slc7a-3

Overview
Nameslc7a-3 (AKN21447.1)
Smed IDSMED30031328
Length (bp)1937
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc7a-3 (SMED30031328) t-SNE clustered cells

Violin plots show distribution of expression levels for slc7a-3 (SMED30031328) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc7a-3 (SMED30031328) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc7a-3 (SMED30031328) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031328

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30031328h1SMcG0001585 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031328h1SMcG0001585 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031328h1SMcG0001585 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031328h1SMcG0001585 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031328h1SMcG0001585 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031328h1SMcG0021829 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031328h1SMcG0021829 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031328h1SMcG0021829 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031328h1SMcG0021829 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031328h1SMcG0021829 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30031328h1SMcG0021829 dd_Smed_v4_11305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30031328h1SMcG0021829 dd_Smed_v4_11305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30031328h1SMcG0018022 Contig4458GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30031328h1SMcG0021829 Contig4458GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30031328h1SMcG0021829 dd_Smed_v4_11305_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30031328h1SMcG0021829 dd_Smed_v4_11305_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc7a-3 vs. Ensembl Human
Match: SLC7A1 (solute carrier family 7 member 1 [Source:HGNC Symbol;Acc:HGNC:11057])

HSP 1 Score: 245.358 bits (625), Expect = 8.641e-72
Identity = 143/436 (32.80%), Postives = 239/436 (54.82%), Query Frame = 2
Query:  137 VLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFV----------------SD--------GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENN 1372
            VL +    + RR+    S+  ET+L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +IL  I+  +SV++ +S   + L    +  F+  ++ L+ +  V   + D+ A  ++  L  +   G   S  +N + + I ++ L  I++  FV GS +N+                 +D        GG++PFGF  +  GA    +A+ GF+C+A + EE KNP+K+IPV +  SL I  + Y   S+ L+ M+P   +D  +P   AF +      K+   + +L A  A+ L   + +PR+IY MAEDGL+FKFL  +++R+K PI A L     ++++A    ++ L D+ S+G +L++  +   +++LRY  ++ N
Sbjct:    5 VLLNIGQQMLRRKVVDCSRE-ETRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLN-APGVLAENPDIFAVIIILILTGLLTLGVKESAMVNKIFTCINVLVLGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDNNSPLPDAFKHVGWEGAKYAVAVGSLCALSASLLGSMFPMPRVIYAMAEDGLLFKFLANVNDRTKTPIIATLASGAVAAVMAFLFDLKDLVDLMSIGTLLAYSLVAACVLVLRYQPEQPN 438          

HSP 2 Score: 56.225 bits (134), Expect = 1.348e-7
Identity = 25/58 (43.10%), Postives = 39/58 (67.24%), Query Frame = 2
Query: 1607 TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSH 1780
            +  K +FK P +P+ PI++I +N+ L+M L   TW+RF V  +IG +IYF YG+ +S 
Sbjct:  552 SKTKLSFKVPFLPVLPILSIFVNVYLMMQLDQGTWVRFAVWMLIGFIIYFGYGLWHSE 609          
BLAST of slc7a-3 vs. Ensembl Human
Match: SLC7A3 (solute carrier family 7 member 3 [Source:HGNC Symbol;Acc:HGNC:11061])

HSP 1 Score: 236.498 bits (602), Expect = 1.206e-68
Identity = 140/434 (32.26%), Postives = 230/434 (53.00%), Query Frame = 2
Query:  143 HSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF----------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNEN 1378
              F   + RRR+  +S   ET+L RCLST  L+  G+   +GAG+YVL G + KD+ G +  + FL + L S+  GLCY EF   +P++GS Y Y+Y+ +GEL AF  GW +IL  ++  ASV++ +S A + L  + +       + L     V     D  A  L+  L  +   GA+ S  +  V + + L+ L  ++I  FV G   N+                      +  GG++PFGF  I +GA    +A+ GF+C+A + EE +NP++SIP+ + +SL +  L Y   SS L+ M+P  Q+  ++P   AF        +++  + +L A   + L   + +PR+IY MAEDGL+F+ L +I   ++ PI A +V    ++ +A   K+  L D+ S+G +L++  + I ++ILRY  D+  + 
Sbjct:    7 RRFGQKLVRRRTL-ESGMAETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAALSSVLAGLCYAEFGARVPRSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISKTLQGSIAL-HVPHVLAEYPDFFALGLVLLLTGLLALGASESALVTKVFTGVNLLVLGFVMISGFVKGDVHNWKLTEEDYELAMAELNDTYSLGPLGSGGFVPFGFEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISLSVCFLAYFAVSSALTLMMPYYQLQPESPLPEAFLYIGWAPARYVVAVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRVLARIHTGTRTPIIATVVSGIIAAFMAFLFKLTDLVDLMSIGTLLAYSLVSICVLILRYQPDQETKT 438          

HSP 2 Score: 54.6842 bits (130), Expect = 4.829e-7
Identity = 29/68 (42.65%), Postives = 39/68 (57.35%), Query Frame = 2
Query: 1625 FKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNS-------HLSEKAEEKT 1807
            FK P +PL P+++I +NI L+M +   TW RF V  +IG  IYF YGI +S         S K+  KT
Sbjct:  539 FKVPALPLLPLMSIFVNIYLMMQMTAGTWARFGVWMLIGFAIYFGYGIQHSLEEIKSNQPSRKSRAKT 606          
BLAST of slc7a-3 vs. Ensembl Human
Match: SLC7A3 (solute carrier family 7 member 3 [Source:HGNC Symbol;Acc:HGNC:11061])

HSP 1 Score: 236.498 bits (602), Expect = 1.206e-68
Identity = 140/434 (32.26%), Postives = 230/434 (53.00%), Query Frame = 2
Query:  143 HSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF----------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNEN 1378
              F   + RRR+  +S   ET+L RCLST  L+  G+   +GAG+YVL G + KD+ G +  + FL + L S+  GLCY EF   +P++GS Y Y+Y+ +GEL AF  GW +IL  ++  ASV++ +S A + L  + +       + L     V     D  A  L+  L  +   GA+ S  +  V + + L+ L  ++I  FV G   N+                      +  GG++PFGF  I +GA    +A+ GF+C+A + EE +NP++SIP+ + +SL +  L Y   SS L+ M+P  Q+  ++P   AF        +++  + +L A   + L   + +PR+IY MAEDGL+F+ L +I   ++ PI A +V    ++ +A   K+  L D+ S+G +L++  + I ++ILRY  D+  + 
Sbjct:    7 RRFGQKLVRRRTL-ESGMAETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAALSSVLAGLCYAEFGARVPRSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISKTLQGSIAL-HVPHVLAEYPDFFALGLVLLLTGLLALGASESALVTKVFTGVNLLVLGFVMISGFVKGDVHNWKLTEEDYELAMAELNDTYSLGPLGSGGFVPFGFEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISLSVCFLAYFAVSSALTLMMPYYQLQPESPLPEAFLYIGWAPARYVVAVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRVLARIHTGTRTPIIATVVSGIIAAFMAFLFKLTDLVDLMSIGTLLAYSLVSICVLILRYQPDQETKT 438          

HSP 2 Score: 54.6842 bits (130), Expect = 4.829e-7
Identity = 29/68 (42.65%), Postives = 39/68 (57.35%), Query Frame = 2
Query: 1625 FKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNS-------HLSEKAEEKT 1807
            FK P +PL P+++I +NI L+M +   TW RF V  +IG  IYF YGI +S         S K+  KT
Sbjct:  539 FKVPALPLLPLMSIFVNIYLMMQMTAGTWARFGVWMLIGFAIYFGYGIQHSLEEIKSNQPSRKSRAKT 606          
BLAST of slc7a-3 vs. Ensembl Human
Match: SLC7A2 (solute carrier family 7 member 2 [Source:HGNC Symbol;Acc:HGNC:11060])

HSP 1 Score: 230.72 bits (587), Expect = 3.725e-66
Identity = 137/428 (32.01%), Postives = 227/428 (53.04%), Query Frame = 2
Query:  146 SFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF-VSD------------------------GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRY 1354
            +F   + RR+  +     +TKL RCLST  LI  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y YTY+ +GEL AFI GW +IL  ++  +SV++ +SG  + L +  +  F   Y  ++ +        D  A  L+  L  +   G   S  +N V + + ++ L  +++  FV G+  N+ +S+                        GG++P+GF     GA    +A+ GF+C+A + EE +NP+K+IP+ +  SL +  + Y   S+ L+ M+P   +D+K+P   AF        K++    +L A   + L   + +PR+IY MAEDGL+FK L +I+ ++K PI A L     ++L+A    ++ L D+ S+G ++++  +   ++ILRY
Sbjct:    9 TFARCLIRRKIVTLDSLEDTKLCRCLSTMDLIALGVGSTLGAGVYVLAGEVAKADSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLSKQIGQFLRTYFRMNYTG--LAEYPDFFAVCLILLLAGLLSFGVKESAWVNKVFTAVNILVLLFVMVAGFVKGNVANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCFMAYFGVSAALTLMMPYYLLDEKSPLPVAFEYVGWGPAKYVVAAGSLCALSTSLLGSIFPMPRVIYAMAEDGLLFKCLAQINSKTKTPIIATLSSGAVAALMAFLFDLKALVDMMSIGTLMAYSLVAACVLILRY 434          

HSP 2 Score: 54.6842 bits (130), Expect = 5.194e-7
Identity = 27/66 (40.91%), Postives = 38/66 (57.58%), Query Frame = 2
Query: 1616 KDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNS---HLSEKAEEK 1804
            K  F  P +P  P  +I +NI L++ L   TW+RF +   IG LIYF YGI +S   HL ++  E+
Sbjct:  553 KVAFMVPFLPFLPAFSILVNIYLMVQLSADTWVRFSIWMAIGFLIYFSYGIRHSLEGHLRDENNEE 618          
BLAST of slc7a-3 vs. Ensembl Human
Match: SLC7A2 (solute carrier family 7 member 2 [Source:HGNC Symbol;Acc:HGNC:11060])

HSP 1 Score: 230.72 bits (587), Expect = 3.725e-66
Identity = 137/428 (32.01%), Postives = 227/428 (53.04%), Query Frame = 2
Query:  146 SFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF-VSD------------------------GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRY 1354
            +F   + RR+  +     +TKL RCLST  LI  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y YTY+ +GEL AFI GW +IL  ++  +SV++ +SG  + L +  +  F   Y  ++ +        D  A  L+  L  +   G   S  +N V + + ++ L  +++  FV G+  N+ +S+                        GG++P+GF     GA    +A+ GF+C+A + EE +NP+K+IP+ +  SL +  + Y   S+ L+ M+P   +D+K+P   AF        K++    +L A   + L   + +PR+IY MAEDGL+FK L +I+ ++K PI A L     ++L+A    ++ L D+ S+G ++++  +   ++ILRY
Sbjct:    9 TFARCLIRRKIVTLDSLEDTKLCRCLSTMDLIALGVGSTLGAGVYVLAGEVAKADSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLSKQIGQFLRTYFRMNYTG--LAEYPDFFAVCLILLLAGLLSFGVKESAWVNKVFTAVNILVLLFVMVAGFVKGNVANWKISEEFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCFMAYFGVSAALTLMMPYYLLDEKSPLPVAFEYVGWGPAKYVVAAGSLCALSTSLLGSIFPMPRVIYAMAEDGLLFKCLAQINSKTKTPIIATLSSGAVAALMAFLFDLKALVDMMSIGTLMAYSLVAACVLILRY 434          

HSP 2 Score: 54.6842 bits (130), Expect = 5.194e-7
Identity = 27/66 (40.91%), Postives = 38/66 (57.58%), Query Frame = 2
Query: 1616 KDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNS---HLSEKAEEK 1804
            K  F  P +P  P  +I +NI L++ L   TW+RF +   IG LIYF YGI +S   HL ++  E+
Sbjct:  553 KVAFMVPFLPFLPAFSILVNIYLMVQLSADTWVRFSIWMAIGFLIYFSYGIRHSLEGHLRDENNEE 618          
BLAST of slc7a-3 vs. Ensembl Celegans
Match: B0454.6 (pep chromosome:WBcel235:II:3032780:3036122:1 gene:WBGene00015197.1 transcript:B0454.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0454.6)

HSP 1 Score: 265.003 bits (676), Expect = 4.715e-80
Identity = 174/562 (30.96%), Postives = 301/562 (53.56%), Query Frame = 2
Query:  155 HSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYL-PLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF---VSDGG--YLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFD--ENNENTIDNSQKLPMRINTNSMICTRXXXXXXXXXXXXXXXXTG-VSILFILPISQITGXXXXXXXXXX-------XXXXXXXXXXYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEK 1792
             +ITR++ F     L++ L RCL    + F  +  M+GAGIYVLTG +++++ G +   SF  +G+ ++ +   Y EF    P+AGS YTYTY+  GEL AFIVGWT+ L+ ++  A+V++ +S   + + ++ +KN T   L  LS+    + +  D+L+F L+     +   G  +S N+N     + ++ + ++I+    Y    N+    SDG   + PFG      GA    F+Y GFE LA + EE K+P ++IPVA F+S+G+I+ LY+L SS L+ MVP  Q+   APF  AFS R    + +I  I  L+      +   + +PR +Y MA+DGLIFK+L  +   +K+P+ A+++    ++++A+   I+ L +  S+G + ++  +   +++LRY     + +   +DN  +L      +S I  R F++       IS+ +   +   F L  +  TG        +        I+     I  ++   ++ +FK P +P  P +++ +N+ ++  L  +TW+R  V   +GLLIYF YGI +S  ++K
Sbjct:    7 QAITRKKRFEGDSHLDSNLRRCLGLMDITFLALGQMMGAGIYVLTGTVVRNQAGPSIIFSFALAGIAALLSAFSYAEFGARFPRAGSAYTYTYIGFGELWAFIVGWTIPLEYMIGNAAVARSWSAYFDNMLDNYIKNTTIGALGELSEPGGFFSTYPDILSFLLICLCACVIAVGPKVSANVNSSFVVLNIVVIFIVIVSGICYADFNNWTGTTSDGRSMFFPFGLTGTLTGAATCFFSYIGFEVLATAGEEVKSPHRTIPVATFLSIGVIMTLYILVSSTLTLMVPYDQVHTTAPFAEAFSARGCTTVMYIISIGALIGLTNNLVTGVFALPRAVYAMADDGLIFKWLAHVTSSTKVPLNAIVIFTLLNAIIALIFDIEALVEFLSIGTLFAYSFVSGSVLVLRYQSAPIDGDGKRMDNGGEL------SSWIPARNFWESLPAGTSISLGVAALIGSFFWLAFTFRTGFYEHWYGQISIGFNGLLIVLVMAFILGHQQNSLETSFKVPFVPFLPCLSLLVNVFMMAYLTTATWIRLFVWMGVGLLIYFSYGIRHSKEAKK 562          
BLAST of slc7a-3 vs. Ensembl Celegans
Match: F23F1.6 (pep chromosome:WBcel235:II:35202:37313:-1 gene:WBGene00017747.1 transcript:F23F1.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F23F1.6)

HSP 1 Score: 258.07 bits (658), Expect = 1.764e-77
Identity = 188/570 (32.98%), Postives = 296/570 (51.93%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFT-DKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVY-------GSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFD--ENNENTIDNSQKLPMRI-------NTNSMICTRXXXXXXXXXXXXXXX--XTGVSILFILPISQITGXXXXXXXXXXXXXXXXXXXXYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEK 1792
            +H     + R+++F     LE+++ RCL+   ++F  I HMIGAGIYVLTG +++++ G A  LSF+FSG  ++ +   Y EF    P+AGS YTY+Y+ MGE+ AFIVGWT+ L+ ++  A+V++ +S   + L + +V N+T D    LS     +    D LAF LLF + +    G+  S N+N     + L  L+ +II    Y       G++Q+  S   + P+G      GA    FA+ GFE LA + EE KNP ++IP+A F SL II ++YVL  + L+ M+P   +D  A F AAF  +     K I  +  L       +   + +PR +Y MA+DGLIF + G I+ ++K P+ A +V    +++LA+   +Q L D  S+G +L++  + I +IILR+     + +    DN   L   +       N +  I  R      +F  I   I   TG+        S   GII   +     L   + I  +E      T+K PL+P  P + + +N+ +++ L   TW+R  V   IG++IY  YGI +S   +K
Sbjct:    3 VHQIADVLFRKKTFDGGSHLESQMKRCLTILDVMFIAIGHMIGAGIYVLTGSVVRNQAGPAIILSFIFSGFAALLSAFSYAEFGARFPRAGSAYTYSYVGMGEIWAFIVGWTVPLEYMIGNAAVARSWSAYFDNLVSKSVSNWTLDTVGRLSDGKGFFALYPDFLAFFLLFLVAVAVAMGSKFSANVNTSFVFLNLAVLAFVIICGLTYADFSLWSGTYQDGRSK--FFPYGIQGAISGASTCFFAFIGFEALATAGEEAKNPHRTIPLATFTSLAIISVIYVLMGASLTLMIPYDLVDPDAAFAAAFEMKGATVAKIIMSVGALAGMLNNLVTGSFALPRAVYAMADDGLIFGWFGVINSKTKTPLNATIVFTIINAILALVFDLQALVDFLSIGTLLAYSMVSICVIILRHQSHLVDGSATDYDNGGCLKSWVPFQGVWENFSEGISIRVAVAGLIFGYICLAIPFRTGI-------FSNAGGIILLTVGAAFSLLSFVFILGHEQNKSTSTYKVPLVPFIPCLGLLINVFMMVYLNSMTWIRLFVWLAIGIVIYICYGIRHSKEGQK 563          
BLAST of slc7a-3 vs. Ensembl Celegans
Match: C50D2.2 (pep chromosome:WBcel235:II:109165:111429:1 gene:WBGene00016806.1 transcript:C50D2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C50D2.2)

HSP 1 Score: 241.506 bits (615), Expect = 3.991e-71
Identity = 145/430 (33.72%), Postives = 240/430 (55.81%), Query Frame = 2
Query:  158 SITRRRSFS----QSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFT-DKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYG--SHQNFVSDGG---YLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDEN-NENTIDNSQKLPMRI 1414
            S  R R F      +  + T L RCLST  +   G+ HMIGAGIYVLTG ++++  G +  LSFL +G  S+ + LCY EF    PKAGS YTYTY+ +GEL AF++GW +IL+ ++  A+V++ +SG ++ L  + + N T  +   L ++S  +    D+LAF L+  +      G+ +S N N  L+ + +  + +++ Y   +   S  + V + G   + P+G   +F GA    FAY GF+ LA + EE K+P +SIP+A F S+ I+ L YVL S+ L+ M+P   +   A F  AF+ R      +   +  L     + +   + +PR +++MA+DGL+F  L  ++ ++++P  A+L+  F ++++A+   I  L +  S+G +L++  +   +I+LRY    N +E   DN  KL   I
Sbjct:    4 SALRERVFRLKNLPAGEIATPLRRCLSTFDITLLGVGHMIGAGIYVLTGSVVRNTAGPSIILSFLLAGFASLLSALCYAEFGARFPKAGSAYTYTYVGVGELWAFVIGWNIILEHMLGAAAVARSWSGYLDSLLGNVISNSTIARTGHLHEASSFFGDYPDLLAFLLIVLVAFFVALGSKVSTNFNSFLTILNIGIVVIVVFYGITFADFSLWSGVDEKGNSRFFPYGVSGMFAGAASCFFAYIGFDGLATAGEEAKDPARSIPIATFSSMTIVTLSYVLMSASLTLMIPYNMVHPTAAFSDAFTMRGAEFASYAVSVGALFGMTTSLVGGMFALPRCVFSMADDGLLFSSLASVNPKTQVPTQALLIFGFLTAIIALLFDITTLVEFLSIGTLLAYSIVSACVIVLRYQPAYNVDEGQFDNGGKLRFSI 433          

HSP 2 Score: 55.8398 bits (133), Expect = 6.756e-8
Identity = 26/69 (37.68%), Postives = 41/69 (59.42%), Query Frame = 2
Query: 1598 YEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEK 1804
            + P +    FK PL+PL P +++ +N  ++++L   TWLR +V   IG +IYF YGI +S    +  EK
Sbjct:  498 HYPNNTPLDFKVPLVPLIPALSLLINTLMMVHLAWITWLRLVVWMSIGFVIYFGYGIHHSKEEVQDAEK 566          
BLAST of slc7a-3 vs. Ensembl Celegans
Match: Y53F4B.12 (pep chromosome:WBcel235:II:15019223:15025768:1 gene:WBGene00013159.1 transcript:Y53F4B.12a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y53F4B.12)

