEKRTDKVEIYNTLFNLRKCRCQMVQTESQYCFIYTIIHECLIQRGLSKVPERDRPANPQSISHSQSYINPIFA 1377          
The following BLAST results are available for this feature:
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRJ6.371e-4637.25protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRJ7.206e-4637.25protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRJ7.421e-4637.25protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRS6.038e-4338.52protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRS6.243e-4338.52protein tyrosine phosphatase receptor type S [Sour... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp-33.538e-3934.39Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-33.542e-3934.39Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-33.865e-3934.39Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-33.980e-3934.39Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-34.087e-3934.39Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptp10D2.009e-4535.37gene:FBgn0004370 transcript:FBtr0073522[more]
Ptp10D2.022e-4535.37gene:FBgn0004370 transcript:FBtr0273235[more]
Ptp10D2.022e-4535.37gene:FBgn0004370 transcript:FBtr0331406[more]
Ptp10D2.055e-4535.37gene:FBgn0004370 transcript:FBtr0330394[more]
Ptp10D3.221e-4535.37gene:FBgn0004370 transcript:FBtr0330393[more]
back to top
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprb1.252e-4235.37protein tyrosine phosphatase receptor type b [Sour... [more]
ptprb1.252e-4235.37protein tyrosine phosphatase receptor type b [Sour... [more]
ptprjb.16.087e-4134.09protein tyrosine phosphatase receptor type Jb, tan... [more]
ptprjb.21.119e-4033.33protein tyrosine phosphatase receptor type Jb, tan... [more]
ptprsa3.384e-4034.18protein tyrosine phosphatase receptor type Sa [Sou... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfsd14b1.631e-4237.86major facilitator superfamily domain containing 14... [more]
mfsd14b1.696e-4237.86major facilitator superfamily domain containing 14... [more]
mfsd14b1.780e-4237.86major facilitator superfamily domain containing 14... [more]
mfsd14b1.817e-4237.86major facilitator superfamily domain containing 14... [more]
mfsd14b1.855e-4237.86major facilitator superfamily domain containing 14... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptpn204.182e-4740.56protein tyrosine phosphatase, non-receptor type 20... [more]
Ptprj7.961e-4637.21protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprj9.892e-4637.21protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprj1.168e-4537.21protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprs6.717e-4238.27protein tyrosine phosphatase, receptor type, S [So... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O55082|PTN20_MOUSE2.925e-4640.56Tyrosine-protein phosphatase non-receptor type 20 ... [more]
sp|Q12913|PTPRJ_HUMAN3.060e-4537.25Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|Q64455|PTPRJ_MOUSE5.712e-4537.21Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|P35992|PTP10_DROME3.228e-4435.37Tyrosine-protein phosphatase 10D OS=Drosophila mel... [more]
sp|A1L1L3|PTN20_RAT1.474e-4338.96Tyrosine-protein phosphatase non-receptor type 20 ... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5N4DMJ85.999e-4636.86Receptor-type tyrosine-protein phosphatase eta OS=... [more]
H9F9B33.178e-4536.51Receptor-type tyrosine-protein phosphatase eta iso... [more]
K9KG284.469e-4536.60Receptor-type tyrosine-protein phosphatase eta-lik... [more]
Q613735.004e-4537.21Protein tyrosine phosphatase (Fragment) OS=Mus mus... [more]