HSP 1 Score: 71.2478 bits (173), Expect = 1.360e-12
Identity = 97/413 (23.49%), Postives = 174/413 (42.13%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCND-AVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVAL-FVSLGIIILLYVLASS-GLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDEN 1369
            + S L  + R R   +     ++  R L    ++       I   ++++    +    G +T L+ +F+ LI  F+     E S  +PK    Y + Y ++GELPAF++ W  ++D +       K ++   N+L      K+ T  +   S  S +     D+L          + L    +   I + L  + L+  +   +  F +   +N++    +  FG+  +          Y+G E  +   EETKNPRK I   L F+ L +  + +VL+ +  LS  V  L      P +  FS  N+ A K++  + ++ A     LA F    R+I  +  D LI       D  +K P +AVL+     +L ++  K  +L  +  M  +   ITI   L+ L++ + E 
Sbjct:    1 MSSLLQKMLRTRRVDEQFLRHSEWARRLGVPLMVALAGIKSISMMLFIILPFSLTQVAGPSTVLAPIFAFLIIFFSAAHLSELSCTMPKNCVQYHFAYAVIGELPAFVIAWISLVDYVAQAGLFCKAWADHFNLLFRGLPAKSLT--FDVFSTDSMLLSPQVDLLTVLSAIITLCLLLCSLRVVGTICVSLLAVTLLIAASCTMVAFFHSDPENWIK-AEFFHFGYQGVLYAICALCACYTGIESTSCLLEETKNPRKRISGVLSFLVLVLTTIFFVLSITFSLSTNVTALSEGIMIPEV--FSVINIPAAKYMLSVCSVCALSGGVLASFLPATRVIAALCHDRLI---PYAKDTSTKSPYFAVLLCTVLVALCSMIQKTMLLNFVIFMAPVKLVITIL--LVYLQHYYPEQ 403          
BLAST of slc7a-3 vs. Ensembl Celegans
Match: Y53F4B.12 (pep chromosome:WBcel235:II:15019223:15025768:1 gene:WBGene00013159.1 transcript:Y53F4B.12b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y53F4B.12)

HSP 1 Score: 65.0846 bits (157), Expect = 1.028e-10
Identity = 62/279 (22.22%), Postives = 116/279 (41.58%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCND-AVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVAL-FVSLGIIILLYVLA 970
            + S L  + R R   +     ++  R L    ++       I   ++++    +    G +T L+ +F+ LI  F+     E S  +PK    Y + Y ++GELPAF++ W  ++D +       K ++   N+L      K+ T  +   S  S +     D+L          + L    +   I + L  + L+  +   +  F +   +N++    +  FG+  +          Y+G E  +   EETKNPRK I   L F+ L +  + +VL+
Sbjct:    1 MSSLLQKMLRTRRVDEQFLRHSEWARRLGVPLMVALAGIKSISMMLFIILPFSLTQVAGPSTVLAPIFAFLIIFFSAAHLSELSCTMPKNCVQYHFAYAVIGELPAFVIAWISLVDYVAQAGLFCKAWADHFNLLFRGLPAKSLT--FDVFSTDSMLLSPQVDLLTVLSAIITLCLLLCSLRVVGTICVSLLAVTLLIAASCTMVAFFHSDPENWIK-AEFFHFGYQGVLYAICALCACYTGIESTSCLLEETKNPRKRISGVLSFLVLVLTTIFFVLS 276          
BLAST of slc7a-3 vs. Ensembl Fly
Match: slif (gene:FBgn0037203 transcript:FBtr0078555)

HSP 1 Score: 256.529 bits (654), Expect = 1.591e-76
Identity = 170/566 (30.04%), Postives = 308/566 (54.42%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF----------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKLP----MRINTNSMICTRXXXXXXXXXXXXXXXXTGVSILFILPISQI-----TGXXXXXXXXXXXXXXXXXXXXYEP-TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNS 1777
            + +   ++TRR++   ++  E++L R L+   L   G+   +G G+YVL G +  +  G A  +SFL + + S F G+CY EF+  +PKAGS Y Y+Y+ +GE  AF +GW +IL+ ++  ASV++G SG  + L N+ +    ++ + +    D      D L+F ++  L  I   GA  S  +N + +T+ L+ ++++++   +  +  N+             GG++PFG   +  GA    + + GF+C+A + EE  NP+++IP+++ VSL II L Y   S+ L+ M+P  + D+ APF  AF +   + +KWI  I  + A   + L   + +PR++Y M +DG++FK L  ++  +K P+ A +V   F+S++A+   +  L D+ S+G +L++  + I +++LRY   ++ E T   S K P       N NS    R+   ++     + I++  +  L    + ++     TG I +   +  +L    ++   +P + ++ TFK PL+P  P +++  N+ L+  L  +TW+RFL+  VIG +IYF YG+ NS
Sbjct:    1 MTNLWKALTRRKTEDVNEG-ESQLARVLNLFDLTALGVGSTLGLGVYVLAGQVAFNIAGPAVTISFLIAAIASAFAGICYAEFAARVPKAGSAYVYSYVTIGEFVAFTIGWNLILEYVIGTASVARGLSGYFDSLINNNMSKALNESMHI--DVDFLGDYPDFLSFGMVLLLAAILAFGAKESSFLNNIFTTVNLVTIAIVLVAGAMNANVDNWRIPKKDVPEGFGTGGFMPFGIAGVMAGAAKCFYGFVGFDCIATTGEEAINPKRNIPLSIVVSLIIIFLSYFGVSTVLTMMLPYYKQDKDAPFPHAFDSVEWYTIKWIVTIGAVFALCTSLLGAMFPLPRILYAMGKDGILFKRLSTVNSYTKTPLLATIVSGIFASIMAMLFNLDQLVDMMSIGTLLAYTIVAICVLVLRY---QDEEMTKLVSVKAPNVFRQFFNGNSF---REPNSMTSSITKVGIVVFAIFCLVWCSLQKVFDLDSTGGIVALSLVGAVLILICVVIGMQPVSTIELTFKVPLVPFVPCLSVFANLYLMFQLDLNTWIRFLIWIVIGYVIYFCYGMRNS 557          
BLAST of slc7a-3 vs. Ensembl Fly
Match: slif (gene:FBgn0037203 transcript:FBtr0078556)

HSP 1 Score: 256.529 bits (654), Expect = 1.591e-76
Identity = 170/566 (30.04%), Postives = 308/566 (54.42%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF----------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKLP----MRINTNSMICTRXXXXXXXXXXXXXXXXTGVSILFILPISQI-----TGXXXXXXXXXXXXXXXXXXXXYEP-TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNS 1777
            + +   ++TRR++   ++  E++L R L+   L   G+   +G G+YVL G +  +  G A  +SFL + + S F G+CY EF+  +PKAGS Y Y+Y+ +GE  AF +GW +IL+ ++  ASV++G SG  + L N+ +    ++ + +    D      D L+F ++  L  I   GA  S  +N + +T+ L+ ++++++   +  +  N+             GG++PFG   +  GA    + + GF+C+A + EE  NP+++IP+++ VSL II L Y   S+ L+ M+P  + D+ APF  AF +   + +KWI  I  + A   + L   + +PR++Y M +DG++FK L  ++  +K P+ A +V   F+S++A+   +  L D+ S+G +L++  + I +++LRY   ++ E T   S K P       N NS    R+   ++     + I++  +  L    + ++     TG I +   +  +L    ++   +P + ++ TFK PL+P  P +++  N+ L+  L  +TW+RFL+  VIG +IYF YG+ NS
Sbjct:    1 MTNLWKALTRRKTEDVNEG-ESQLARVLNLFDLTALGVGSTLGLGVYVLAGQVAFNIAGPAVTISFLIAAIASAFAGICYAEFAARVPKAGSAYVYSYVTIGEFVAFTIGWNLILEYVIGTASVARGLSGYFDSLINNNMSKALNESMHI--DVDFLGDYPDFLSFGMVLLLAAILAFGAKESSFLNNIFTTVNLVTIAIVLVAGAMNANVDNWRIPKKDVPEGFGTGGFMPFGIAGVMAGAAKCFYGFVGFDCIATTGEEAINPKRNIPLSIVVSLIIIFLSYFGVSTVLTMMLPYYKQDKDAPFPHAFDSVEWYTIKWIVTIGAVFALCTSLLGAMFPLPRILYAMGKDGILFKRLSTVNSYTKTPLLATIVSGIFASIMAMLFNLDQLVDMMSIGTLLAYTIVAICVLVLRY---QDEEMTKLVSVKAPNVFRQFFNGNSF---REPNSMTSSITKVGIVVFAIFCLVWCSLQKVFDLDSTGGIVALSLVGAVLILICVVIGMQPVSTIELTFKVPLVPFVPCLSVFANLYLMFQLDLNTWIRFLIWIVIGYVIYFCYGMRNS 557          
BLAST of slc7a-3 vs. Ensembl Fly
Match: slif (gene:FBgn0037203 transcript:FBtr0078557)

HSP 1 Score: 256.529 bits (654), Expect = 1.591e-76
Identity = 170/566 (30.04%), Postives = 308/566 (54.42%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF----------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKLP----MRINTNSMICTRXXXXXXXXXXXXXXXXTGVSILFILPISQI-----TGXXXXXXXXXXXXXXXXXXXXYEP-TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNS 1777
            + +   ++TRR++   ++  E++L R L+   L   G+   +G G+YVL G +  +  G A  +SFL + + S F G+CY EF+  +PKAGS Y Y+Y+ +GE  AF +GW +IL+ ++  ASV++G SG  + L N+ +    ++ + +    D      D L+F ++  L  I   GA  S  +N + +T+ L+ ++++++   +  +  N+             GG++PFG   +  GA    + + GF+C+A + EE  NP+++IP+++ VSL II L Y   S+ L+ M+P  + D+ APF  AF +   + +KWI  I  + A   + L   + +PR++Y M +DG++FK L  ++  +K P+ A +V   F+S++A+   +  L D+ S+G +L++  + I +++LRY   ++ E T   S K P       N NS    R+   ++     + I++  +  L    + ++     TG I +   +  +L    ++   +P + ++ TFK PL+P  P +++  N+ L+  L  +TW+RFL+  VIG +IYF YG+ NS
Sbjct:    1 MTNLWKALTRRKTEDVNEG-ESQLARVLNLFDLTALGVGSTLGLGVYVLAGQVAFNIAGPAVTISFLIAAIASAFAGICYAEFAARVPKAGSAYVYSYVTIGEFVAFTIGWNLILEYVIGTASVARGLSGYFDSLINNNMSKALNESMHI--DVDFLGDYPDFLSFGMVLLLAAILAFGAKESSFLNNIFTTVNLVTIAIVLVAGAMNANVDNWRIPKKDVPEGFGTGGFMPFGIAGVMAGAAKCFYGFVGFDCIATTGEEAINPKRNIPLSIVVSLIIIFLSYFGVSTVLTMMLPYYKQDKDAPFPHAFDSVEWYTIKWIVTIGAVFALCTSLLGAMFPLPRILYAMGKDGILFKRLSTVNSYTKTPLLATIVSGIFASIMAMLFNLDQLVDMMSIGTLLAYTIVAICVLVLRY---QDEEMTKLVSVKAPNVFRQFFNGNSF---REPNSMTSSITKVGIVVFAIFCLVWCSLQKVFDLDSTGGIVALSLVGAVLILICVVIGMQPVSTIELTFKVPLVPFVPCLSVFANLYLMFQLDLNTWIRFLIWIVIGYVIYFCYGMRNS 557          
BLAST of slc7a-3 vs. Ensembl Fly
Match: CG13248 (gene:FBgn0036984 transcript:FBtr0078234)

HSP 1 Score: 248.054 bits (632), Expect = 8.018e-73
Identity = 148/424 (34.91%), Postives = 233/424 (54.95%), Query Frame = 2
Query:  128 MSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESS----ADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFV-SDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTI 1384
            + ++L      + R +S   +  +ET LNRCL+T  +   GI HM+GAGIYVLTG + K+  G    LSF+ +G IS+   LCY EF T +PKAGS Y YTY+ MGE  AF++GW ++L+ ++  ASV++ +SG V+ +    + N T     L  +  + E       DVLAF +          G   +   N +L+ + +  + ++I   F Y   +N+  ++GG+LP+G G +  GA    +A+ GF+ +A S EE KNP  SIPVA  +SL ++ + Y+L S+ L+ M+P  +I+  A    AF   NL   K++  I  L     T L   + +PR +Y MA DGL+F   GKI+  +++P+  ++V    S+ LA+   +  L +  S+G +L++  +   +IILRY   E    TI
Sbjct:    9 LRHILSGICTKMNRTKSV-PTDVMETPLNRCLNTFDIALLGIGHMVGAGIYVLTGTVAKEMAGPGIILSFILAGFISMLAALCYAEFGTRVPKAGSAYVYTYISMGEFWAFVIGWNILLEHMLGAASVARAWSGYVDSMLGGWIGNTT-----LELTGGIHEPGLAQYPDVLAFLVCIVYAAALAGGVKATAVFNSLLTLVNIAVMVLVISVGFWYADGKNWSEAEGGFLPYGVGGVIAGAATCFYAFVGFDSIATSGEEAKNPSVSIPVATVISLFVVTVGYILVSAALTLMIPISEINPAASLPEAFGQLNLSWAKYLISIGALCGMTTTLLGSLFALPRCMYAMASDGLLFSCFGKINPTTQVPLLNLVVSGVMSACLALVFDLAKLVEFMSIGTLLAYTIVSASVIILRYRPMERIHTTI 426          

HSP 2 Score: 57.7658 bits (138), Expect = 2.291e-8
Identity = 26/55 (47.27%), Postives = 35/55 (63.64%), Query Frame = 2
Query: 1625 FKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSE 1789
            FK PL+P  P + I  NI L+++L   TW+RF V   IG+++YF YGI NS   E
Sbjct:  551 FKVPLVPFVPALGIFCNILLMVHLDAVTWVRFFVWVCIGMVVYFLYGIRNSKEGE 605          
BLAST of slc7a-3 vs. Ensembl Fly
Match: CG5535 (gene:FBgn0036764 transcript:FBtr0075159)

HSP 1 Score: 237.654 bits (605), Expect = 2.782e-69
Identity = 139/428 (32.48%), Postives = 229/428 (53.50%), Query Frame = 2
Query:  131 SYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF----------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTI 1384
            S+ + +    +TR++    S   E+KL + LS   L   GI   +G G+YVL G + K   G A  +SFL + + SIF GLCY EF   +PKAGS Y Y+Y+ +GE  AF++GW +IL+  +  ASV KG S  ++ LC + + +F   ++PL+       +  D+ AF +     L    GA  S  +N V + + L  +  +II      S  N+            DGG++P+G   I +GA +  + + GF+C+A + EE KNP+KSIP A+ VSL +I L Y   S+ L+ M+P  + D+KAP    F        +++  I  +    ++ +   + +PR+++ M+ DGL+FKFLG I E+ K P    ++    + +LA    +  L ++ S+G +L++  +   +++LRY  D+  E+ I
Sbjct:    3 SWSVTNAFRVLTRKKPLEDSN--ESKLAKVLSAFDLTALGIGSTLGVGVYVLAGEVSKQYAGPAVVVSFLIAAIASIFAGLCYAEFGARVPKAGSAYIYSYVTIGEFIAFLIGWNLILEYAIGSASVVKGLSTYLDQLCGNPMSSFLGTHMPLNIEG--MGAYPDLFAFVVTILFSLAIAVGAKESTRVNNVFTMLNLGVVLFVIIAGLFKVSSSNWSIPKSQVPEGYGDGGFMPYGVSGIIKGAAVCFYGFIGFDCIATAGEEAKNPKKSIPFAVIVSLAMIFLAYFGVSTVLTMMLPYFEQDEKAPLPHVFRINGWHVAEYVVSIGAMFGLCSSMMGAMFPLPRIVFAMSNDGLLFKFLGDISEKYKTPFKGTMITGMLTGILAAVFNLSQLVNMMSIGTLLAYSMVASCVLMLRYEVDDRRESRI 426          

HSP 2 Score: 56.6102 bits (135), Expect = 4.911e-8
Identity = 29/70 (41.43%), Postives = 43/70 (61.43%), Query Frame = 2
Query: 1601 EPTD-VKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKT 1807
            +PT  VK +FK PL+P  P I+I +NI L++ L   TW+RF +   IGL I+  YGI +S L ++ +   
Sbjct:  517 QPTSGVKLSFKVPLVPWLPGISILINIYLMIKLDILTWIRFSIWIAIGLAIFLAYGIRHSRLRQREQRNN 586          
BLAST of slc7a-3 vs. Ensembl Zebrafish
Match: slc7a3a (solute carrier family 7 member 3a [Source:ZFIN;Acc:ZDB-GENE-041114-206])

HSP 1 Score: 249.595 bits (636), Expect = 1.923e-73
Identity = 149/443 (33.63%), Postives = 239/443 (53.95%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQN-------FVSD---------------GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKL 1402
            + SF H + RRR+   S   ET+  RCLST  L+  G+   +GAG+YVL G + +++ G A  L FL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +IL  ++  ASV++ +S   + L    + NF    + +     V     D+ A  L+  L  +   G + S  +N + + I LI L  III  FV G+  N       F++D               GG+ PFG G I  GA    +A+ GF+C+A ++EE KNP +SIPV +  SL I    Y   S+ L+ M+P  +++ ++P   AFS       ++I  + +L A   + L   + +PR+IY MAEDGL+F+ L ++++R+K P+ A +     ++L+A    +  L D+ S+G +L++  + + ++ILRY     N ++   ++KL
Sbjct:    5 MASFGHILLRRRALDFSGE-ETRFARCLSTLDLVALGVGSTLGAGVYVLAGEVAREKAGPAIVLCFLVAALSSMLAGLCYAEFGARVPKTGSAYLYSYVTVGEIWAFITGWNLILSYVIGTASVARAWSSTFDNLIEQKISNFFRASMAMKVPGKVLAEYPDLFALILILLLTGLLAFGVSESALVNKIFTGINLIVLGFIIISGFVKGNTANWNLTYEYFINDTNITEPERIESTFGSGGFAPFGLGGILSGAATCFYAFVGFDCIATTSEEAKNPMRSIPVGIVASLLICFFAYFGVSAALTLMMPYYKLNTQSPLPEAFSYVGWAPARYIVAVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRSLSRMNKRTKTPLLATIASGIVAALMAFLFDLAALVDLMSIGTLLAYSLVAVCVLILRY--QPGNLSSSSQTEKL 444          

HSP 2 Score: 54.6842 bits (130), Expect = 2.615e-7
Identity = 27/52 (51.92%), Postives = 34/52 (65.38%), Query Frame = 2
Query: 1622 TFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNS 1777
            TFK PL+P  P+ +I +NI L+M L  +TW RF V   IG  IYF YGI +S
Sbjct:  558 TFKVPLLPWLPLFSIFVNIYLMMQLDVATWCRFTVWMAIGFAIYFGYGIWHS 609          
BLAST of slc7a-3 vs. Ensembl Zebrafish
Match: slc7a3b (solute carrier family 7 member 3b [Source:ZFIN;Acc:ZDB-GENE-120813-6])

HSP 1 Score: 246.899 bits (629), Expect = 2.334e-72
Identity = 143/427 (33.49%), Postives = 228/427 (53.40%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF---VSD-------------------GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRY 1354
            L SF   + RRR    S  +E+   RCL+T  LI  G+   +GAG+YVL G + +++ G A  LSFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +IL  ++  ASV++ +S   + L    +  F   ++    + +V     DV A  L+  L  +   G + S  +N + + I L+ L+ +II  FV G   N+   V D                   GG+ PFG   +  GA    +A+ GF+C+A ++EE KNP +SIP+ +  SL I    Y   S+ L+ M+P   +D+ +P   AF        ++I  + +L A   + L   + +PR+IY MAEDGL+F+FL ++ +++K P  A LV    ++L+A    +  L D+ S+G +L++  + + ++ILRY
Sbjct:    6 LASFGKMLLRRRVLDDSP-VESHFARCLTTLDLIALGVGATLGAGVYVLAGEVAREKAGPAIVLSFLIAALSSVLAGLCYAEFGARVPKTGSAYVYSYVTVGEIWAFITGWNLILSYVIGTASVARAWSATFDSLLAQKISTFFKAFMSFPDTQNVLAKYPDVFALILVMLLTGLLAFGVSESALVNKIFTGINLVVLTFVIISGFVKGDTANWNLTVEDYINRTNITGAQKIEKEFGSGGFAPFGLNGVLSGAATCFYAFVGFDCIATTSEEAKNPMRSIPIGIVASLLICFFAYFGVSAALTLMMPYYMLDKHSPLPQAFDYVGWGPARYIVSVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRFLSRMHKKTKTPALATLVSGIVAALMAFLFDLDALVDLMSIGTLLAYTLVAVCVLILRY 431          

HSP 2 Score: 64.6994 bits (156), Expect = 2.363e-10
Identity = 29/52 (55.77%), Postives = 39/52 (75.00%), Query Frame = 2
Query: 1622 TFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNS 1777
            TFK PL+P+ P+I+I +NI L+M + G+TW+RF V   IG LIYF YGI +S
Sbjct:  560 TFKVPLLPILPLISIFVNIYLMMQMSGATWIRFAVWMAIGFLIYFAYGIRHS 611          
BLAST of slc7a-3 vs. Ensembl Zebrafish
Match: slc7a3b (solute carrier family 7 member 3b [Source:ZFIN;Acc:ZDB-GENE-120813-6])

HSP 1 Score: 246.514 bits (628), Expect = 8.485e-72
Identity = 143/427 (33.49%), Postives = 228/427 (53.40%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF---VSD-------------------GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRY 1354
            L SF   + RRR    S  +E+   RCL+T  LI  G+   +GAG+YVL G + +++ G A  LSFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +IL  ++  ASV++ +S   + L    +  F   ++    + +V     DV A  L+  L  +   G + S  +N + + I L+ L+ +II  FV G   N+   V D                   GG+ PFG   +  GA    +A+ GF+C+A ++EE KNP +SIP+ +  SL I    Y   S+ L+ M+P   +D+ +P   AF        ++I  + +L A   + L   + +PR+IY MAEDGL+F+FL ++ +++K P  A LV    ++L+A    +  L D+ S+G +L++  + + ++ILRY
Sbjct:   58 LASFGKMLLRRRVLDDSP-VESHFARCLTTLDLIALGVGATLGAGVYVLAGEVAREKAGPAIVLSFLIAALSSVLAGLCYAEFGARVPKTGSAYVYSYVTVGEIWAFITGWNLILSYVIGTASVARAWSATFDSLLAQKISTFFKAFMSFPDTQNVLAKYPDVFALILVMLLTGLLAFGVSESALVNKIFTGINLVVLTFVIISGFVKGDTANWNLTVEDYINRTNITGAQKIEKEFGSGGFAPFGLNGVLSGAATCFYAFVGFDCIATTSEEAKNPMRSIPIGIVASLLICFFAYFGVSAALTLMMPYYMLDKHSPLPQAFDYVGWGPARYIVSVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRFLSRMHKKTKTPALATLVSGIVAALMAFLFDLDALVDLMSIGTLLAYTLVAVCVLILRY 483          

HSP 2 Score: 64.6994 bits (156), Expect = 2.272e-10
Identity = 29/52 (55.77%), Postives = 39/52 (75.00%), Query Frame = 2
Query: 1622 TFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNS 1777
            TFK PL+P+ P+I+I +NI L+M + G+TW+RF V   IG LIYF YGI +S
Sbjct:  612 TFKVPLLPILPLISIFVNIYLMMQMSGATWIRFAVWMAIGFLIYFAYGIRHS 663          
BLAST of slc7a-3 vs. Ensembl Zebrafish
Match: slc7a1a (solute carrier family 7 member 1a [Source:ZFIN;Acc:ZDB-GENE-091116-69])

HSP 1 Score: 234.572 bits (597), Expect = 7.670e-68
Identity = 130/421 (30.88%), Postives = 228/421 (54.16%), Query Frame = 2
Query:  170 RRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSD--------------------------GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRY 1354
            R       S E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  LSFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +IL  ++  +SV++ +S   + L    +++F  +Y+ ++ +  V     D+ +  ++ TL  +   G   S  +N V + I ++ L  +++   V G+ +N+  D                          GG++PFGF  +  GA    +A+ GF+C+A + EE KNP+++IP+ +  SL I  + Y   S+ L+ M+P   +D+ +P   AF         +   + +L A   + L   + +PR+++ MA+DGL+FKF+  I ER+K PI A ++  F ++++A    ++ L D+ S+G +L++  +   +++LRY
Sbjct:   15 RVKVVNCNSEESRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVLSFLIAALASVLAGLCYAEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYVIGTSSVARAWSATFDELIGKHIEHFCRQYMSMN-APGVLAEYPDMFSVFIILTLTGLLAFGVKESAMVNKVFTCINILVLLFMVVSGLVKGTLKNWHLDPDEILNATNSTLNATQPLPSEEMLGQGGFMPFGFTGVLSGAATCFYAFVGFDCIATTGEEVKNPQRAIPIGIVSSLLICFVAYFGVSAALTMMMPYYMLDKNSPLPVAFKYVGWEGATYAVAVGSLCALSTSLLGAMFPMPRVLWAMADDGLLFKFMAGISERTKTPIKATIMSGFLAAIMAFLFDLKDLVDLMSIGTLLAYTLVAACVLVLRY 434          

HSP 2 Score: 55.0694 bits (131), Expect = 2.119e-7
Identity = 26/63 (41.27%), Postives = 40/63 (63.49%), Query Frame = 2
Query: 1607 TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKA 1795
            +  K +FK P +P  P++++ +N+ L+M L   TW+RF +   IGL+IYF YGI   H +E A
Sbjct:  545 SKTKLSFKVPCLPFIPVVSMFVNVYLMMQLDRGTWIRFAIWMSIGLVIYFGYGI--WHSTEAA 605          
BLAST of slc7a-3 vs. Ensembl Zebrafish
Match: slc7a1a (solute carrier family 7 member 1a [Source:ZFIN;Acc:ZDB-GENE-091116-69])

HSP 1 Score: 234.572 bits (597), Expect = 7.670e-68
Identity = 130/421 (30.88%), Postives = 228/421 (54.16%), Query Frame = 2
Query:  170 RRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSD--------------------------GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRY 1354
            R       S E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  LSFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +IL  ++  +SV++ +S   + L    +++F  +Y+ ++ +  V     D+ +  ++ TL  +   G   S  +N V + I ++ L  +++   V G+ +N+  D                          GG++PFGF  +  GA    +A+ GF+C+A + EE KNP+++IP+ +  SL I  + Y   S+ L+ M+P   +D+ +P   AF         +   + +L A   + L   + +PR+++ MA+DGL+FKF+  I ER+K PI A ++  F ++++A    ++ L D+ S+G +L++  +   +++LRY
Sbjct:   15 RVKVVNCNSEESRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVLSFLIAALASVLAGLCYAEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYVIGTSSVARAWSATFDELIGKHIEHFCRQYMSMN-APGVLAEYPDMFSVFIILTLTGLLAFGVKESAMVNKVFTCINILVLLFMVVSGLVKGTLKNWHLDPDEILNATNSTLNATQPLPSEEMLGQGGFMPFGFTGVLSGAATCFYAFVGFDCIATTGEEVKNPQRAIPIGIVSSLLICFVAYFGVSAALTMMMPYYMLDKNSPLPVAFKYVGWEGATYAVAVGSLCALSTSLLGAMFPMPRVLWAMADDGLLFKFMAGISERTKTPIKATIMSGFLAAIMAFLFDLKDLVDLMSIGTLLAYTLVAACVLVLRY 434          

HSP 2 Score: 55.0694 bits (131), Expect = 2.119e-7
Identity = 26/63 (41.27%), Postives = 40/63 (63.49%), Query Frame = 2
Query: 1607 TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKA 1795
            +  K +FK P +P  P++++ +N+ L+M L   TW+RF +   IGL+IYF YGI   H +E A
Sbjct:  545 SKTKLSFKVPCLPFIPVVSMFVNVYLMMQLDRGTWIRFAIWMSIGLVIYFGYGI--WHSTEAA 605          
BLAST of slc7a-3 vs. Ensembl Xenopus
Match: SLC7A1 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [Source:NCBI gene;Acc:100492323])

HSP 1 Score: 240.736 bits (613), Expect = 4.096e-70
Identity = 132/409 (32.27%), Postives = 230/409 (56.23%), Query Frame = 2
Query:  170 RRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSD--------GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENN 1372
            RR    S S E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  L FL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE  AF+ GW +IL  ++  +SV++ +S   + L    ++ +   ++ ++    V     D+ +  ++  L  +   G   S  +N V + I ++ L  +II  FV GS +N  +         GG++PFGF  +  GA    +A+ GF+C+A + EE KNP+K+IP+ +  SL I  + Y   S+ L+ M+P   +++++P   AF+       ++   + +L A   + L   + +PR+I+ MA+DGL+FKFL K+ E++K P+ A L     ++L+A+   ++ L D+ S+G +L++  +   +++LRY  D+ N
Sbjct:   11 RRKVVGSDSKESRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVLCFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGEFLAFVTGWNLILSYVIGTSSVARAWSATFDDLIGKRIEEYCLAHISMNFPG-VLARYPDIFSVLIILVLTGLLSFGVKESALVNKVFTCINVLVLGFVIISGFVKGSVKNCGTKEQDLNYGAGGFMPFGFAGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPIGIVASLLICFVAYFGVSAALTLMMPYYLLNKESPLPVAFNYVGWDGARYAVAVGSLCALSTSLLGSMFPMPRVIFAMADDGLLFKFLAKVSEKTKTPVIATLTSGSVAALMALLFDLKDLVDLMSIGTLLAYSLVAACVLVLRYQPDQPN 418          

HSP 2 Score: 63.929 bits (154), Expect = 6.025e-10
Identity = 31/67 (46.27%), Postives = 44/67 (65.67%), Query Frame = 2
Query: 1607 TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKT 1807
            +  K +FK PL+P+ PI++I +N+ L+M L   TW+RF +  VIGL IYF YG+   H SE A  +T
Sbjct:  527 SKTKLSFKVPLLPVLPILSILVNVYLMMQLDKGTWIRFTIWMVIGLFIYFGYGM--WHSSEAASSET 591          
BLAST of slc7a-3 vs. Ensembl Xenopus
Match: SLC7A1 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [Source:NCBI gene;Acc:100492323])

HSP 1 Score: 240.35 bits (612), Expect = 6.287e-70
Identity = 134/427 (31.38%), Postives = 236/427 (55.27%), Query Frame = 2
Query:  134 YVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF--------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENN 1372
            Y+  + L  + RR+    S S E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  L FL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE  AF+ GW +IL  ++  +SV++ +S   + L    ++ +   ++ ++    V     D+ +  ++  L  +   G   S  +N V + I ++ L  +II  FV GS +N+                 GG++PFGF  +  GA    +A+ GF+C+A + EE KNP+K+IP+ +  SL I  + Y   S+ L+ M+P   +++++P   AF+       ++   + +L A   + L   + +PR+I+ MA+DGL+FKFL K+ E++K P+ A L     ++L+A+   ++ L D+ S+G +L++  +   +++LRY  D+ N
Sbjct:    2 YLERTMLKQLFRRKVVG-SDSKESRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVLCFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGEFLAFVTGWNLILSYVIGTSSVARAWSATFDDLIGKRIEEYCLAHISMNFPG-VLARYPDIFSVLIILVLTGLLSFGVKESALVNKVFTCINVLVLGFVIISGFVKGSVKNWQLSENDFNVTNDLNYGAGGFMPFGFAGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPIGIVASLLICFVAYFGVSAALTLMMPYYLLNKESPLPVAFNYVGWDGARYAVAVGSLCALSTSLLGSMFPMPRVIFAMADDGLLFKFLAKVSEKTKTPVIATLTSGSVAALMALLFDLKDLVDLMSIGTLLAYSLVAACVLVLRYQPDQPN 426          

HSP 2 Score: 63.929 bits (154), Expect = 6.074e-10
Identity = 31/67 (46.27%), Postives = 44/67 (65.67%), Query Frame = 2
Query: 1607 TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKT 1807
            +  K +FK PL+P+ PI++I +N+ L+M L   TW+RF +  VIGL IYF YG+   H SE A  +T
Sbjct:  535 SKTKLSFKVPLLPVLPILSILVNVYLMMQLDKGTWIRFTIWMVIGLFIYFGYGM--WHSSEAASSET 599          
BLAST of slc7a-3 vs. Ensembl Xenopus
Match: SLC7A2 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 2, gene 1 [Source:NCBI gene;Acc:100485546])

HSP 1 Score: 239.58 bits (610), Expect = 1.511e-69
Identity = 142/440 (32.27%), Postives = 232/440 (52.73%), Query Frame = 2
Query:  134 YVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQK 1399
            Y+  +F   I RR+  +     ++KL RCLST  L+  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y YTY+ +GEL AFI GW +IL  ++  +SV++ +SG  + L    +  F   Y  +  +S       D+ A  L+  L  +   G   S  +N V + + ++ L  ++I  FV G  QN+                     GG++P+G   +  GA    +A+ GF+C+A + EE +NP+++IP+ +  SL I  + Y   S+ L+ M+P  ++D+K+P   AF        K++  + +L A   + L   + +PR+IY MAEDGL+FK L KI  R+K P+ A L     ++++A    ++ L D+ S+G +L++  +   ++ILRY      E    N++K
Sbjct:    5 YLSLTFARCILRRKIVTLDSLEDSKLCRCLSTLDLVALGVGSTLGAGVYVLAGEVAKANSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLGKRIGQFFSTYFRM--NSPGLAEYPDIFAVFLILLLSGLLSFGVKESAWVNKVFTAVNVLVLLFVMIAGFVKGDLQNWKITESFLNSVSYDNVTSLYGAGGFMPYGLTGMLAGAATCFYAFVGFDCIATTGEEVRNPQRAIPIGIVASLLICFMAYFGVSAALTLMMPYFKLDEKSPLPVAFEYVGWGPAKYVVAVGSLCALSTSLLGSIFPMPRVIYAMAEDGLLFKSLAKISPRTKTPVIATLSSGAVAAVMAFLFDLKALVDMMSIGTLLAYSLVAACVLILRYQPGLGYEIPKGNAEK 442          

HSP 2 Score: 58.151 bits (139), Expect = 3.751e-8
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 2
Query: 1616 KDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNS 1777
            K TF  P +P+ P+ ++ +N+ L++ L G TW+RF +  VIG LIYF YGI +S
Sbjct:  546 KITFMVPFLPVLPVFSVLVNVYLMVQLSGDTWIRFSIWMVIGFLIYFAYGIRHS 599          
BLAST of slc7a-3 vs. Ensembl Xenopus
Match: SLC7A1 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [Source:NCBI gene;Acc:100492323])

HSP 1 Score: 238.039 bits (606), Expect = 7.310e-69
Identity = 135/440 (30.68%), Postives = 238/440 (54.09%), Query Frame = 2
Query:  128 MSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF-------------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENN 1372
            + Y+L +F   + RR+    S S E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  L FL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE  AF+ GW +IL  ++  +SV++ +S   + L    ++ +   ++ ++    V     D+ +  ++  L  +   G   S  +N V + I ++ L  +II  FV GS +N+                            GG++PFGF  +  GA    +A+ GF+C+A + EE KNP+K+IP+ +  SL I  + Y   S+ L+ M+P   +++++P   AF+       ++   + +L A   + L   + +PR+I+ MA+DGL+FKFL K+ E++K P+ A L     ++L+A+   ++ L D+ S+G +L++  +   +++LRY  D+ N
Sbjct:    1 VGYILLTFGQQLFRRKVVG-SDSKESRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVLCFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGEFLAFVTGWNLILSYVIGTSSVARAWSATFDDLIGKRIEEYCLAHISMNFPG-VLARYPDIFSVLIILVLTGLLSFGVKESALVNKVFTCINVLVLGFVIISGFVKGSVKNWQLSENDFNVTNVTGLPNGTKEQDLNYGAGGFMPFGFAGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPIGIVASLLICFVAYFGVSAALTLMMPYYLLNKESPLPVAFNYVGWDGARYAVAVGSLCALSTSLLGSMFPMPRVIFAMADDGLLFKFLAKVSEKTKTPVIATLTSGSVAALMALLFDLKDLVDLMSIGTLLAYSLVAACVLVLRYQPDQPN 438          

HSP 2 Score: 63.929 bits (154), Expect = 6.307e-10
Identity = 31/67 (46.27%), Postives = 44/67 (65.67%), Query Frame = 2
Query: 1607 TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKT 1807
            +  K +FK PL+P+ PI++I +N+ L+M L   TW+RF +  VIGL IYF YG+   H SE A  +T
Sbjct:  547 SKTKLSFKVPLLPVLPILSILVNVYLMMQLDKGTWIRFTIWMVIGLFIYFGYGM--WHSSEAASSET 611          
BLAST of slc7a-3 vs. Ensembl Xenopus
Match: SLC7A2 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 2, gene 1 [Source:NCBI gene;Acc:100485546])

HSP 1 Score: 236.498 bits (602), Expect = 2.667e-68
Identity = 142/444 (31.98%), Postives = 232/444 (52.25%), Query Frame = 2
Query:  146 SFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF-----------VSD---------------GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQK 1399
            +F   I RR+  +     ++KL RCLST  L+  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y YTY+ +GEL AFI GW +IL  ++  +SV++ +SG  + L    +  F   Y  +  +S       D+ A  L+  L  +   G   S  +N V + + ++ L  ++I  FV G  QN+            +D               GG++P+G   +  GA    +A+ GF+C+A + EE +NP+++IP+ +  SL I  + Y   S+ L+ M+P  ++D+K+P   AF        K++  + +L A   + L   + +PR+IY MAEDGL+FK L KI  R+K P+ A L     ++++A    ++ L D+ S+G +L++  +   ++ILRY      E    N++K
Sbjct:    9 TFARCILRRKIVTLDSLEDSKLCRCLSTLDLVALGVGSTLGAGVYVLAGEVAKANSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLGKRIGQFFSTYFRM--NSPGLAEYPDIFAVFLILLLSGLLSFGVKESAWVNKVFTAVNVLVLLFVMIAGFVKGDLQNWKITESFLQNISATDGNSVSYDNVTSLYGAGGFMPYGLTGMLAGAATCFYAFVGFDCIATTGEEVRNPQRAIPIGIVASLLICFMAYFGVSAALTLMMPYFKLDEKSPLPVAFEYVGWGPAKYVVAVGSLCALSTSLLGSIFPMPRVIYAMAEDGLLFKSLAKISPRTKTPVIATLSSGAVAAVMAFLFDLKALVDMMSIGTLLAYSLVAACVLILRYQPGLGYEIPKGNAEK 450          

HSP 2 Score: 57.7658 bits (138), Expect = 4.222e-8
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 2
Query: 1616 KDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNS 1777
            K TF  P +P+ P+ ++ +N+ L++ L G TW+RF +  VIG LIYF YGI +S
Sbjct:  554 KITFMVPFLPVLPVFSVLVNVYLMVQLSGDTWIRFSIWMVIGFLIYFAYGIRHS 607          
BLAST of slc7a-3 vs. Ensembl Mouse
Match: Slc7a1 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [Source:MGI Symbol;Acc:MGI:88117])

HSP 1 Score: 252.292 bits (643), Expect = 2.295e-75
Identity = 142/445 (31.91%), Postives = 247/445 (55.51%), Query Frame = 2
Query:  155 HSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF-----------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENN--ENTIDNSQKLPMRINTNSMI 1432
              + RR+    S+  E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +IL  I+  +SV++ +S   + L    +  F+ +++ L+ +  V   + D+ A  ++  L  +   G   S  +N + + I ++ L  I++  FV GS +N+                   +GG++PFGF  +  GA    +A+ GF+C+A + EE KNP+K+IPV +  SL I  + Y   S+ L+ M+P   +D  +P   AF ++     K+   I +L A   + L   + +PR+IY MAEDGL+FKFL KI+ R+K P+ A +     ++++A   +++ L D+ S+G +L++  +   +++LRY  ++ N        +++L  R++ N ++
Sbjct:   11 QQMLRRKVVDCSRE-ESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGKPIGEFSRQHMALN-APGVLAQTPDIFAVIIIIILTGLLTLGVKESAMVNKIFTCINVLVLCFIVVSGFVKGSIKNWQLTEKNFSCNNNDTNVKYGEGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDIDSPLPGAFKHQGWEEAKYAVAIGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFKFLAKINNRTKTPVIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAACVLVLRYQPEQPNLVYQMARTTEELD-RVDQNELV 452          
BLAST of slc7a-3 vs. Ensembl Mouse
Match: Slc7a1 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [Source:MGI Symbol;Acc:MGI:88117])

HSP 1 Score: 252.292 bits (643), Expect = 1.515e-74
Identity = 142/445 (31.91%), Postives = 247/445 (55.51%), Query Frame = 2
Query:  155 HSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF-----------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENN--ENTIDNSQKLPMRINTNSMI 1432
              + RR+    S+  E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +IL  I+  +SV++ +S   + L    +  F+ +++ L+ +  V   + D+ A  ++  L  +   G   S  +N + + I ++ L  I++  FV GS +N+                   +GG++PFGF  +  GA    +A+ GF+C+A + EE KNP+K+IPV +  SL I  + Y   S+ L+ M+P   +D  +P   AF ++     K+   I +L A   + L   + +PR+IY MAEDGL+FKFL KI+ R+K P+ A +     ++++A   +++ L D+ S+G +L++  +   +++LRY  ++ N        +++L  R++ N ++
Sbjct:   11 QQMLRRKVVDCSRE-ESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGKPIGEFSRQHMALN-APGVLAQTPDIFAVIIIIILTGLLTLGVKESAMVNKIFTCINVLVLCFIVVSGFVKGSIKNWQLTEKNFSCNNNDTNVKYGEGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDIDSPLPGAFKHQGWEEAKYAVAIGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFKFLAKINNRTKTPVIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAACVLVLRYQPEQPNLVYQMARTTEELD-RVDQNELV 452          