T1I8011.564e-4334.94Uncharacterized protein (Fragment) OS=Rhodnius pro... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprb2.640e-4135.08receptor-type tyrosine-protein phosphatase beta [S... [more]
ptprb2.689e-4135.08receptor-type tyrosine-protein phosphatase beta [S... [more]
ENSAMXT00000012844.21.294e-4036.75receptor-type tyrosine-protein phosphatase S-like ... [more]
ENSAMXT00000038448.11.474e-4036.63receptor-type tyrosine-protein phosphatase S-like ... [more]
ENSAMXT00000035527.11.699e-4036.63receptor-type tyrosine-protein phosphatase S-like ... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpra3.900e-3736.64protein tyrosine phosphatase receptor type A [Sour... [more]
ENSPMAT00000008162.11.723e-3637.25pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-... [more]
ptprk2.858e-3534.22protein tyrosine phosphatase receptor type K [Sour... [more]
ENSPMAT00000006037.12.961e-3535.06pep scaffold:Pmarinus_7.0:GL477253:2:79428:1 gene:... [more]
ENSPMAT00000003525.13.356e-3435.29pep scaffold:Pmarinus_7.0:GL477320:686:22463:-1 ge... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PTP14.493e-2633.22Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP34.989e-1331.65Phosphotyrosine-specific protein phosphatase; invo... [more]
PTP22.848e-922.22Nuclear phosphotyrosine-specific phosphatase invol... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481874.183e-4040.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469614.757e-4033.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383042.460e-3935.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438545.673e-3937.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350621.465e-3737.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRB1.345e-4333.83protein tyrosine phosphatase receptor type B [Sour... [more]
PTPRB1.735e-4333.83protein tyrosine phosphatase receptor type B [Sour... [more]
PTPRB1.840e-4333.83protein tyrosine phosphatase receptor type B [Sour... [more]
ptprfa1.295e-4237.23protein tyrosine phosphatase receptor type F [Sour... [more]
ENSORLT00000023638.23.793e-4234.09receptor-type tyrosine-protein phosphatase beta [S... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005237.10.000e+092.35SMESG000005237.1[more]
SMESG000005237.10.000e+092.35SMESG000005237.1[more]
SMESG000005237.10.000e+092.35SMESG000005237.1[more]
SMESG000005237.10.000e+092.35SMESG000005237.1[more]
SMESG000005237.10.000e+092.35SMESG000005237.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031329 ID=SMED30031329|Name=Protein tyrosine phosphatase receptor type B|organism=Schmidtea mediterranea sexual|type=transcript|length=1284bp
ATAATCTAATTACTTATTGCGATAATTTGTTAGAATTGGATTTCGAGTAT
ATACGACTGCCGGGTTCACAACCGAGGGAGTTATCACCGTTAGAACGGCT
ATTAATTGGGCTATTCTTGTGGGATTTTTCGTCTTCCTGCTTCTTTCAGG
TGGTATTGGTTTTGCAGCGTTCTATTTCTACAGGCGCTACAGACGTCTCA
ATCGCTCAGATTCAGATATCGTTGTAATACATGGTGATATGGGTCCAGAT
GAAAATGATAAATCGCCGTTGGCGTTGAACTTTCACACACATTTTGAGTT
CATGAAACGTGACAGTAACGGTAGATTAATTGATCAGTTTCAGGACATTA
AACATCAGGTGGCACAATTACAAAACCAAAACGTATTGGTATTTGCCGAA
GGAAGCGTACATAAAAATAGATATGGCAATATTAGACCTTACCAACACAA
CCGAGTGAAACTGAATAAACTTGATGATTATATCAACGCCAGTAGGATTT
GTGTCAGACATTGGAACACTGATCTTAATGGGAGCCCATGTAATTGCACT
GATTATTATATAGCTACCCAAGGCCCGTTAGGCGAAGACAGAGAGCCGAA
AGTTTCAACTATTGGAGATTTCTGGCGGATGGTTTTGGAGAACAATGTTT
GTATCATAGTTAATCTGACCAGATCTGAAGAGAATGGAAGAGAGAAATGC
AGTCAGTATTGGCCTGGTAAGAATAACGACCGAATAGCATTTTCCAGTGG
TGACTACCTAGTTGAAGTCACAATGACGAACTTTAGAGAAAACAGTATAT
TTACTGAAAGAGTTCTTACAGTATCAATGAACAAATATAAGAAAACTATC
AAGCAATTACACATGACATCATGGCTTGATCATAGCTGTCCCACAACCTC
TGATTTCATGGAATTCTATGCTGCTTACACAAGATCCAAGGTACCGTCAG
AAGCTATTATAGTGCATTGCAGTGCTGGAGTCGGTCGGACTGGATCATTT