HSP 2 Score: 56.225 bits (134), Expect = 9.363e-8
Identity = 26/58 (44.83%), Postives = 38/58 (65.52%), Query Frame = 2
Query: 1607 TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSH 1780
            +  K +FK P +P+ P+++I +NI L+M L   TW+RF V  +IG  IYF YGI +S 
Sbjct:  545 SKTKLSFKVPFVPVLPVLSIFVNIYLMMQLDQGTWVRFAVWMLIGFTIYFGYGIWHSE 602          
BLAST of slc7a-3 vs. Ensembl Mouse
Match: Slc7a3 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 3 [Source:MGI Symbol;Acc:MGI:1100521])

HSP 1 Score: 233.032 bits (593), Expect = 1.938e-67
Identity = 145/435 (33.33%), Postives = 234/435 (53.79%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF----------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNEN 1378
            L  F   + RRR        ET+L RCLST  L+  G+   +GAG+YVL G + KD+ G +  + FL + L S+  GLCY EF   +P +GS Y Y+Y+ +GEL AF  GW +IL  ++  ASV++ +S A + L  + +   T K   L K   V     D  A AL+  L  + + GA+ S  +  V + + L+ LS +II  F+ G  +N+                      +  GG++PFG   I +GA    +A+ GF+C+A + EE +NP++SIP+ + +S+ I  L Y   SS L+ M+P  ++  ++P   AFS       +++  I +L A   + L   + +PR++Y+MAEDGL+F+ L K+   + IPI A LV    ++ +A   ++  L D+ S+G +L+   + I ++ILRY  D+  ++
Sbjct:    6 LRRFGQKLVRRRVLELGMG-ETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAALSSVLAGLCYAEFGARVPGSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISR-TLKGTILLKMPHVLAEYPDFFALALVLLLTGLLVLGASKSALVTKVFTGMNLLVLSFVIISGFIKGELRNWKLTKEDYCLTMSESNGTCSLDSMGSGGFMPFGLEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISMFICFLAYFGVSSALTLMMPYYKLHPESPLPEAFSYVGWEPARYLVAIGSLCALSTSLLGSMFPMPRVMYSMAEDGLLFRVLAKVHSVTHIPIVATLVSGVIAAFMAFLFELTDLVDLMSIGTLLAHSLVSICVLILRYQPDQEMKS 438          

HSP 2 Score: 52.7582 bits (125), Expect = 1.116e-6
Identity = 24/59 (40.68%), Postives = 36/59 (61.02%), Query Frame = 2
Query: 1625 FKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEE 1801
            FK P +PL P+++I +N+ L+M +   TW RF +  +IG  IYF YGI +S    K  +
Sbjct:  538 FKVPAVPLLPLVSIFVNVYLMMQMTAGTWARFGIWMLIGFAIYFGYGIQHSMKEVKNHQ 596          
BLAST of slc7a-3 vs. Ensembl Mouse
Match: Slc7a3 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 3 [Source:MGI Symbol;Acc:MGI:1100521])

HSP 1 Score: 233.032 bits (593), Expect = 1.938e-67
Identity = 145/435 (33.33%), Postives = 234/435 (53.79%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF----------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNEN 1378
            L  F   + RRR        ET+L RCLST  L+  G+   +GAG+YVL G + KD+ G +  + FL + L S+  GLCY EF   +P +GS Y Y+Y+ +GEL AF  GW +IL  ++  ASV++ +S A + L  + +   T K   L K   V     D  A AL+  L  + + GA+ S  +  V + + L+ LS +II  F+ G  +N+                      +  GG++PFG   I +GA    +A+ GF+C+A + EE +NP++SIP+ + +S+ I  L Y   SS L+ M+P  ++  ++P   AFS       +++  I +L A   + L   + +PR++Y+MAEDGL+F+ L K+   + IPI A LV    ++ +A   ++  L D+ S+G +L+   + I ++ILRY  D+  ++
Sbjct:    6 LRRFGQKLVRRRVLELGMG-ETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAALSSVLAGLCYAEFGARVPGSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISR-TLKGTILLKMPHVLAEYPDFFALALVLLLTGLLVLGASKSALVTKVFTGMNLLVLSFVIISGFIKGELRNWKLTKEDYCLTMSESNGTCSLDSMGSGGFMPFGLEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISMFICFLAYFGVSSALTLMMPYYKLHPESPLPEAFSYVGWEPARYLVAIGSLCALSTSLLGSMFPMPRVMYSMAEDGLLFRVLAKVHSVTHIPIVATLVSGVIAAFMAFLFELTDLVDLMSIGTLLAHSLVSICVLILRYQPDQEMKS 438          

HSP 2 Score: 52.7582 bits (125), Expect = 1.116e-6
Identity = 24/59 (40.68%), Postives = 36/59 (61.02%), Query Frame = 2
Query: 1625 FKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEE 1801
            FK P +PL P+++I +N+ L+M +   TW RF +  +IG  IYF YGI +S    K  +
Sbjct:  538 FKVPAVPLLPLVSIFVNVYLMMQMTAGTWARFGIWMLIGFAIYFGYGIQHSMKEVKNHQ 596          
BLAST of slc7a-3 vs. Ensembl Mouse
Match: Slc7a3 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 3 [Source:MGI Symbol;Acc:MGI:1100521])

HSP 1 Score: 233.032 bits (593), Expect = 1.938e-67
Identity = 145/435 (33.33%), Postives = 234/435 (53.79%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF----------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNEN 1378
            L  F   + RRR        ET+L RCLST  L+  G+   +GAG+YVL G + KD+ G +  + FL + L S+  GLCY EF   +P +GS Y Y+Y+ +GEL AF  GW +IL  ++  ASV++ +S A + L  + +   T K   L K   V     D  A AL+  L  + + GA+ S  +  V + + L+ LS +II  F+ G  +N+                      +  GG++PFG   I +GA    +A+ GF+C+A + EE +NP++SIP+ + +S+ I  L Y   SS L+ M+P  ++  ++P   AFS       +++  I +L A   + L   + +PR++Y+MAEDGL+F+ L K+   + IPI A LV    ++ +A   ++  L D+ S+G +L+   + I ++ILRY  D+  ++
Sbjct:    6 LRRFGQKLVRRRVLELGMG-ETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAALSSVLAGLCYAEFGARVPGSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISR-TLKGTILLKMPHVLAEYPDFFALALVLLLTGLLVLGASKSALVTKVFTGMNLLVLSFVIISGFIKGELRNWKLTKEDYCLTMSESNGTCSLDSMGSGGFMPFGLEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISMFICFLAYFGVSSALTLMMPYYKLHPESPLPEAFSYVGWEPARYLVAIGSLCALSTSLLGSMFPMPRVMYSMAEDGLLFRVLAKVHSVTHIPIVATLVSGVIAAFMAFLFELTDLVDLMSIGTLLAHSLVSICVLILRYQPDQEMKS 438          

HSP 2 Score: 52.7582 bits (125), Expect = 1.116e-6
Identity = 24/59 (40.68%), Postives = 36/59 (61.02%), Query Frame = 2
Query: 1625 FKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEE 1801
            FK P +PL P+++I +N+ L+M +   TW RF +  +IG  IYF YGI +S    K  +
Sbjct:  538 FKVPAVPLLPLVSIFVNVYLMMQMTAGTWARFGIWMLIGFAIYFGYGIQHSMKEVKNHQ 596          
BLAST of slc7a-3 vs. UniProt/SwissProt
Match: sp|P30823|SL7A1_RAT (High affinity cationic amino acid transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc7a1 PE=2 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 9.390e-75
Identity = 142/430 (33.02%), Postives = 239/430 (55.58%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF-------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENN 1372
            L S    + RR+    S+  E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +IL  I+  +SV++ +S   + L    +  F+ +++ L+ +  V   + D+ A  ++  L  +   G   S  +N + + I ++ L  I++  FV GS +N+                     +GG++PFGF  +  GA    +A+ GF+C+A + EE KNP+K+IPV +  SL I  + Y   S+ L+ M+P   +D  +P   AF  R     K+   + +L A   + L   + +PR+IY MAEDGL+FKFL KI++R+K PI A +     ++++A   +++ L D+ S+G +L++  +   +++LRY  ++ N
Sbjct:    6 LLSLGQQMLRRKVVDCSRE-ESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGKPIGEFSRQHMALN-APGVLAQTPDIFAVIIIIILTGLLTLGVKESAMVNKIFTCINVLVLCFIMVSGFVKGSIENWQLTENKSSPLCGNNDTNVKYGEGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDTDSPLPGAFKYRGWEEAKYAVAVGSLCALSTSPLGSMFPMPRVIYAMAEDGLLFKFLAKINDRTKTPIIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAACVLVLRYQPEQPN 433          

HSP 2 Score: 53.5286 bits (127), Expect = 5.055e-6
Identity = 24/58 (41.38%), Postives = 37/58 (63.79%), Query Frame = 2
Query: 1607 TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSH 1780
            +  K +FK P +P+ P+++I +NI L+M L   TW+RF V  +I   IYF YG+ +S 
Sbjct:  547 SKTKLSFKVPFVPVLPVLSIFVNIYLMMQLDQGTWVRFAVWMLIAFAIYFGYGVWHSE 604          
BLAST of slc7a-3 vs. UniProt/SwissProt
Match: sp|Q09143|SL7A1_MOUSE (High affinity cationic amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc7a1 PE=1 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.060e-73
Identity = 142/445 (31.91%), Postives = 247/445 (55.51%), Query Frame = 2
Query:  155 HSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF-----------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENN--ENTIDNSQKLPMRINTNSMI 1432
              + RR+    S+  E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +IL  I+  +SV++ +S   + L    +  F+ +++ L+ +  V   + D+ A  ++  L  +   G   S  +N + + I ++ L  I++  FV GS +N+                   +GG++PFGF  +  GA    +A+ GF+C+A + EE KNP+K+IPV +  SL I  + Y   S+ L+ M+P   +D  +P   AF ++     K+   I +L A   + L   + +PR+IY MAEDGL+FKFL KI+ R+K P+ A +     ++++A   +++ L D+ S+G +L++  +   +++LRY  ++ N        +++L  R++ N ++
Sbjct:   11 QQMLRRKVVDCSRE-ESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGKPIGEFSRQHMALN-APGVLAQTPDIFAVIIIIILTGLLTLGVKESAMVNKIFTCINVLVLCFIVVSGFVKGSIKNWQLTEKNFSCNNNDTNVKYGEGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDIDSPLPGAFKHQGWEEAKYAVAIGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFKFLAKINNRTKTPVIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAACVLVLRYQPEQPNLVYQMARTTEELD-RVDQNELV 452          

HSP 2 Score: 56.225 bits (134), Expect = 6.549e-7
Identity = 26/58 (44.83%), Postives = 38/58 (65.52%), Query Frame = 2
Query: 1607 TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSH 1780
            +  K +FK P +P+ P+++I +NI L+M L   TW+RF V  +IG  IYF YGI +S 
Sbjct:  545 SKTKLSFKVPFVPVLPVLSIFVNIYLMMQLDQGTWVRFAVWMLIGFTIYFGYGIWHSE 602          
BLAST of slc7a-3 vs. UniProt/SwissProt
Match: sp|P30825|SL7A1_HUMAN (High affinity cationic amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC7A1 PE=1 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 4.150e-71
Identity = 143/436 (32.80%), Postives = 239/436 (54.82%), Query Frame = 2
Query:  137 VLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFV----------------SD--------GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENN 1372
            VL +    + RR+    S+  ET+L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +IL  I+  +SV++ +S   + L    +  F+  ++ L+ +  V   + D+ A  ++  L  +   G   S  +N + + I ++ L  I++  FV GS +N+                 +D        GG++PFGF  +  GA    +A+ GF+C+A + EE KNP+K+IPV +  SL I  + Y   S+ L+ M+P   +D  +P   AF +      K+   + +L A  A+ L   + +PR+IY MAEDGL+FKFL  +++R+K PI A L     ++++A    ++ L D+ S+G +L++  +   +++LRY  ++ N
Sbjct:    5 VLLNIGQQMLRRKVVDCSRE-ETRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRTHMTLN-APGVLAENPDIFAVIIILILTGLLTLGVKESAMVNKIFTCINVLVLGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDNNSPLPDAFKHVGWEGAKYAVAVGSLCALSASLLGSMFPMPRVIYAMAEDGLLFKFLANVNDRTKTPIIATLASGAVAAVMAFLFDLKDLVDLMSIGTLLAYSLVAACVLVLRYQPEQPN 438          

HSP 2 Score: 56.225 bits (134), Expect = 6.476e-7
Identity = 25/58 (43.10%), Postives = 39/58 (67.24%), Query Frame = 2
Query: 1607 TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSH 1780
            +  K +FK P +P+ PI++I +N+ L+M L   TW+RF V  +IG +IYF YG+ +S 
Sbjct:  552 SKTKLSFKVPFLPVLPILSIFVNVYLMMQLDQGTWVRFAVWMLIGFIIYFGYGLWHSE 609          
BLAST of slc7a-3 vs. UniProt/SwissProt
Match: sp|Q8WY07|CTR3_HUMAN (Cationic amino acid transporter 3 OS=Homo sapiens OX=9606 GN=SLC7A3 PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 5.790e-68
Identity = 140/434 (32.26%), Postives = 230/434 (53.00%), Query Frame = 2
Query:  143 HSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF----------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNEN 1378
              F   + RRR+  +S   ET+L RCLST  L+  G+   +GAG+YVL G + KD+ G +  + FL + L S+  GLCY EF   +P++GS Y Y+Y+ +GEL AF  GW +IL  ++  ASV++ +S A + L  + +       + L     V     D  A  L+  L  +   GA+ S  +  V + + L+ L  ++I  FV G   N+                      +  GG++PFGF  I +GA    +A+ GF+C+A + EE +NP++SIP+ + +SL +  L Y   SS L+ M+P  Q+  ++P   AF        +++  + +L A   + L   + +PR+IY MAEDGL+F+ L +I   ++ PI A +V    ++ +A   K+  L D+ S+G +L++  + I ++ILRY  D+  + 
Sbjct:    7 RRFGQKLVRRRTL-ESGMAETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAALSSVLAGLCYAEFGARVPRSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISKTLQGSIAL-HVPHVLAEYPDFFALGLVLLLTGLLALGASESALVTKVFTGVNLLVLGFVMISGFVKGDVHNWKLTEEDYELAMAELNDTYSLGPLGSGGFVPFGFEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISLSVCFLAYFAVSSALTLMMPYYQLQPESPLPEAFLYIGWAPARYVVAVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRVLARIHTGTRTPIIATVVSGIIAAFMAFLFKLTDLVDLMSIGTLLAYSLVSICVLILRYQPDQETKT 438          

HSP 2 Score: 54.6842 bits (130), Expect = 2.319e-6
Identity = 29/68 (42.65%), Postives = 39/68 (57.35%), Query Frame = 2
Query: 1625 FKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNS-------HLSEKAEEKT 1807
            FK P +PL P+++I +NI L+M +   TW RF V  +IG  IYF YGI +S         S K+  KT
Sbjct:  539 FKVPALPLLPLMSIFVNIYLMMQMTAGTWARFGVWMLIGFAIYFGYGIQHSLEEIKSNQPSRKSRAKT 606          
BLAST of slc7a-3 vs. UniProt/SwissProt
Match: sp|P70423|CTR3_MOUSE (Cationic amino acid transporter 3 OS=Mus musculus OX=10090 GN=Slc7a3 PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.355e-66
Identity = 145/435 (33.33%), Postives = 234/435 (53.79%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF----------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNEN 1378
            L  F   + RRR        ET+L RCLST  L+  G+   +GAG+YVL G + KD+ G +  + FL + L S+  GLCY EF   +P +GS Y Y+Y+ +GEL AF  GW +IL  ++  ASV++ +S A + L  + +   T K   L K   V     D  A AL+  L  + + GA+ S  +  V + + L+ LS +II  F+ G  +N+                      +  GG++PFG   I +GA    +A+ GF+C+A + EE +NP++SIP+ + +S+ I  L Y   SS L+ M+P  ++  ++P   AFS       +++  I +L A   + L   + +PR++Y+MAEDGL+F+ L K+   + IPI A LV    ++ +A   ++  L D+ S+G +L+   + I ++ILRY  D+  ++
Sbjct:    6 LRRFGQKLVRRRVLELGMG-ETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKDKAGPSIVICFLVAALSSVLAGLCYAEFGARVPGSGSAYLYSYVTVGELWAFTTGWNLILSYVIGTASVARAWSSAFDNLIGNHISR-TLKGTILLKMPHVLAEYPDFFALALVLLLTGLLVLGASKSALVTKVFTGMNLLVLSFVIISGFIKGELRNWKLTKEDYCLTMSESNGTCSLDSMGSGGFMPFGLEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISMFICFLAYFGVSSALTLMMPYYKLHPESPLPEAFSYVGWEPARYLVAIGSLCALSTSLLGSMFPMPRVMYSMAEDGLLFRVLAKVHSVTHIPIVATLVSGVIAAFMAFLFELTDLVDLMSIGTLLAHSLVSICVLILRYQPDQEMKS 438          

HSP 2 Score: 52.7582 bits (125), Expect = 7.807e-6
Identity = 24/59 (40.68%), Postives = 36/59 (61.02%), Query Frame = 2
Query: 1625 FKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEE 1801
            FK P +PL P+++I +N+ L+M +   TW RF +  +IG  IYF YGI +S    K  +
Sbjct:  538 FKVPAVPLLPLVSIFVNVYLMMQMTAGTWARFGIWMLIGFAIYFGYGIQHSMKEVKNHQ 596          
BLAST of slc7a-3 vs. TrEMBL
Match: A0A0H3YF62 (Slc7a-3 OS=Schmidtea mediterranea OX=79327 GN=slc7a-3 PE=2 SV=1)

HSP 1 Score: 1003.05 bits (2592), Expect = 0.000e+0
Identity = 591/591 (100.00%), Postives = 591/591 (100.00%), Query Frame = 2
Query:   83 MHTVQVGQERSFIFFMSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKLPMRINTNSMICTRXXXXXXXXXXXXXXXXTGVSILFILPISQITGXXXXXXXXXXXXXXXXXXXXYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKTXXXXXXXXXXXXXKQE 1855
            MHTVQVGQERSFIFFMSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVLAFALLFTLFLITLTGANISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWITGIATLLATGATKLAVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKLPMRINTNSMICTRKFFKISLFSLIISIILTGVSILFILPISQITGIIFSAIFILLILTFTIIISLYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKTELILLDNNNDEILKQE
Sbjct:    1 MHTVQVGQERSFIFFMSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVLAFALLFTLFLITLTGANISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWITGIATLLATGATKLAVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKLPMRINTNSMICTRKFFKISLFSLIISIILTGVSILFILPISQITGIIFSAIFILLILTFTIIISLYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKTELILLDNNNDEILKQE 591          
BLAST of slc7a-3 vs. TrEMBL
Match: A0A0H3YJ04 (Slc7a-5 OS=Schmidtea mediterranea OX=79327 GN=slc7a-5 PE=2 SV=1)

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 310/546 (56.78%), Postives = 416/546 (76.19%), Query Frame = 2
Query:  167 RRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTI-DNSQKLPMRINTNSMICTRXXXXXXXXXXXXXXXXTGVSILFILPISQITGXXXXXXXXXXXXXXXXXXXXYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEE 1801
            R++SFSQ ++L+T L+RCLST QL FYGIS MIG GIY+LTG IIKD+VG  TNLSFL SG ISIFTGLCYCEFSTLIPKAGS YTYTYLMMGELPAFI+GWT++++ I++LA V+KGFS A+N + N  + N+T K+LPLSK S +W+SS D++A  L+  LF  +LTG +ISMN+N VL+  Q++FL+ III CFVYGS+QN++ DGGYLPFGF S+F+GAG+ IF Y+GFE LAN AEETK+P+KSIP A+  SL +I++LY L S+GL ++VPR QID  +PFI AF  +NL  +KW+T I T+LA  ATK  V Y+IPR IY MA DGL+F+FL  I+++SKIPI A++ G+ FS  L +FIKI++LAD+T++GII+SFIT+GI+L+ILRY+ + + E ++ +++  + MR+N+ + +  +  FK  L   IIS IL G S L+I P  QI GI+     +++IL   II+SLYEP   K+ F TPLMPL P+ITI LNI ++++ P  TW+R+L+    GL++Y F+G  NS L+EK EE
Sbjct:   14 RKQSFSQLQTLDTNLDRCLSTYQLTFYGISRMIGVGIYILTGIIIKDKVGPGTNLSFLLSGFISIFTGLCYCEFSTLIPKAGSSYTYTYLMMGELPAFIIGWTVLMNYIIALAGVAKGFSAAINSIVNGTIGNWTLKHLPLSKDSTIWDSSIDIVAVLLILLLFSFSLTGISISMNVNCVLAISQILFLTTIIIACFVYGSNQNYLDDGGYLPFGFLSVFKGAGLVIFTYAGFESLANIAEETKDPKKSIPTAMLTSLSLIVILYFLISTGLPYLVPRHQIDASSPFITAFMEKNLVLMKWVTIIGTILAIAATKFTVIYIIPRAIYAMANDGLLFRFLANINKKSKIPISALITGILFSCTLTMFIKIEILADVTTIGIIISFITVGINLLILRYLHETDTEKSLMESNVPMEMRVNSCAFLANQNIFKAVLSCFIISNILFGFSFLYIYPTFQIFGIVVCTFSLMVILLMMIILSLYEPHCFKEGFTTPLMPLAPVITIILNISIIVHFPIGTWIRYLICLSFGLILYIFHGFSNSELAEKVEE 559          
BLAST of slc7a-3 vs. TrEMBL
Match: A0A1I8GIC5 (AA_permease_C domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017733g2 PE=4 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 2.675e-137
Identity = 233/554 (42.06%), Postives = 366/554 (66.06%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPL--SKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYI-FDENNENTIDNSQKLPMRINTN-SMICTRXXXXXXXXXXXXXXXXTGVSILFILPISQITGXXXXXXXXXXXXXXXXXXXXYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSE 1789
            L SF   + R++S ++++SLET L+RCL+   L+FY I+HM GAG+YVLTG ++K   G    +S+L  G+ S+FTGLCY EF+TL+PKAGSCYTYTYLM+GELPAF+VGWTM+ D I+ +ASV+K FSG V+ LCN  V  F  +++       S +++ + D++A AL+ +L L+ + GAN S+++N+ LS +QL+ L+ + +  FVYGS  N+ + GG+ P+G   + QGA +AIFAYSGFE ++N+AEE +NPR+ +P+AL  SLGII +LYV A  G+S++ P  ++D  +PF++AFS R  +  +      TLLATGATKLA  YVIPRM Y +A DG+I K    ++ER ++P+  +  G   +++LA+F K++ LAD+ SMGI+LS+  +G+DL +LRY+ F   +++ +        R++++   + T    K  L   +++  L G ++ + +P       +   I +  +L    ++  Y+P +V + +++PLMPL+P+ TI +N  +++ +   TWLRFL+   +GL++YF YGI +S   E
Sbjct:    9 LQSFGSKLLRKKSLAEARSLETPLDRCLTVWHLLFYAIAHMAGAGVYVLTGAVVKSNAGPGAFVSYLICGVASLFTGLCYVEFATLVPKAGSCYTYTYLMLGELPAFVVGWTMLSDYIIGMASVAKAFSGTVDALCNHTVSGFFKQHMGTFHHGPSQIFDDTWDMVAVALILSLMLLVVAGANFSLSVNIGLSVLQLLCLATVAVAAFVYGSAANWTAGGGFFPYGISGVVQGATVAIFAYSGFESVSNAAEECRNPRRDLPIALLSSLGIIAVLYVAACLGISYLEPYYELDVNSPFVSAFSRRGAYWAEGFAAAGTLLATGATKLATMYVIPRMAYALASDGVILKCFANVNERVRVPLPGLFCGTALAAVLAMFFKLEFLADMVSMGILLSYFAVGLDLFVLRYLHFASGDKSEVPLRDWASDRLSSSLPWLGTLPGLKRLLGGFVVACFLCGGAVDYAVPQLTWWSWLLGCITLAAVLVTGGLLCAYQPHEVAEMYESPLMPLSPLTTIFINAVMIVKMQFYTWLRFLLWIGVGLILYFSYGIRHSTALE 562          
BLAST of slc7a-3 vs. TrEMBL
Match: A0A1I8JIQ3 (AA_permease_C domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017733g3 PE=4 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 3.617e-137
Identity = 233/554 (42.06%), Postives = 366/554 (66.06%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPL--SKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYI-FDENNENTIDNSQKLPMRINTN-SMICTRXXXXXXXXXXXXXXXXTGVSILFILPISQITGXXXXXXXXXXXXXXXXXXXXYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSE 1789
            L SF   + R++S ++++SLET L+RCL+   L+FY I+HM GAG+YVLTG ++K   G    +S+L  G+ S+FTGLCY EF+TL+PKAGSCYTYTYLM+GELPAF+VGWTM+ D I+ +ASV+K FSG V+ LCN  V  F  +++       S +++ + D++A AL+ +L L+ + GAN S+++N+ LS +QL+ L+ + +  FVYGS  N+ + GG+ P+G   + QGA +AIFAYSGFE ++N+AEE +NPR+ +P+AL  SLGII +LYV A  G+S++ P  ++D  +PF++AFS R  +  +      TLLATGATKLA  YVIPRM Y +A DG+I K    ++ER ++P+  +  G   +++LA+F K++ LAD+ SMGI+LS+  +G+DL +LRY+ F   +++ +        R++++   + T    K  L   +++  L G ++ + +P       +   I +  +L    ++  Y+P +V + +++PLMPL+P+ TI +N  +++ +   TWLRFL+   +GL++YF YGI +S   E
Sbjct:    9 LQSFGSKLLRKKSLAEARSLETPLDRCLTVWHLLFYAIAHMAGAGVYVLTGAVVKSNAGPGAFVSYLICGVASLFTGLCYVEFATLVPKAGSCYTYTYLMLGELPAFVVGWTMLSDYIIGMASVAKAFSGTVDALCNHTVSGFFKQHMGTFHHGPSQIFDDTWDMVAVALILSLMLLVVAGANFSLSVNIGLSVLQLLCLATVAVAAFVYGSAANWTAGGGFFPYGISGVVQGATVAIFAYSGFESVSNAAEECRNPRRDLPIALLSSLGIIAVLYVAACLGISYLEPYYELDVNSPFVSAFSRRGAYWAEGFAAAGTLLATGATKLATMYVIPRMAYALASDGVILKCFANVNERVRVPLPGLFCGTALAAVLAMFFKLEFLADMVSMGILLSYFAVGLDLFVLRYLHFASGDKSKVPLRDWASGRLSSSLPWLGTLPGLKRLLGGFVVACFLCGGAVDYAVPQLTWWSWLLGCITLAAVLVTGGLLCGYQPHEVAEMYESPLMPLSPLTTIFINAVMIVKMQFYTWLRFLLWIGVGLILYFSYGIRHSTALE 562          
BLAST of slc7a-3 vs. TrEMBL
Match: A0A267FDF9 (AA_permease_C domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012557g1 PE=4 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 2.108e-129
Identity = 232/555 (41.80%), Postives = 355/555 (63.96%), Query Frame = 2
Query:  146 SFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSD-GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKLPMRINTNSMICTRXXXXXXXXXXXXXXXXTGVSILFILPISQITGXXXXXXXXXXXXXXXXXXXXYEPTDVK-DTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEK 1804
            +FL  + R++S ++++SLET L RCL+  QLIFYGI+HM GAGIYVL G +IK + G A +LSFL   L+S+FTGLCY EFSTLIP+AGSCYT+TY+ +GELPAF+VGWTMI D ++ +ASV+K FS  V+ + + A+ N T  +      SD  + + D++ F+L+  L L+TLTGA ISM++N+VLS +Q + L+++   C+V GS  N+ ++ GG+ PFG   +  GA +AIFA+SGFE +AN+AEE K+PR+S+PVAL  SLGII LLY  +S GLS++ P  ++D  +PF+ AF +     L ++    TLLATGATKLA  YV+PR+ Y +A DG+IF     +  R  +P+  ++ G   S++LA+   I  LA+  SMG++LS++ IG+DL  LRY+     ++++  +    +     + +C R          +   +LTGV I +  P+     ++ + +   + L   + +  Y+P  V+   ++ PLMPL P++   +N  L++ L   TW+RFLV ++ GL++Y  YG  NS  ++  ++ 
Sbjct:   59 TFLGKLLRQKSLTEARSLETPLKRCLTAYQLIFYGIAHMAGAGIYVLAGTVIKTKAGPAASLSFLLCALLSVFTGLCYVEFSTLIPRAGSCYTFTYITLGELPAFLVGWTMISDLVIGMASVAKAFSSTVDAISHQAISNATRTHFGSLPESDYLDPNIDLVGFSLIIALMLLTLTGAAISMSVNMVLSAVQCVCLTLMAGACYVLGSPDNWSAEHGGFFPFGVSGVINGATVAIFAFSGFEAIANAAEECKDPRRSLPVALLTSLGIITLLYFASSLGLSYLSPYSELDAGSPFVVAFQSHGAAWLSYVAAGGTLLATGATKLATIYVMPRLFYALAADGVIFPCFAYVQPRLGVPLVGLVFGGLLSAVLALVFNIHTLANFVSMGVLLSYLMIGVDLFYLRYLLHRWGDHSL-RAWACCISPGLANWLCRRSTLTRLFVGYLGVSLLTGVLINYAAPLLTWWALLATVLVGAVNLLMLVCLCAYQPRTVEPGVYEAPLMPLPPLMAFFINAVLIVRLEWLTWVRFLVWSIFGLIMYGAYGYRNSVSAKDTQQS 612          
BLAST of slc7a-3 vs. Ensembl Cavefish
Match: slc7a2 (solute carrier family 7 member 2 [Source:NCBI gene;Acc:103042120])

HSP 1 Score: 269.626 bits (688), Expect = 3.962e-81
Identity = 184/611 (30.11%), Postives = 303/611 (49.59%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSH-----------------------QNFVSD---GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFD-------------ENNENTIDNSQKLPMRINTNSMICT---RXXXXXXXXXXXXXXXXTGVSILFILPISQITGXXXXXXXXXXXXXXXXXXXXY------------EPTDVKD-TFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKT 1807
            L SF HS+ RR++    +  ++KL RCLST  LI  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +IL  ++  +SV++ +SG  + L    ++ F  KY  +S          D  A  L+  L  +   G   S  +N + + + ++ L  +II  FV G                         +N  SD   GG+LP+GFG    GA    +A+ GF+C+A + EE KNP+++IP+ +  SL I  L Y   S+ L+ M+P   +D+K+P   AF        K++  + +L A   + L   + +PR+IY MA+DG++FK L +I+ ++K P+ A +     ++++A    ++ L D+ S+G +L++  +   ++ILRY  D             E  E+ +  S+     +    M          + +  S     +  GV ++ +  IS IT     AI  ++      + + +            +P   K  +F  PL+P  PI++I +N+ L++ L G TW+RF V   +G LIYF YGI +S   ++  + +
Sbjct:    5 LLSFGHSLVRRKNVDCLE--DSKLCRCLSTVDLIALGVGSTLGAGVYVLAGEVAKGDSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYSYVTVGELLAFITGWNLILSYVIGTSSVARAWSGTFDELIGGHIETFCTKYFRMSLPG--LAEYPDFFAVCLILLLSGLLSFGVKESAWVNKIFTAVNVLVLMFVIISGFVKGDSYNWNISEESLINVTIVTRNLSYTENVTSDYGAGGFLPYGFGGTLAGAATCFYAFVGFDCIATTGEEVKNPQRAIPIGIVSSLLICFLAYFGVSAALTLMMPYYLLDEKSPLPMAFEYVGWGPAKYVVAVGSLCALSTSLLGSIFPMPRVIYAMADDGVLFKVLARINPKTKTPVIATMTSGVVAAIMACIFDLKALVDMMSIGTLLAYSLVAACVLILRYRPDSVLEGSRMNKDGEEVRESELTESESHLNSLKDGEMTLQTILHPSKQPTTASSTAVNMAVGVIVITVCVISAITTHYGLAILAMVPWVLGTLAASFVVFFVCIILICRQPQTSKKVSFMVPLLPYLPILSIFVNVYLMLQLSGDTWIRFSVWMAVGFLIYFGYGIWHSSEHQRQRQAS 611          
BLAST of slc7a-3 vs. Ensembl Cavefish
Match: slc7a2 (solute carrier family 7 member 2 [Source:NCBI gene;Acc:103042120])

HSP 1 Score: 259.996 bits (663), Expect = 1.631e-77
Identity = 182/611 (29.79%), Postives = 302/611 (49.43%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSH-----------------------QNFVSD---GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFD-------------ENNENTIDNSQKLPMRINTNSMICT---RXXXXXXXXXXXXXXXXTGVSILFILPISQITGXXXXXXXXXXXXXXXXXXXXY------------EPTDVKD-TFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKT 1807
            L SF HS+ RR++    +  ++KL RCLST  LI  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +IL  ++  +SV++ +SG  + L    ++ F  KY  +S          D  A  L+  L  +   G   S  +N + + + ++ L  +II  FV G                         +N  SD   GG+LP+GFG    GA    +A+ GF+C+A + EE KNP+++IP+ +  SL I  L Y   S+ L+ M+P   +D+K+P   AF        K++  + +L A   + L   + +PR+++ MA DG++F+FL K+++R   P+ A +     ++++A    ++ L D+ S+G +L++  +   ++ILRY  D             E  E+ +  S+     +    M          + +  S     +  GV ++ +  IS IT     AI  ++      + + +            +P   K  +F  PL+P  PI++I +N+ L++ L G TW+RF V   +G LIYF YGI +S   ++  + +
Sbjct:    5 LLSFGHSLVRRKNVDCLE--DSKLCRCLSTVDLIALGVGSTLGAGVYVLAGEVAKGDSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYSYVTVGELLAFITGWNLILSYVIGTSSVARAWSGTFDELIGGHIETFCTKYFRMSLPG--LAEYPDFFAVCLILLLSGLLSFGVKESAWVNKIFTAVNVLVLMFVIISGFVKGDSYNWNISEESLINVTIVTRNLSYTENVTSDYGAGGFLPYGFGGTLAGAATCFYAFVGFDCIATTGEEVKNPQRAIPIGIVSSLLICFLAYFGVSAALTLMMPYYLLDEKSPLPMAFEYVGWGPAKYVVAVGSLCALSTSLLGCMFPLPRILFAMARDGILFRFLSKLNKRQS-PVAATMAAGTTAAIMACIFDLKALVDMMSIGTLLAYSLVAACVLILRYRPDSVLEGSRMNKDGEEVRESELTESESHLNSLKDGEMTLQTILHPSKQPTTASSTAVNMAVGVIVITVCVISAITTHYGLAILAMVPWVLGTLAASFVVFFVCIILICRQPQTSKKVSFMVPLLPYLPILSIFVNVYLMLQLSGDTWIRFSVWMAVGFLIYFGYGIWHSSEHQRQRQAS 610          
BLAST of slc7a-3 vs. Ensembl Cavefish
Match: slc7a3a (cationic amino acid transporter 3 [Source:NCBI gene;Acc:103034170])

HSP 1 Score: 244.973 bits (624), Expect = 9.978e-72
Identity = 144/434 (33.18%), Postives = 234/434 (53.92%), Query Frame = 2
Query:  167 RRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQN-------FVSD---------------GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKL 1402
            RRR    S   ET+  RCLST  L+  G+   +GAG+YVL G + +++ G A  L FL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +IL  ++  ASV++ +S   + L    + +F    + +    +V     D+ A  L+  L  +   G + S  +N + + + L+ L  +II  FV G+ +N       F++D               GG+ PFGF  I  GA    +A+ GF+C+A ++EE KNP +SIPV +  SL I    Y   S+ L+ M+P  +++ ++P   AFS       ++I  + +L A   + L   + +PR+IY MAEDGL+F+ L ++++R+K P+ A +   F ++L+A    +  L D+ S+G +L++  + + ++ILRY       N    S+KL
Sbjct:   14 RRRVLDCSGE-ETRFARCLSTLDLVALGVGSTLGAGVYVLAGEVAREKAGPAIVLCFLVAALSSMLAGLCYAEFGARVPKTGSAYLYSYVTVGEIWAFITGWNLILSYVIGTASVARAWSSTFDNLVEQKISSFFKSAMAIKVPGNVLAEYPDLFALILILLLSGLLAFGVSESALVNKIFTGVNLVVLGFVIISGFVKGNTENWNLTLNDFINDTNITTPEVVEKSFGTGGFAPFGFSGILSGAATCFYAFVGFDCIATTSEEAKNPMRSIPVGIVASLLICFFAYFGVSAALTLMMPYYKLNTQSPLPEAFSYVGWAPARYIVAVGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRALSRMNKRTKTPLLATVASGFVAALMAFLFDLAALVDLMSIGTLLAYSLVAVCVLILRY--QPGTLNCSSQSEKL 444          

HSP 2 Score: 59.6918 bits (143), Expect = 7.896e-9
Identity = 29/61 (47.54%), Postives = 39/61 (63.93%), Query Frame = 2
Query: 1622 TFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEK 1804
            TFK PL+P  P+ +I +NI L+M L  +TW RF V   IG LIYF YGI NS  +  + ++
Sbjct:  558 TFKVPLLPWLPLFSIFVNIYLMMQLDLATWCRFAVWMAIGFLIYFCYGIRNSTEALNSAQR 618          
BLAST of slc7a-3 vs. Ensembl Cavefish
Match: slc7a3b (cationic amino acid transporter 3-like [Source:NCBI gene;Acc:103021899])

HSP 1 Score: 241.891 bits (616), Expect = 8.874e-71
Identity = 139/424 (32.78%), Postives = 227/424 (53.54%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF-------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRY 1354
            L SF   + RRR    +   ET+  RCL+T  LI  G+   +GAG+YVL G + +++ G A  LSFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +IL  ++  ASV++ +S   + L    +  F +  + L  +  V     D+ A  L+  L  +   G + S  +N + + I L+ L  +II  FV G   N+                     +GG+ PFGF  I  GA    +A+ GF+C+A ++EE KNP++SIP+ +  SL I  + Y   S+ L+ M+P   +D  +P   AF        ++I  + +L A   + L   + +PR+I+ MAEDGL+F+ L ++ +++K P+ A +     ++L+A    +  L D+ S+G +L++  + + ++ILRY
Sbjct:    3 LASFGRMLVRRRVLDTNDE-ETRFARCLTTLDLIALGVGATLGAGVYVLAGEVAREKAGPAIVLSFLIAALSSVLAGLCYAEFGARVPKTGSAYLYSYVTVGEIWAFITGWNLILSYVIGTASVARAWSSTFDNLVEQKISTFFNGSMALPDTGGVLAKYPDLFALVLILLLTGLLAFGVSESALVNKIFTGINLVVLGFVIISGFVKGDTANWNISLEDIQNRSLLVPPNTKFGNGGFAPFGFSGILSGAATCFYAFVGFDCIATTSEEAKNPQRSIPIGIVASLLICFVAYFGVSAALTMMMPYYLLDTDSPLPEAFKYVEWDPARYIVAVGSLCALSTSLLGSMFPMPRVIFAMAEDGLLFRSLSRMHKKTKTPVLATIASGVVAALMAFIFSLDALVDLMSIGTLLAYTLVAVCVLILRY 425          