ATTTTGATTGATGAGGAACTCTCGAGAATCGAAAATAGAACCGATAAAGT
TGAAATTTATAATACTTTAATAAATTTAAGGAAATCTCGATGTCAGATGG
TGCAAACTGAATCTCAATATTGCTTCACCTATACAATCATCCATGAGTGC
CTCATTCAGAGAGGTCTTTCACAAGTTCCTGAGCGTGACCGCCCCGCAAA
TCCCCAAAGTATCTACCATTCCCAGTCGTACATCAATCCGATTTTCTCTT
ATAGATAGAAGTTTTCATTTATTATATAACAAAT
back to top

protein sequence of SMED30031329-orf-1

>SMED30031329-orf-1 ID=SMED30031329-orf-1|Name=SMED30031329-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=340bp
MGPDENDKSPLALNFHTHFEFMKRDSNGRLIDQFQDIKHQVAQLQNQNVL
VFAEGSVHKNRYGNIRPYQHNRVKLNKLDDYINASRICVRHWNTDLNGSP
CNCTDYYIATQGPLGEDREPKVSTIGDFWRMVLENNVCIIVNLTRSEENG
REKCSQYWPGKNNDRIAFSSGDYLVEVTMTNFRENSIFTERVLTVSMNKY
KKTIKQLHMTSWLDHSCPTTSDFMEFYAAYTRSKVPSEAIIVHCSAGVGR
TGSFILIDEELSRIENRTDKVEIYNTLINLRKSRCQMVQTESQYCFTYTI
IHECLIQRGLSQVPERDRPANPQSIYHSQSYINPIFSYR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001568blood vessel development
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0007155cell adhesion
GO:0010977negative regulation of neuron projection development
GO:0021510spinal cord development
GO:0021549cerebellum development
GO:0021766hippocampus development
GO:0021987cerebral cortex development
GO:0022038corpus callosum development
GO:0030517negative regulation of axon extension
GO:0032687negative regulation of interferon-alpha production
GO:0032688negative regulation of interferon-beta production
GO:0034164negative regulation of toll-like receptor 9 signaling pathway
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0048671negative regulation of collateral sprouting
GO:0048681negative regulation of axon regeneration
GO:0061000negative regulation of dendritic spine development
GO:0090557establishment of endothelial intestinal barrier
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR000242PTPase_domain
IPR003595Tyr_Pase_cat
IPR029021Prot-tyrosine_phosphatase-like
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
IPR001024PLAT/LH2_dom
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO:0005515protein binding
GO:0004721phosphoprotein phosphatase activity
GO:0008201heparin binding
GO:0016787hydrolase activity
GO:0035374chondroitin sulfate binding
GO:0043395heparan sulfate proteoglycan binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030285integral component of synaptic vesicle membrane
GO:0030424axon
GO:0070062extracellular exosome
GO:0099061integral component of postsynaptic density membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 27..47
NoneNo IPR availablePANTHERPTHR19134:SF483PROTEIN TYROSINE PHOSPHATASE 4E, ISOFORM A-RELATEDcoord: 17..305
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 17..305
NoneNo IPR availableCDDcd00047PTPccoord: 81..298
e-value: 5.82072E-66
score: 204.827
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 202..219
score: 34.31
coord: 80..87
score: 70.51
coord: 239..257
score: 66.87
coord: 287..297
score: 63.05
coord: 114..134
score: 37.62
coord: 271..286
score: 27.17
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 29..306
e-value: 1.7E-79
score: 280.1
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 58..302
e-value: 6.3E-64
score: 215.7
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 30..304
score: 40.385
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 203..303
e-value: 1.1E-30
score: 117.9
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 8..313
e-value: 3.3E-77
score: 261.7
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 17..305
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 242..252
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 221..295
score: 18.477