HSP 2 Score: 55.4546 bits (132), Expect = 1.547e-7
Identity = 32/60 (53.33%), Postives = 44/60 (73.33%), Query Frame = 2
Query: 1622 TFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEE 1801
            TFK PL+P+ P+++I +NI L+M L G+TWLRF V  V+G +IYF YGI NS  ++K  E
Sbjct:  554 TFKVPLLPVLPLVSIFVNIYLMMQLDGATWLRFTVWMVLGFVIYFLYGIRNSSQAKKNSE 613          
BLAST of slc7a-3 vs. Ensembl Cavefish
Match: ENSAMXT00000010113.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:11948206:11968754:-1 gene:ENSAMXG00000009846.2 transcript:ENSAMXT00000010113.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.195 bits (609), Expect = 2.663e-70
Identity = 131/415 (31.57%), Postives = 231/415 (55.66%), Query Frame = 2
Query:  149 FLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF-------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRY 1354
            F   + R ++   S   E++L+RCL+T  L+  G+   +GAG+YVL G + ++  G A  LSFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GEL AFI GW +IL  I+  +SV++ +S   + L    ++ F   ++ ++ +  +     D+ A  ++  L  +   G   S  +N V + + ++ L  +++   + G+ +N+             + +GG++PFGF  +  GA    +A+ GF+C+A + EE KNP+++IP+ +  SL I  + Y   S+ L+ M+P   +DQ +P  AAF        K+   + +L A   + L   + +PR+I+ MAEDGL+FKFL KI+ +SK P+ A +     ++++A    ++ L D+ S+G +L++  +   +++LRY
Sbjct:    4 FGEQLLRVKAVDCSTE-ESRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVLSFLIAALASVMAGLCYAEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIKKQIELFCRTHMRMN-APGILAEYPDMFAVLIILILTGLLAFGVKESAMVNKVFTCVNVLVLMFVVVSGLIKGTFKNWNIDPDDVLNGTSILGEGGFMPFGFTGVLSGAATCFYAFVGFDCIATTGEEVKNPQRAIPIGIVASLLICFVAYFGVSAALTMMMPYYLLDQNSPLPAAFKYVGWDGAKYAVAVGSLCALSTSLLGSMFPMPRIIWAMAEDGLLFKFLAKINTKSKTPVLATITSGIVAAVMAFLFDLKDLVDLMSIGTLLAYTLVAACVLVLRY 416          
BLAST of slc7a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000766.1 (pep scaffold:Pmarinus_7.0:GL478727:35765:49900:1 gene:ENSPMAG00000000697.1 transcript:ENSPMAT00000000766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 206.068 bits (523), Expect = 9.716e-59
Identity = 124/415 (29.88%), Postives = 209/415 (50.36%), Query Frame = 2
Query:  200 ETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF-----------------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYI 1357
            ++ L RCLST  L+  G+   +GAG YVL G + +   G +  LSFL + L S+  GLCY EF   +P+ GS Y Y+Y+ +GEL AFI GW +IL  ++  +SV++ +S   N L    +  F  +++ +           DV A  ++  L  +   G   S  IN V + I  + L+ +II  F+ G   NF                                GG++P+G   +  GA    +A+ GF+C+A + EE +NP+++IP  +  SL +  L Y   S+ L+ ++P   +D   P   AF        ++      L A  A+ L   + +PR++Y MA DGL+F++L ++ ER + P+ A L     ++++A+   ++ L D+ S+G +L++  +   ++ILRY+
Sbjct:    2 DSSLARCLSTFDLVALGVGSTLGAGAYVLAGAVARQDAGPSIVLSFLVAALASVLAGLCYAEFGARVPRTGSAYLYSYVTVGELLAFITGWNLILSYVIGTSSVARAWSANFNDLIGGHISAFFGQHMVMDAPG--LARYPDVFAAFIIMLLAGLLSFGVKESAIINKVFTCINALVLTFVIIAGFIKGDTHNFNVPYSYLNVIMIFDDSSRNIPAGLNASSSFGVGGFMPYGVTGMLSGAATCFYAFVGFDCIATTGEEVRNPQRAIPFGIVASLLLCFLAYFGVSAALTLLMPYCLLDPNNPLPVAFQFVGWGPARYAVAAGALCALSASMLGSMFPLPRIMYAMARDGLLFRYLARVSER-RTPVAATLSAGCLAAVMALLFDLKDLVDMMSIGTLLAYSLVAACVLILRYV 413          
BLAST of slc7a-3 vs. Ensembl Sea Lamprey
Match: slc7a4 (solute carrier family 7 member 4 [Source:ZFIN;Acc:ZDB-GENE-030919-2])

HSP 1 Score: 200.29 bits (508), Expect = 3.690e-56
Identity = 133/397 (33.50%), Postives = 222/397 (55.92%), Query Frame = 2
Query:  197 LETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDV--WESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFV-SDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNEN 1378
            +ET L RCLST  L   G+  M+G+G+YVLTG + K   G A  +SFL +GL S+   LCY EF    P+AGS Y YTY+ MGE+ AF++GW ++L+ ++  A+V++ +SG  + +    ++NFT  ++    S DV       D LA  +LF   ++   G  +S  IN + + I +  +  I+++ F     QN+   +GG+ P+GF  I  G     FA+ GF+ +A+S+EE ++P +S+PVA  +SL +  L Y L ++ L+ MVP   +  ++    AFS R      +I    ++ A     L+  + +PR+IY MA+DGL F     +   +K+P+ A++V    +++LA    ++ L    S+G +L++  +   +I+LRY  D   ++
Sbjct:   29 METSLTRCLSTLDLTLLGLGGMVGSGLYVLTGTVAKSMAGPAVIISFLLAGLASMLAALCYAEFGARAPRAGSAYLYTYMTMGEVWAFMIGWNVVLEYMIGGAAVARAWSGYFDAIFEHKIQNFTLTHV---ASWDVPFLAHYPDFLACGILFIATILVSFGTKVSSWINHLFAVISMGAILFILVFGFTLADPQNYSKKEGGFAPYGFSGIMTGTATCFFAFVGFDVIASSSEEARDPSRSVPVATALSLVLATLAYTLVATVLTLMVPWHSLVPESALSDAFSRRGHPWAGFIVSTGSICAMNTVLLSSLFSLPRIIYAMADDGLFFSVFSHLHAVTKVPVNAIVVFGTLTAVLATLFDLEALVQFLSIGTLLAYTFVAASVIVLRYQPDRTLQS 422          

HSP 2 Score: 49.2914 bits (116), Expect = 2.291e-6
Identity = 24/68 (35.29%), Postives = 38/68 (55.88%), Query Frame = 2
Query: 1598 YEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEE 1801
            +E      TF  P +P  P +++ +NI L++ L   TW+RF+V  V+G+ IY  YG+   H  E+  E
Sbjct:  539 HEQNRGPTTFLVPCVPFLPALSMLINITLMLKLNYMTWVRFMVWIVVGMFIYLSYGM--WHSKERLRE 604          
BLAST of slc7a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000741.1 (pep scaffold:Pmarinus_7.0:GL501074:1046:17370:1 gene:ENSPMAG00000000668.1 transcript:ENSPMAT00000000741.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 3.212e-28
Identity = 72/246 (29.27%), Postives = 130/246 (52.85%), Query Frame = 2
Query:  686 SMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF-------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDE 1366
            S  +N + + + ++ L  +++  FV G   N+                   +  GG+LPFG   +  GA    +A+ GF+C+A + EE KNP+++IPV + VSL I    Y   S+ L+ M+P   +D+++P   AF        K+   + +L A   + L   + +PR++Y MA DGLIF+ L K+  R K P+ A +     ++++A+ + ++ L D+ S+G +L++  +   ++ILRY  D+
Sbjct:   62 SAWVNKIFTVVNVLVLCFVVVAGFVKGDIHNWAIVPEEITNITSSHSAELRLGVGGFLPFGVTGMLAGAATCFYAFIGFDCIATTGEEVKNPQRAIPVGIVVSLLICFAAYFGVSAALTLMMPYYLLDKESPLPVAFEYVGWDPAKYPVAVGSLCALSTSLLGSMFPLPRIVYAMARDGLIFRHLAKLSSR-KSPVVATMASGMLAAVMALLLDLKDLVDMMSIGTLLAYSLVAACVLILRYKEDD 306          
BLAST of slc7a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001199.1 (pep scaffold:Pmarinus_7.0:GL479551:1043:11089:-1 gene:ENSPMAG00000001071.1 transcript:ENSPMAT00000001199.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 8.880e-26
Identity = 53/127 (41.73%), Postives = 80/127 (62.99%), Query Frame = 2
Query:  143 HSFLHSITRRRS--FSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDS-IVSLASVS 514
              F  +++RR+S       + E++L+R LST  L+  G+   +GAG+YVL G + +D  G A  LSFL + + S+  GLCY EF   +PK GS Y Y+Y+ +GEL AF+ GWT++ D  +V+ AS+S
Sbjct:    6 ERFARTLSRRKSGAMDADGTEESQLSR-LSTLDLVVLGVGSTLGAGVYVLAGAVARDDAGPAIVLSFLVAAVASVLAGLCYAEFGARVPKTGSAYLYSYVAVGELCAFVTGWTLLRDRFVVNSASLS 131          
BLAST of slc7a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002665.1 (pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1 gene:ENSPMAG00000002414.1 transcript:ENSPMAT00000002665.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 7.234e-13
Identity = 91/383 (23.76%), Postives = 174/383 (45.43%), Query Frame = 2
Query:  251 ISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSG--LISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYL-PLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVY----GSHQNFVSDGGYLPFGFG---SIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLAS-SGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAI-FIKIQVLADITSMGIILSFITIGID---LIILRY 1354
            +  M+G+GI+V  G +++   G  ++   +++G  L+S+   LCY E    +P  G  Y Y     G   AF+  WT       S+A +    + AV +        F +  L PL        +    LA A L  + ++       +M    VL+ ++++ L+++ +   V      +H    S  G  P       S +QG    ++AY G+  L  + EE K+  K+I   + V++ ++   YVL + S ++ + P+ +I   A     + +R L +  WI  ++  ++T  +     +V+ R+ Y  A +G     L  +  R + P  AV     FS+LL++ F+    L  +T+    ++++ +G++   L++LRY
Sbjct:   50 VGSMVGSGIFVSPGGVLRFVGGDPSSALLVWAGCGLLSLLGALCYAELGAAVPTTGGEYAYVRRAFGAPLAFLFAWT-------SVALLRPAMNSAVAL-------TFAEYVLRPLFHGCPAPPAIVKCLAIASLLVVGILNCVSMKWAMRALDVLTLLKMLALAIVSVGGLVLLASGRTHNPLGSFAGAPPSPAQIGESFYQG----LWAYGGWNALNYATEELKDVHKNITRCIVVAVPLVTAFYVLVNISYMTVLTPK-EIISSAAVAVTWGDRVLGSFSWIVPLSVAVSTFGSLNCSAFVMGRLNYAAAREGHALPLLAMLSVRHQTPTPAVA----FSTLLSVAFVLPTDLIMLTNYFGFVTWLLVGLNCAGLLVLRY 409          
BLAST of slc7a-3 vs. Ensembl Yeast
Match: HIP1 (High-affinity histidine permease; also involved in the transport of manganese ions [Source:SGD;Acc:S000003423])

HSP 1 Score: 60.077 bits (144), Expect = 6.493e-10
Identity = 51/165 (30.91%), Postives = 81/165 (49.09%), Query Frame = 2
Query:  791 GGYLPFGFGSIFQGAG----IAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMV----PRL-----QID-QKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFF 1243
            G ++    G+ F+G       A F+YSG E  A SA E+KNPR++IP A   +  +I   YV   + +  +V    PRL      +D   +P + A  N  +  L  +     L+A  +   +  Y   R +  MA  G + KFL ++D+R + P+ A+L+ LFF
Sbjct:  270 GAFVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGR-PMNAILLTLFF 433          
BLAST of slc7a-3 vs. Ensembl Yeast
Match: TAT1 (Amino acid transporter for valine, leucine, isoleucine, and tyrosine; low-affinity tryptophan and histidine transporter; overexpression confers FK506 and FTY720 resistance; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000273])

HSP 1 Score: 53.9138 bits (128), Expect = 5.649e-8
Identity = 53/197 (26.90%), Postives = 90/197 (45.69%), Query Frame = 2
Query:  704 VLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGI----AIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVP----------RLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSL 1252
            +L  I  + L+ III C   G  +   ++  + P  F   F+G       A F+Y G E L  SA E +NP KSIP A    +  I+L+Y+L +  + F+VP                 +PF+ A ++  +  +        L++  +   +  Y  PR++ ++AE G++ K L  +D R+  P+    V L F  +
Sbjct:  241 ILMVIGFVILA-IIINCGGAGDRRYIGAEYWHNPGPFAHGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVD-RNGRPLLCFFVSLVFGCI 435          
BLAST of slc7a-3 vs. Ensembl Yeast
Match: BAP2 (High-affinity leucine permease; functions as a branched-chain amino acid permease involved in uptake of leucine, isoleucine and valine; contains 12 predicted transmembrane domains; BAP2 has a paralog, BAP3, that arose from the whole genome duplication [Source:SGD;Acc:S000000272])

HSP 1 Score: 51.9878 bits (123), Expect = 2.403e-7
Identity = 42/140 (30.00%), Postives = 69/140 (49.29%), Query Frame = 2
Query:  842 AIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQ----------KAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLV 1231
            A F++ G E  A S +E  NPRKS PVA   S+  I+++Y+L    + F VP    DQ           +P++ A S   +  +  I     L++  +   +  Y  PR+I ++A+ G   KFL  +D   + P+ A++V
Sbjct:  297 AYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVP-YNDDQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGR-PLRALIV 434          
BLAST of slc7a-3 vs. Ensembl Yeast
Match: BAP3 (Amino acid permease; involved in uptake of cysteine, leucine, isoleucine and valine; BAP3 has a paralog, BAP2, that arose from the whole genome duplication [Source:SGD;Acc:S000002453])

HSP 1 Score: 50.447 bits (119), Expect = 7.144e-7
Identity = 41/140 (29.29%), Postives = 67/140 (47.86%), Query Frame = 2
Query:  842 AIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQ----------KAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLV 1231
            A F++ G E    S  E  NPRKS PVA   S+  I+++Y+L    + F VP    DQ           +P++ A S   +  +  I     L++  +   +  Y  PR++ ++A+ G   KFL  ID   + P+ A++V
Sbjct:  292 AYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPH-NNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGR-PLRALVV 429          
BLAST of slc7a-3 vs. Ensembl Yeast
Match: DIP5 (Dicarboxylic amino acid permease; mediates high-affinity and high-capacity transport of L-glutamate and L-aspartate; also a transporter for Gln, Asn, Ser, Ala, and Gly; relocalizes from plasma membrane to vacuole upon DNA replication stress [Source:SGD;Acc:S000006186])

HSP 1 Score: 49.2914 bits (116), Expect = 1.414e-6
Identity = 54/202 (26.73%), Postives = 90/202 (44.55%), Query Frame = 2
Query:  842 AIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYV----LASSGLSFMVPRLQIDQ-------KAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIK------IQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQ 1396
            ++F+Y+G E       E +NPRKS+P A+ +++  II+ Y+    L    +++  PRL   +        +PF+ A  N  +  L  I     L+   +   +  YV  R +Y +A DG   K   K   R  +P  A+++ + F  L  + +            ++ SM  ILS+ITI   LI+  Y         ID S+
Sbjct:  293 SLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKT-SRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITI---LIVYIYFDKACRAQGIDKSK 490          
BLAST of slc7a-3 vs. Ensembl Nematostella
Match: EDO40885 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Y3])

HSP 1 Score: 189.504 bits (480), Expect = 1.549e-54
Identity = 110/368 (29.89%), Postives = 192/368 (52.17%), Query Frame = 2
Query:  128 MSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDK------YLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIP 1213
            M+ V+  F  ++ R++  ++   + T L+RCL+   L   G+   +GAGIYV+ G + +   G    +SF  +   S+ +GLCY EF   +PKAGS Y Y+Y+ MGEL AFI+GW ++L+ ++  +SV++ +S   + +  D ++  T +      +  L K  D +        F L+  +  +   G   S   N V + + ++ +  I +  F +    N+  D  +LPFGF  +  GA    + + GF+ +A + EE +NP ++IP+++ VSLGI  + Y   S+ L+ M P   +  +      F+ R     +++     L    A+ +   + +PR++Y MA DGLIF FL +I  R++IP
Sbjct:    1 MAAVIRWF-GNLGRKKYLNEEAIVRTDLSRCLTLQDLTALGVGSTLGAGIYVVAGEVARSVAGPGVVISFFIAAFASVLSGLCYAEFGARVPKAGSAYVYSYVTMGELCAFIIGWNLVLEYVIGASSVARAWSSYFDTIIQDRIRTSTIQTIGEINFPGLGKYPDFFS-------FLLVLVITFVLAIGVKNSSRFNSVFTFVNVLVIIFITVLGFYHAKGVNWTRD--FLPFGFSGVVSGAATCFYCFVGFDIIATTGEEAQNPSRAIPISIVVSLGICFVAYFGVSAALTLMWPYNLLPAQGALPKVFALRGAPWAQYLIAAGALCGLTASLIGALFPLPRLLYAMASDGLIFTFLARIHPRTEIP 358          
BLAST of slc7a-3 vs. Ensembl Nematostella
Match: EDO41863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2Z0])

HSP 1 Score: 182.57 bits (462), Expect = 6.010e-50
Identity = 130/430 (30.23%), Postives = 217/430 (50.47%), Query Frame = 2
Query:  170 RRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAV-KNFTDKYLPLSKSSDVWESSA-----DVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKLPMRINTNSMICTR 1441
            RR       +ET L+RCL+   L   G+  M+GAG+Y+ TG I +   G A  +S L   +    + LCY EF + I K GS YTYTY  MGE+ AFIVGW +IL++I++ A +    S  +N +    + K FTD           W+ +      D +AFA++     +   GAN S     V   I +  +  +++    +   +N+ + G + P+GF  I  GA  + FAY GF+ L  ++EE  NP+ SIP A  +S  + I +Y+L +  L+ M+P  Q+  +     AF++      K+   +  + A   + LA  +  PR++Y M+ DGL+ KF  KI   +++P+  VL     ++ +++F+    L ++ S+G +L++I I I +++ R+   E  E+   + +       T    C R
Sbjct:   12 RRKTKDIFHVETILHRCLNALDLTLLGVGSMLGAGLYIATGEIARSTAGPAIVISLLIGAIPVCLSSLCYAEFGSRISKTGSSYTYTYFAMGEIWAFIVGWNLILENIIAAALLGHESSRFLNSISGGRIYKFFTDNI-------SNWQITGLLPFPDFVAFAIVMIFTTLASFGANRSAGFIRVAMLINVFVVVFVVLSGVYFVDTKNW-TKGNFAPYGFYGIMSGAASSYFAYLGFDTLNTASEEAINPKHSIPKACNISTYLGIAMYLLTAGILTLMIPYKQLSPEIALPQAFADEGFPIGKYFVAVGGMSAMALSLLAYLFSGPRILYAMSRDGLMIKFFNKISYATQVPVRGVLFCGLTAASVSLFVNTSNLVEMLSIGTMLAYIAIAISVLLERHKPAEPREHEFLSRKTSTASNATEEPSCWR 433          
BLAST of slc7a-3 vs. Ensembl Nematostella
Match: EDO40886 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Y4])

HSP 1 Score: 173.326 bits (438), Expect = 1.555e-49
Identity = 94/272 (34.56%), Postives = 164/272 (60.29%), Query Frame = 2
Query:  128 MSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLG 943
            M+ +  S L +++R++ F      +T+L+RCLS   L   GI+  +GAGIYVL G + K+  G    LSFL +G+ S+ + LCY EF + +P+AGS Y Y+Y+ +GE  AF+VGW MIL+ ++  +S+++G +  ++ L N  ++ ++ K++  S ++ +     D LAFA+   + +    GA ++   N V++ I LI ++ I +    +   +N+     +LP+GF  +  GA    F++ GF+C+A SAEE KNP K +P+A+ +++G
Sbjct:    1 MAELTKSALTTMSRKKIFVAKDYTKTELSRCLSKIDLAGLGIASTLGAGIYVLAGIVAKNIAGPGLVLSFLIAGIASLMSALCYAEFGSRVPRAGSAYVYSYVAIGEFCAFVVGWNMILEYLIGASSLARGCTEYLDALFNGQIREYSLKHIG-SMNAPLIAQYPDFLAFAIALIVTIPLALGAAMTTRTNNVITAINLIVITFITLVGLSFADRKNW---NNFLPYGFSGVVAGAATCFFSFVGFDCIATSAEEAKNPTKDVPIAILITIG 268          
BLAST of slc7a-3 vs. Ensembl Nematostella
Match: EDO40406 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7D5])

HSP 1 Score: 147.902 bits (372), Expect = 6.000e-38
Identity = 113/416 (27.16%), Postives = 214/416 (51.44%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNIS---MNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNEN 1378
            + SF+  + RR+S   +   E+ L RC+    L   G+  M+ AGIYV+ G +     G +  +SFL + + ++  GL Y E S+ I K GS Y +TY+ +GE+  F VGW+M+ + IV+ AS++K  S  +N L   AV ++  + +     ++      D++A AL+    +I   G   S   M+I ++++   ++F    I+   V+   + + +   + P G   I        +  SGF+ +  ++EE   P +++P A+ + L I    Y+  SS ++ MVP   ID  +P   AFS R      ++  I    A  A+ LA +Y   R++Y+++ DGLI  FL KI++  ++P+ +V+     + L ++   ++ L ++ ++  I ++ ++ + +++ R+  D   +N
Sbjct:    1 MSSFISGLLRRKS-QGTWFQESGLARCMDLFDLTVLGLGGMLDAGIYVVIGQL-AIVAGPSVIVSFLVATVAALLAGLSYAELSSRITKTGSAYVFTYVTLGEVLGFFVGWSMLAEYIVNAASMAKACSLYINSLSGGAVYSYLAENISWGARNNYVGHFPDLVALALVLCSVVIIGLGVRESKTLMDIIMIMNGTVILFS---IVSGVVFADTKLWSTPQKFAPKGLDGIILAIPQCFYCLSGFDTIPTASEEALEPSRTVPKAIVLCLVITSCAYLGISSIITLMVPYTAIDYHSPLAEAFSTRGFPPGYYVVSIGATAAIFASLLASYYAASRLLYSLSYDGLICMFLNKINKSRQVPLNSVIAVGVITGLSSLVFNMRELVELVAVATICTYTSVSVCVLVSRFQADYTTKN 411          
BLAST of slc7a-3 vs. Ensembl Nematostella
Match: EDO40551 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S703])

HSP 1 Score: 77.0258 bits (188), Expect = 7.958e-15
Identity = 90/366 (24.59%), Postives = 166/366 (45.36%), Query Frame = 2
Query:  260 MIGAGIYVLTGHIIKDRVGSATNLSFLF---SGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMIL-DSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCF--VYGSHQNFVSDGGYLPFGFGSIFQGA-GIA----IFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFIT 1324
            MIG+GI++    +++ + GS   LS +     GL+++F  LCYCE  T+IPK+G+ Y+Y     G LPAF+  WT+ L     SLA VS  F+           +  T  + P  + S +  S   +LA   L     I       +  I    +  +LI +++++I     +      ++ D    PF   +    A G+A    ++AY G+  L    EE KNP + +P AL + + ++ + Y+L +     +V R  I           +  L  + WI  I    +T      + +   R++Y  A +G + + L  I  + + P+ +++    F + +A+   I ++ D +  G ++++ +
Sbjct:   52 MIGSGIFISPKGVLQ-QTGS-VGLSLVVWAGCGLLALFGSLCYCEMGTMIPKSGAEYSYLKDAFGPLPAFLYSWTLALIIRPSSLAIVSLTFA-----------RYVTQPFFPNCEISPL--SVRKILAACCLALTLFINCASVRWATRIQDSFTLGKLIAIAILVILGIITIAKGQVEYLED----PFEKSTPNPAAIGLAFYSGLWAYDGWNALNFVTEEMKNPARDLPRALIIGIPLVTICYLLTNIAYIAVVGREGILSSGAVAMTVGDMYLGPMSWIIPIFVACSTFGCVNGLLFSGARLVYVSARNGHMPRLLAMIHNKCQTPMPSII----FMNTIAL---IMLIPDASEFGTLVNYFS 391          
BLAST of slc7a-3 vs. Ensembl Medaka
Match: SLC7A1 (high affinity cationic amino acid transporter 1 [Source:NCBI gene;Acc:101172427])

HSP 1 Score: 246.899 bits (629), Expect = 1.443e-72
Identity = 174/587 (29.64%), Postives = 289/587 (49.23%), Query Frame = 2
Query:  200 ETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF--------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVG---------LFFSSLL---------AIFIKIQVLADITSMGIILSFITIGIDLII-------LRYIFD-ENNENTIDNSQK----LPMRINTNSMICTRXXXXXXXXXXXXXXXXTGVSILFILPISQITGXXXXXXXXXXXXXXXXXXXXYEP-TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKT 1807
            E++L+RCL T  L+  G+   +GAG+YVL G + ++  G A  LSFL + L S+  GLCY EF   +P+ GS Y Y+Y+ +GEL AFI GW +IL  ++  +SV++ +S   + L N  +K F+ +YLP++          D+ A  ++ +L  + + G   S  +N V + I ++ L  +II  FV G  +N+                    +  GG++PFG+  +  GA    +A+ GF+C+A + EE KNP+++IP+ +  SL I  + Y   S+ L+ M+P   + + +P   AF         +   I +L A   + L   + +PR+I+ MA DGL+F FL  + ER K P  + LV          +FF SLL         A    +  L ++ S+G +L++  +   +++       LR  ++    ++  D S+     LP   +  ++       K         ++    SIL + P S     +     I         I   +P +  K  FK PL+P  P+I++ +N+ L+M L   TW+RF +  V+G +IYF YGI NS  +E A  ++
Sbjct:   21 ESRLSRCLGTFDLVALGVGSTLGAGVYVLAGAVARENSGPAIVLSFLIAALASVLAGLCYAEFGARVPRTGSAYLYSYVTVGELWAFITGWNLILSYVIGTSSVARAWSATFDELINGHIKRFSSQYLPMNAPGVA--EYPDIFAVLIILSLTGLLVFGVKESALVNKVFTCINVLVLLFVIIAGFVKGDRKNWSLNPEDILNSTRNSTLNEETIGAGGFMPFGWTGVLSGAATCFYAFVGFDCIATTGEEVKNPQRAIPIGIVASLLICFVAYFGVSAALTMMMPYYMLSKDSPLPVAFEYVGWKGATYAVAIGSLCALSTSLLGSMFPLPRIIFAMARDGLLFSFLAHVSER-KTPTVSTLVAGILAFFSVLMFFPSLLFSACAAAVMAFLFDLTDLVNLMSIGTLLAYTLVAACVLVLRYQPEQLRAAYEMAKTQDEADISESYSDILPQPEDRLTVKNLLFPSKPEPSPQSGLVVNICTSILGLAPWS-----VCLLSTIAATCLVVTFIVWRQPQSKTKLAFKVPLLPFVPVISMFVNVYLMMQLDRGTWIRFAIWMVLGFIIYFTYGIRNS--AEAAANRS 597          
BLAST of slc7a-3 vs. Ensembl Medaka
Match: slc7a3a (cationic amino acid transporter 3 [Source:NCBI gene;Acc:101173804])

HSP 1 Score: 242.276 bits (617), Expect = 8.268e-71
Identity = 147/451 (32.59%), Postives = 234/451 (51.88%), Query Frame = 2
Query:  128 MSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF--------------------------VSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKL 1402
            M+  L  F   + RRR+   S   ET+  RCLST  LI  G+   +GAG+YVL G + +++ G A  L FL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +IL  ++  ASV++ +S   + L    + +F    + +     V     D+ A  L+  L  +   G + S  +N + + I L+ L  +II  FV G+  N+                             GG+ PFGF  +  GA    +A+ GF+C+A ++EE KNP +SIP+ +  SL I    Y   S+ L+ M+P  +++ ++P   AFS       ++I    +L A   + L   + +PR+IY MAEDGL+F+ L K+ ER+K P+ A +V    ++L+A    +  L D+ S+G +L++  + I ++ILRY       N+   ++KL
Sbjct:    1 MASKLSKFGKMLLRRRALDCSGE-ETRFARCLSTLDLIALGVGSTLGAGVYVLAGEVAREKAGPAIVLCFLIAALSSMLAGLCYAEFGARVPKTGSAYLYSYVTVGEIWAFITGWNLILSYVIGTASVARAWSSTFDNLVEQKISSFFKGIMEMKVPGKVLAEYPDLFALILVLLLSGLLAFGVSESALVNKIFTGINLVVLGFVIISGFVKGNTANWNLKEEDYITFINATNSTHKPLNVEKDFGVGGFAPFGFTGVLSGAATCFYAFVGFDCIATTSEEAKNPMRSIPIGIVASLLICFFAYFGVSAALTMMMPYYELNTQSPLPVAFSYVGWGPARYIVAFGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFRALSKMSERTKTPVLATIVSGIVAALMAFLFDLGALVDLMSIGTLLAYSLVAICVLILRY--QPGTLNSSSQTEKL 448          

HSP 2 Score: 63.1586 bits (152), Expect = 5.220e-10
Identity = 32/60 (53.33%), Postives = 40/60 (66.67%), Query Frame = 2
Query: 1622 TFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEE 1801
            TFK PL+P  P+ ++ +NI L+M L  +TWLRF V  VIG  IYF YGI NS  SE A+ 
Sbjct:  555 TFKVPLLPWLPLFSVFVNIYLMMQLDVATWLRFAVWMVIGFAIYFLYGIKNS--SENADR 612          
BLAST of slc7a-3 vs. Ensembl Medaka
Match: slc7a2 (solute carrier family 7 member 2 [Source:NCBI gene;Acc:101165487])

HSP 1 Score: 236.498 bits (602), Expect = 3.341e-69
Identity = 137/421 (32.54%), Postives = 229/421 (54.39%), Query Frame = 2
Query:  146 SFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFV--------------SD---GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYI 1357
            SF  S+ RR+    +   ++KL RCL T  LI  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +IL  ++  +SV++ +SG  + +    ++ F   Y   S +S       D  A  L+  L  +   G   S  +N V +++ ++ L  +II  FV G   N+               SD   GG+LP+GF     GA    +A+ GF+C+A + EE +NP+++IP+ + VSL +  L Y   S+ L+ M+P   +D+K+P   AF        K++  + +L A   + L   + +PR+IY MAEDG++FK L +I+ ++K P+ A +     ++++A    ++ L D+ S+G +L++  + + ++ILR +
Sbjct:    7 SFSRSLVRRKVVDMNNLEDSKLCRCLGTVDLIALGVGSTLGAGVYVLAGEVAKGNSGPSIVISFLIAALASVMAGLCYAEFGARVPKTGSAYLYSYVTVGEIWAFITGWNLILSYVIGTSSVARAWSGTFDEMIGGHIEKFCKTY--FSMNSPGLAPYPDFFAVCLILLLSGLLSFGVKESAWVNKVFTSVNVLVLLFVIISGFVKGDAVNWKISEESLINFTVVTRSDYGVGGFLPYGFSGTLAGAATCFYAFVGFDCIATTGEEVRNPQRAIPIGIVVSLTVCFLAYFGVSAALTLMMPYYLLDEKSPLPMAFEYVGWGPAKYVVAVGSLCALSTSLLGSIFPMPRVIYAMAEDGVVFKALARINPKTKTPVIATMSSGVVAAIMAFLFDLKALVDMMSIGTLLAYSLVAVCVLILRLV 425          

HSP 2 Score: 60.4622 bits (145), Expect = 3.652e-9
Identity = 29/67 (43.28%), Postives = 41/67 (61.19%), Query Frame = 2
Query: 1607 TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKT 1807
            T  K +F  PL+P  PI+++ +NI L++ L G TW+RF V   IG LIYF YG+ +S   +   E T
Sbjct:  493 TSKKVSFMVPLLPFLPILSVFVNIYLMVQLSGDTWIRFSVWMAIGFLIYFGYGMWHSEERQHRTEGT 559          
BLAST of slc7a-3 vs. Ensembl Medaka
Match: ENSORLT00000008841.2 (cationic amino acid transporter 2 [Source:NCBI gene;Acc:101168301])

HSP 1 Score: 236.113 bits (601), Expect = 8.528e-69
Identity = 174/585 (29.74%), Postives = 303/585 (51.79%), Query Frame = 2
Query:  128 MSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDV--WESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQN-FVSD----------------------GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKLPMRINTNSMICTRXXXXXXXXXXXXXXXXTGVSILFILPISQITGXXXXXXXXXXXXXXXXX------------XXXYEPTD-VKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGI 1768
            MS+V  SFL S++RR+   +    ++  NRCL+T  L+  G+   +GAG+YVL+G + +D  G +  +SF  + L SIF GLCY EF + +PK GS Y Y+Y+ +GEL AFI GW ++L  ++  +SV+  +SG  +    D +     KY   + S  +       D  A AL+  L  +   G   S  IN + + I ++ L  + I  F+ G+  N ++S+                      GG+ P+GF     GA    +A+ GF+C+A + EE KNP+KS+PV +  SL I  L Y   S+ L+ M+P   +++K+P   AF        K++  + +L A   + L   + +PR+++ MA DGL+F+ L K+  +   P  A +     ++++A+   ++ L ++ S+G + ++  + I ++ILRY++     ++ D   KL M+ + +     +     +  +     ILT +S +F+L +  I      AI  L   +  ++            +   +P +  K TF  PL+P+ P+++  +N+ L++ L G+TWLR+ +  ++GL+IYF YGI
Sbjct:    1 MSWV-KSFLVSLSRRKPI-EPDGEQSTFNRCLTTLDLVALGVGSTLGAGVYVLSGEVARDTAGPSIIISFFIAALASIFAGLCYAEFGSRVPKTGSAYLYSYVTVGELLAFITGWNLLLSYVIGTSSVALAWSGTFD----DLIGGVISKYFEENASMGLPGLAPYPDFFAAALILLLSGVLAFGVKESTTINKIFTAINILVLLFVTISGFIKGNIDNWYISEEALLNATAEENSTINVTSVFGVGGFFPYGFNGTLAGAATCFYAFVGFDCIATTGEEVKNPQKSVPVGIVASLLICFLAYFAVSAALTLMMPYYMLNEKSPLPVAFEYVGWGPAKYVVAVGSLCALSTSLLGSMFPMPRVLFAMARDGLLFQPLTKVTAKGS-PAIATIASGVVAAIMALLFDLEALVEMMSIGTLFAYTLVAICILILRYVYPFTLGSSED--AKLQMKESESKFNLLKPPSSPTNITSKTVTILTVISAVFVLALCLILTQAIDAIANLEAWSIVLVCVFSLALLVILLLIWRQPQNPTKATFMVPLLPVLPLVSTLINVYLMVQLGGATWLRYAIWMLVGLVIYFGYGI 576          
BLAST of slc7a-3 vs. Ensembl Medaka
Match: slc7a2 (solute carrier family 7 member 2 [Source:NCBI gene;Acc:101165487])

HSP 1 Score: 235.343 bits (599), Expect = 3.486e-68
Identity = 138/429 (32.17%), Postives = 229/429 (53.38%), Query Frame = 2
Query:  146 SFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNF-----------------------VSD---GGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRY 1354
            SF  S+ RR+    +   ++KL RCL T  LI  G+   +GAG+YVL G + K   G +  +SFL + L S+  GLCY EF   +PK GS Y Y+Y+ +GE+ AFI GW +IL  ++  +SV++ +SG  + +    ++ F   Y   S +S       D  A  L+  L  +   G   S  +N V +++ ++ L  +II  FV G   N+                        SD   GG+LP+GF     GA    +A+ GF+C+A + EE +NP+++IP+ + VSL +  L Y   S+ L+ M+P   +D+K+P   AF        K++  + +L A   + L   + +PR+IY MAEDG++FK L +I+ ++K P+ A +     ++++A    ++ L D+ S+G +L++  + + ++ILRY
Sbjct:    7 SFSRSLVRRKVVDMNNLEDSKLCRCLGTVDLIALGVGSTLGAGVYVLAGEVAKGNSGPSIVISFLIAALASVMAGLCYAEFGARVPKTGSAYLYSYVTVGEIWAFITGWNLILSYVIGTSSVARAWSGTFDEMIGGHIEKFCKTY--FSMNSPGLAPYPDFFAVCLILLLSGLLSFGVKESAWVNKVFTSVNVLVLLFVIISGFVKGDAVNWKISEESLINFTVVTRNLSVAANVSSDYGVGGFLPYGFSGTLAGAATCFYAFVGFDCIATTGEEVRNPQRAIPIGIVVSLTVCFLAYFGVSAALTLMMPYYLLDEKSPLPMAFEYVGWGPAKYVVAVGSLCALSTSLLGSIFPMPRVIYAMAEDGVVFKALARINPKTKTPVIATMSSGVVAAIMAFLFDLKALVDMMSIGTLLAYSLVAVCVLILRY 433          

HSP 2 Score: 60.4622 bits (145), Expect = 4.043e-9
Identity = 29/67 (43.28%), Postives = 41/67 (61.19%), Query Frame = 2
Query: 1607 TDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKT 1807
            T  K +F  PL+P  PI+++ +NI L++ L G TW+RF V   IG LIYF YG+ +S   +   E T
Sbjct:  551 TSKKVSFMVPLLPFLPILSVFVNIYLMVQLSGDTWIRFSVWMAIGFLIYFGYGMWHSEERQHRTEGT 617          
BLAST of slc7a-3 vs. Planmine SMEST
Match: SMESG000081300.1 (SMESG000081300.1)

HSP 1 Score: 949.118 bits (2452), Expect = 0.000e+0
Identity = 551/556 (99.10%), Postives = 553/556 (99.46%), Query Frame = 2
Query:   83 MHTVQVGQERSFIFFMSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKLPMRINTNSMICTRXXXXXXXXXXXXXXXXTGVSILFILPISQITGXXXXXXXXXXXXXXXXXXXXYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLI 1750
            MHTVQVGQERSFIFFMS VLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVLAFALLFTLFLITLTGANISMNINLVLSTIQLIFLSVIIIYCF YGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWITGIATLLATGATKLAVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNS+KLPMRINTNSMICTRKFFKISLFSLIISIILTGVSILFILPISQITGIIFSAIFILLILTFTIIISLYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIG +I
Sbjct:    1 MHTVQVGQERSFIFFMSSVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVLAFALLFTLFLITLTGANISMNINLVLSTIQLIFLSVIIIYCFFYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWITGIATLLATGATKLAVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSEKLPMRINTNSMICTRKFFKISLFSLIISIILTGVSILFILPISQITGIIFSAIFILLILTFTIIISLYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGKII 556          
BLAST of slc7a-3 vs. Planmine SMEST
Match: SMESG000081298.1 (SMESG000081298.1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 397/577 (68.80%), Postives = 485/577 (84.06%), Query Frame = 2
Query:  128 MSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDN-SQKLPMRINTNSMICTRXXXXXXXXXXXXXXXXTGVSILFILPISQITGXXXXXXXXXXXXXXXXXXXXYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEEKTXXXXXXXXXXXXXKQE 1855
            +S V   + H+ TR+R  S++KSL+TKL+RCLST QLIFYGISHMIGAGIYVLTGHIIK++VG ATNLSF+ SG +SIFTGLCYCEF+TLIPKAGSCYTYTYLMMGELPAFI+GWTMI+D  +SL+S++KGFSGAVN+L N+AVKNFTD+Y+PL+  S++W++S D++A  LLFTLFL+TLTGANIS+NIN VL+ +QLIFL+ III CFVYG+ QN+ +DGGYLPFG  SIFQGAGI I+AYSGFECL+NSAEETK PRKSIP ALFVSLGI+I+LYVL S+GLSFMVPRLQI++ APFI+AF+ ++L  LKW+TGIATLLATGA+KLA  YVIPRMIY MAEDGL+F+FL K++E SK+P  A++VG+ FS++LA+F++IQ+LA+ITSMGII+SF+ +GIDLIILRY+ +E  EN   N S+ L MR    S +  R  FK     L+ SII  G+SIL + PI  I+GII S   ++ +LT ++++SLY+P   KD F TPLMPLTPIITI LNICLL+NLP  TW+RFLV  + GLLIYFFYGIPNSHLSEKAEEKTELILLDNNNDEILKQE
Sbjct:    2 LSLVKKYYGHA-TRKRVLSKNKSLDTKLHRCLSTYQLIFYGISHMIGAGIYVLTGHIIKEKVGPATNLSFVLSGFVSIFTGLCYCEFATLIPKAGSCYTYTYLMMGELPAFIIGWTMIMDLSISLSSIAKGFSGAVNLLSNNAVKNFTDRYVPLTPDSEIWDTSVDLVALLLLFTLFLLTLTGANISLNINAVLAALQLIFLTTIIISCFVYGNSQNYFADGGYLPFGVASIFQGAGIGIYAYSGFECLSNSAEETKEPRKSIPTALFVSLGIVIVLYVLTSTGLSFMVPRLQINENAPFISAFTGKSLHELKWLTGIATLLATGASKLAAIYVIPRMIYAMAEDGLLFRFLDKVNESSKVPTNALVVGVLFSTILAMFVRIQILAEITSMGIIISFMIVGIDLIILRYLHNEELENIESNESKNLEMRFTIFSGLANRTCFKGIFICLLFSIIFMGLSILLLYPIHYISGIICSVFCLITLLTMSLLLSLYKPLLTKDAFATPLMPLTPIITITLNICLLINLPLETWIRFLVWILFGLLIYFFYGIPNSHLSEKAEEKTELILLDNNNDEILKQE 577          
BLAST of slc7a-3 vs. Planmine SMEST
Match: SMESG000081293.1 (SMESG000081293.1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 311/546 (56.96%), Postives = 413/546 (75.64%), Query Frame = 2
Query:  167 RRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLPLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQ-KLPMRINTNSMICTRXXXXXXXXXXXXXXXXTGVSILFILPISQITGXXXXXXXXXXXXXXXXXXXXYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEKAEE 1801
            R++SFSQ ++L+T L+RCLST QL FYGIS MIG GIY+LTG IIKD+VG  TNLSFL SG ISIFTGLCYCEFSTLIPKAGS YTYTYLMMGELPAFI+GWT++++ I++LA V+KGFS A+N + N  + N+T K+LPLSK S +W+SS D++A  L+  LF  +LTG +ISMN+N VL+  Q++FL  III CFVYGS+QN++ DGGYLPFGF S+F+GAG+ IF Y+GFE LAN AEETK+P+KSIP A+  SL +I++LY L S+GL ++VPR QID  +PFI AF  +NL  +KW+T I T+LA  ATK  V Y+IPR IY MA DGL+F+FL  I+++SKIPI A++ G+ FS  L +FIKI++LAD+T++GII+SFIT+GI+L+ILRY+ + + E ++  S   + MR+N+ + +  +  FK  L   IIS IL G S L+I P  QI GI+     +++IL   II+SLYEP   K+ F TPLMPL P+ITI LNI ++++ P  TW+R+L+    GL++Y F+G  NS L+EK EE
Sbjct:   14 RKQSFSQLQTLDTNLDRCLSTYQLTFYGISRMIGVGIYILTGIIIKDKVGPGTNLSFLLSGFISIFTGLCYCEFSTLIPKAGSSYTYTYLMMGELPAFIIGWTVLMNYIIALAGVAKGFSAAINSIVNGTIGNWTLKHLPLSKDSTIWDSSIDIVAVLLILLLFSFSLTGISISMNVNCVLAISQILFLMTIIIACFVYGSNQNYLDDGGYLPFGFLSVFKGAGLVIFTYAGFESLANIAEETKDPKKSIPTAMLTSLSLIVILYFLISTGLPYLVPRHQIDASSPFITAFMEKNLVLMKWVTIIGTILAIAATKFTVIYIIPRAIYAMANDGLLFRFLANINKKSKIPISALITGILFSCTLTMFIKIEILADVTTIGIIISFITVGINLLILRYLHETDTEKSLMESNVPMEMRVNSCAFLANQNIFKAVLSCFIISNILFGFSFLYIYPTFQIFGIVVCTFSLMVILLMMIILSLYEPHCFKEGFTTPLMPLAPVITIILNISIIVHFPIGTWIRYLICLSFGLILYIFHGFSNSELAEKVEE 559          
BLAST of slc7a-3 vs. Planmine SMEST
Match: SMESG000033534.1 (SMESG000033534.1)

HSP 1 Score: 196.823 bits (499), Expect = 1.698e-54
Identity = 123/415 (29.64%), Postives = 220/415 (53.01%), Query Frame = 2
Query:  146 SFLHSITRRRSFSQ--SKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKA-GSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYL---PLSKSSDVWESSADVXXXXXXXXXXXXXXXXXNISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDENN 1372
            S  +++ RR+  +    +S  + L +CL+T  L   GI  ++GAGIYV+ G +  +  G +  LS   + + S+ +GLCY EF + +P+  GS Y+Y+Y  +GE  AFI+GW +IL+ ++  A+ ++  S A++ L +  + NFT+  +   PL+ +        D+L F L  ++ +I   G   S       + +       II+         N+ S   + P G   +  GA    +AY GF+ +A + EE ++P KSIP A+ ++L +    Y   ++ L+ MVP   +   +P   AF  R L   KWI G+  +    A+ +   + +PR+IY MA DGL+FKFL ++  R+++PI+A L+  F ++   +   +  L ++ S+G +L++  +   +++LRY   E++
Sbjct:   13 SLRYTLFRRKHITNLNRESSTSDLAKCLTTFDLTNLGIGSILGAGIYVVVGQVSTNIAGPSVTLSLFIAAVTSLLSGLCYAEFGSRVPRTTGSAYSYSYHTVGEFIAFIIGWNLILEYMIGTAADARALSSAIDYLLDHKLSNFTETQIGRVPLTNAL------PDLLGFILTISVTMILAAGVKESARYTTFFNFLTAAVAIFIIVAGAAESKLSNWNSKKKFFPKGVHGVLSGAATCFYAYVGFDVIATTGEEARSPSKSIPKAMSLTLLVCFTFYFGVATVLTMMVPFGNLKTSSPITEAFDLRGLHWAKWIVGLGGVAGMSASLMGSEFPLPRIIYAMASDGLLFKFLSQVWNRTEVPIFATLIPGFLTAFFTMLFDLGELVEMMSIGTLLAYSLVCTSVLLLRYTPREDD 421          
BLAST of slc7a-3 vs. Planmine SMEST
Match: SMESG000031905.1 (SMESG000031905.1)

HSP 1 Score: 170.244 bits (430), Expect = 3.698e-45
Identity = 123/439 (28.02%), Postives = 217/439 (49.43%), Query Frame = 2
Query:  140 LHSFLHSITRRRSFSQSKSLETKLNRCLSTSQLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYCEFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGAVNILCNDAVKNFTDKYLP-----LSKSSDVWESSADVXXXXXXXXXXXXXXXXXNI--SMNINLVLSTIQLIFLSVIIIY-----------CFVYGSHQNFVSDGGYLPFGFGSIFQGAGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGLSFMVPRLQIDQKAPFIAAFSNRNLFALKWXXXXXXXXXXXXXXXXVFYVIPRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVLADITSMGIILSFITIGIDLIILRYIFDE-NNENTIDNSQK 1399
            +  F     R++++      ++ L RCL+T  L   GI   +GAG+YV+ G + K+  G +  +SFL + + SIF GLCY EF   +P+ GS Y Y+Y+ +GEL AFI+GW +IL+ ++  ASV++ +S   + +    +K+F +  +P     L+   D++     V+  ++L      +    NI   +N++++L  I   F +V I               +Y  H   +  G + PFG   +  GAG   +A+ GF+ +A + EE  NP+K+IP A+   L +  + Y   S+ ++ M P   I++ AP    F     +  K+I GI  L     + L   + +PR+IY M+ D                 +     GL  +++ A+F  ++ L D+ S+G +L++  +   +++LR   D  N ++  +N QK
Sbjct:    3 IKRFFMGFFRKKTYIGVDLNKSLLARCLTTLDLTALGIGATLGAGVYVVAGKVAKESAGPSVVVSFLVAAIASIFAGLCYAEFGARVPRTGSAYIYSYVSVGELMAFIIGWNLILEYVIGTASVARAWSSNFDEITGGHIKDFFNSTMPMNLIGLAPYPDLFAFLITVVLTSILCIGVKESSRFNNIFTVLNVSVILYVIICGFWNVDIKNWKIPPKTMSNGTIIYNPH---IGSGYFFPFGISGMLSGAGTCFYAFVGFDSIATTGEEVINPQKAIPFAIIFCLSLCFVAYASISTIITLMCPFYIINEDAPLPFIFDKAGWYVSKYIVGIGALFGLSTSLLGALFPLPRIIYAMSSD-----------------VATAAAGLLAATMSALF-DLKSLVDMMSIGTLLAYTLVAFSILLLRGSVDSINVDSDSENEQK 420          

HSP 2 Score: 57.7658 bits (138), Expect = 1.688e-8
Identity = 26/65 (40.00%), Postives = 41/65 (63.08%), Query Frame = 2
Query: 1601 EPTDVKD-TFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLTVIGLLIYFFYGIPNSHLSEK 1792
            +P + K  +FK P +P  P I+I +N+ L++ LP  TW RF +   +G LIYFFYG+ +S   ++
Sbjct:  503 QPENQKKISFKVPGVPWLPAISILINLYLMLKLPVDTWYRFGIWMAVGFLIYFFYGLSHSKEGKR 567          
The following BLAST results are available for this feature:
BLAST of slc7a-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A18.641e-7232.80solute carrier family 7 member 1 [Source:HGNC Symb... [more]
SLC7A31.206e-6832.26solute carrier family 7 member 3 [Source:HGNC Symb... [more]
SLC7A31.206e-6832.26solute carrier family 7 member 3 [Source:HGNC Symb... [more]
SLC7A23.725e-6632.01solute carrier family 7 member 2 [Source:HGNC Symb... [more]
SLC7A23.725e-6632.01solute carrier family 7 member 2 [Source:HGNC Symb... [more]
back to top
BLAST of slc7a-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B0454.64.715e-8030.96pep chromosome:WBcel235:II:3032780:3036122:1 gene:... [more]
F23F1.61.764e-7732.98pep chromosome:WBcel235:II:35202:37313:-1 gene:WBG... [more]
C50D2.23.991e-7133.72pep chromosome:WBcel235:II:109165:111429:1 gene:WB... [more]
Y53F4B.121.360e-1223.49pep chromosome:WBcel235:II:15019223:15025768:1 gen... [more]
Y53F4B.121.028e-1022.22pep chromosome:WBcel235:II:15019223:15025768:1 gen... [more]
back to top
BLAST of slc7a-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slif1.591e-7630.04gene:FBgn0037203 transcript:FBtr0078555[more]
slif1.591e-7630.04gene:FBgn0037203 transcript:FBtr0078556[more]
slif1.591e-7630.04gene:FBgn0037203 transcript:FBtr0078557[more]
CG132488.018e-7334.91gene:FBgn0036984 transcript:FBtr0078234[more]
CG55352.782e-6932.48gene:FBgn0036764 transcript:FBtr0075159[more]
back to top
BLAST of slc7a-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a3a1.923e-7333.63solute carrier family 7 member 3a [Source:ZFIN;Acc... [more]
slc7a3b2.334e-7233.49solute carrier family 7 member 3b [Source:ZFIN;Acc... [more]
slc7a3b8.485e-7233.49solute carrier family 7 member 3b [Source:ZFIN;Acc... [more]
slc7a1a7.670e-6830.88solute carrier family 7 member 1a [Source:ZFIN;Acc... [more]
slc7a1a7.670e-6830.88solute carrier family 7 member 1a [Source:ZFIN;Acc... [more]
back to top
BLAST of slc7a-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A14.096e-7032.27solute carrier family 7 (cationic amino acid trans... [more]
SLC7A16.287e-7031.38solute carrier family 7 (cationic amino acid trans... [more]
SLC7A21.511e-6932.27solute carrier family 7 (cationic amino acid trans... [more]
SLC7A17.310e-6930.68solute carrier family 7 (cationic amino acid trans... [more]
SLC7A22.667e-6831.98solute carrier family 7 (cationic amino acid trans... [more]
back to top
BLAST of slc7a-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc7a12.295e-7531.91solute carrier family 7 (cationic amino acid trans... [more]
Slc7a11.515e-7431.91solute carrier family 7 (cationic amino acid trans... [more]
Slc7a31.938e-6733.33solute carrier family 7 (cationic amino acid trans... [more]
Slc7a31.938e-6733.33solute carrier family 7 (cationic amino acid trans... [more]
Slc7a31.938e-6733.33solute carrier family 7 (cationic amino acid trans... [more]
back to top
BLAST of slc7a-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P30823|SL7A1_RAT9.390e-7533.02High affinity cationic amino acid transporter 1 OS... [more]
sp|Q09143|SL7A1_MOUSE1.060e-7331.91High affinity cationic amino acid transporter 1 OS... [more]
sp|P30825|SL7A1_HUMAN4.150e-7132.80High affinity cationic amino acid transporter 1 OS... [more]
sp|Q8WY07|CTR3_HUMAN5.790e-6832.26Cationic amino acid transporter 3 OS=Homo sapiens ... [more]
sp|P70423|CTR3_MOUSE1.355e-6633.33Cationic amino acid transporter 3 OS=Mus musculus ... [more]
back to top
BLAST of slc7a-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF620.000e+0100.00Slc7a-3 OS=Schmidtea mediterranea OX=79327 GN=slc7... [more]
A0A0H3YJ040.000e+056.78Slc7a-5 OS=Schmidtea mediterranea OX=79327 GN=slc7... [more]
A0A1I8GIC52.675e-13742.06AA_permease_C domain-containing protein OS=Macrost... [more]
A0A1I8JIQ33.617e-13742.06AA_permease_C domain-containing protein OS=Macrost... [more]
A0A267FDF92.108e-12941.80AA_permease_C domain-containing protein (Fragment)... [more]
back to top
BLAST of slc7a-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a23.962e-8130.11solute carrier family 7 member 2 [Source:NCBI gene... [more]
slc7a21.631e-7729.79solute carrier family 7 member 2 [Source:NCBI gene... [more]
slc7a3a9.978e-7233.18cationic amino acid transporter 3 [Source:NCBI gen... [more]
slc7a3b8.874e-7132.78cationic amino acid transporter 3-like [Source:NCB... [more]
ENSAMXT00000010113.22.663e-7031.57pep primary_assembly:Astyanax_mexicanus-2.0:1:1194... [more]
back to top
BLAST of slc7a-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000766.19.716e-5929.88pep scaffold:Pmarinus_7.0:GL478727:35765:49900:1 g... [more]
slc7a43.690e-5633.50solute carrier family 7 member 4 [Source:ZFIN;Acc:... [more]
ENSPMAT00000000741.13.212e-2829.27pep scaffold:Pmarinus_7.0:GL501074:1046:17370:1 ge... [more]
ENSPMAT00000001199.18.880e-2641.73pep scaffold:Pmarinus_7.0:GL479551:1043:11089:-1 g... [more]
ENSPMAT00000002665.17.234e-1323.76pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1... [more]
back to top
BLAST of slc7a-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HIP16.493e-1030.91High-affinity histidine permease; also involved in... [more]
TAT15.649e-826.90Amino acid transporter for valine, leucine, isoleu... [more]
BAP22.403e-730.00High-affinity leucine permease; functions as a bra... [more]
BAP37.144e-729.29Amino acid permease; involved in uptake of cystein... [more]
DIP51.414e-626.73Dicarboxylic amino acid permease; mediates high-af... [more]
back to top
BLAST of slc7a-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO408851.549e-5429.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418636.010e-5030.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408861.555e-4934.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404066.000e-3827.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405517.958e-1524.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc7a-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A11.443e-7229.64high affinity cationic amino acid transporter 1 [S... [more]
slc7a3a8.268e-7132.59cationic amino acid transporter 3 [Source:NCBI gen... [more]
slc7a23.341e-6932.54solute carrier family 7 member 2 [Source:NCBI gene... [more]
ENSORLT00000008841.28.528e-6929.74cationic amino acid transporter 2 [Source:NCBI gen... [more]
slc7a23.486e-6832.17solute carrier family 7 member 2 [Source:NCBI gene... [more]
back to top
BLAST of slc7a-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081300.10.000e+099.10SMESG000081300.1[more]
SMESG000081298.10.000e+068.80SMESG000081298.1[more]
SMESG000081293.10.000e+056.96SMESG000081293.1[more]
SMESG000033534.11.698e-5429.64SMESG000033534.1[more]
SMESG000031905.13.698e-4528.02SMESG000031905.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30031328
GenBankAKN21447.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031328 ID=SMED30031328|Name=slc7a-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1937bp
AAATCGATATTAACAAGCCAACTCAACTGCAACACACGCACATTCATCAA
ATTTGCGTGGCCAGAATGAGTGCGTGTGTGTAATGCACACAGTACAAGTT
GGACAAGAAAGATCATTCATTTTTTTCATGTCTTATGTATTGCATTCATT
TCTTCATTCGATAACAAGGAGACGATCGTTTTCTCAAAGCAAATCTCTCG
AAACAAAGCTTAATCGATGCCTTTCCACTTCTCAACTGATTTTCTATGGA
ATATCACATATGATTGGGGCTGGAATATACGTATTAACTGGTCATATTAT
CAAAGACAGAGTTGGATCGGCAACAAATTTGTCGTTTTTATTTAGCGGTC
TCATTTCAATTTTTACCGGATTATGTTACTGTGAATTTTCAACTCTTATT
CCAAAAGCCGGTTCATGTTACACCTACACTTATTTGATGATGGGAGAGTT
GCCAGCATTTATTGTTGGTTGGACAATGATTTTGGATTCAATTGTTAGTT
TAGCAAGTGTTTCCAAAGGTTTCAGTGGAGCTGTGAATATACTGTGTAAC
GATGCCGTAAAGAATTTTACTGATAAATATCTTCCTCTATCTAAAAGCAG
TGATGTCTGGGAATCTTCCGCCGATGTGTTGGCTTTTGCTTTACTATTTA
CACTATTCTTGATAACGTTAACCGGTGCAAATATTTCAATGAACATCAAT
TTAGTATTATCAACAATACAACTTATATTTTTATCTGTTATAATTATTTA
TTGTTTCGTCTACGGTAGTCATCAAAATTTTGTGTCGGATGGAGGATATT
TACCTTTTGGTTTTGGATCCATATTCCAAGGAGCTGGAATAGCGATATTT
GCATATTCTGGCTTTGAATGCTTAGCAAATTCCGCAGAAGAGACAAAGAA
TCCTCGAAAAAGCATTCCTGTAGCACTTTTTGTGTCGTTAGGTATTATTA
TTTTACTATACGTTTTGGCATCGTCAGGTTTGTCTTTTATGGTGCCGCGA
CTGCAGATCGATCAGAAAGCACCTTTTATCGCTGCATTTAGTAATAGAAA
TTTATTTGCTTTAAAATGGATTACCGGAATAGCAACTTTATTGGCAACCG
GTGCAACAAAGCTGGCAGTATTTTATGTAATTCCAAGAATGATTTATACA
ATGGCAGAAGATGGACTTATTTTCAAGTTTCTTGGTAAAATTGATGAAAG
ATCTAAAATACCAATATATGCCGTTCTAGTGGGACTTTTCTTTTCCTCTT
TACTTGCTATTTTTATTAAAATACAAGTTCTTGCAGATATCACATCAATG
GGAATTATTTTGTCTTTCATAACAATAGGAATTGATCTGATCATACTTCG
ATATATTTTCGATGAAAACAATGAAAATACCATAGATAATTCTCAAAAAT
TACCAATGAGAATAAATACAAATTCAATGATTTGCACTAGAAAATTTTTC
AAAATTAGTTTATTTTCATTAATTATTTCTATTATTTTAACGGGGGTATC
AATTTTGTTTATTTTACCAATATCTCAAATTACTGGAATAATCTTTTCAG
CAATTTTTATTTTGCTAATATTAACATTTACAATTATTATTTCTTTATAT
GAACCAACTGATGTAAAAGATACATTTAAGACTCCACTGATGCCATTGAC
ACCAATTATCACAATTTGTCTTAACATATGTCTTTTAATGAATCTTCCGG
GAAGTACATGGTTGAGGTTTTTAGTTTTAACCGTTATTGGATTGCTTATT
TACTTTTTCTATGGAATTCCAAACAGCCATTTATCGGAAAAGGCGGAAGA
GAAAACTGAGTTGATTTTGCTGGATAATAATAATGATGAAATATTAAAAC
AAGAGTGATATACATTTTATTTTTTCGAATAAACATTATGGTGATTAGCT
GATTTATTTTGAATAAAGGATTTTATTTTAAAAAAAA
back to top

protein sequence of SMED30031328-orf-1

>SMED30031328-orf-1 ID=SMED30031328-orf-1|Name=SMED30031328-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=592bp
MHTVQVGQERSFIFFMSYVLHSFLHSITRRRSFSQSKSLETKLNRCLSTS
QLIFYGISHMIGAGIYVLTGHIIKDRVGSATNLSFLFSGLISIFTGLCYC
EFSTLIPKAGSCYTYTYLMMGELPAFIVGWTMILDSIVSLASVSKGFSGA
VNILCNDAVKNFTDKYLPLSKSSDVWESSADVLAFALLFTLFLITLTGAN
ISMNINLVLSTIQLIFLSVIIIYCFVYGSHQNFVSDGGYLPFGFGSIFQG
AGIAIFAYSGFECLANSAEETKNPRKSIPVALFVSLGIIILLYVLASSGL
SFMVPRLQIDQKAPFIAAFSNRNLFALKWITGIATLLATGATKLAVFYVI
PRMIYTMAEDGLIFKFLGKIDERSKIPIYAVLVGLFFSSLLAIFIKIQVL
ADITSMGIILSFITIGIDLIILRYIFDENNENTIDNSQKLPMRINTNSMI
CTRKFFKISLFSLIISIILTGVSILFILPISQITGIIFSAIFILLILTFT
IIISLYEPTDVKDTFKTPLMPLTPIITICLNICLLMNLPGSTWLRFLVLT
VIGLLIYFFYGIPNSHLSEKAEEKTELILLDNNNDEILKQE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0015171amino acid transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0003333amino acid transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR029485CAT_C
IPR002293AA/rel_permease1
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002293Amino acid/polyamine transporter IPIRSFPIRSF006060AA_transportercoord: 441..591
e-value: 0.029
score: 10.0
coord: 29..430
e-value: 1.2E-70
score: 235.6
IPR002293Amino acid/polyamine transporter IPFAMPF13520AA_permease_2coord: 47..499
e-value: 1.2E-40
score: 139.7
IPR029485Cationic amino acid transporter, C-terminalPFAMPF13906AA_permease_Ccoord: 515..565
e-value: 2.1E-16
score: 59.7
NoneNo IPR availableGENE3DG3DSA:1.20.1740.10coord: 41..443
e-value: 3.9E-86
score: 291.5
NoneNo IPR availablePANTHERPTHR43243FAMILY NOT NAMEDcoord: 19..566
NoneNo IPR availableTMHMMTMhelixcoord: 519..538
NoneNo IPR availableTMHMMTMhelixcoord: 543..562
NoneNo IPR availableTMHMMTMhelixcoord: 484..506
NoneNo IPR availableTMHMMTMhelixcoord: 239..261
NoneNo IPR availableTMHMMTMhelixcoord: 207..229
NoneNo IPR availableTMHMMTMhelixcoord: 378..400
NoneNo IPR availableTMHMMTMhelixcoord: 282..304
NoneNo IPR availableTMHMMTMhelixcoord: 83..105
NoneNo IPR availableTMHMMTMhelixcoord: 51..73
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 329..351
NoneNo IPR availableTMHMMTMhelixcoord: 458..480
NoneNo IPR availableTMHMMTMhelixcoord: 112..134
NoneNo IPR availableTMHMMTMhelixcoord: 404..426