WntP-4

Overview
NameWntP-4 (ACJ64867.1)
Smed IDSMED30031321
Length (bp)1259
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WntP-4 (SMED30031321) t-SNE clustered cells

Violin plots show distribution of expression levels for WntP-4 (SMED30031321) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031321

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior region of the whole animalSMED30031321SMESG000049719.1 FJ463752.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WntP-4 vs. Ensembl Human
Match: WNT4 (Wnt family member 4 [Source:HGNC Symbol;Acc:HGNC:12783])

HSP 1 Score: 157.147 bits (396), Expect = 1.266e-43
Identity = 92/302 (30.46%), Postives = 155/302 (51.32%), Query Frame = 3
Query:  162 RLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRL--FQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVIND----PFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            ++C    EV++ +      A+EEC  Q +  RW+C   + L  F ++V + ++EAA++ AI++AG+ + VT+ACS G+L+ C C      +S     Q + C++N+ YG +F++ F+D                  + +R K  S+ +  + L+NN   R  I+  M  +CKC G SG+C  K CW+ +P F ++G ALK K+  A ++             +G   +LV  +    P  +ED L++L PS D+C  +M+ G+ G  GR C   +     C  LCC  GF   +  + E+C+
Sbjct:   55 QMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQG-FQWSGCSDNIAYGVAFSQSFVD------------------VRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRR---------VGSSRALVPRNAQFKPHTDED-LVYLEPSPDFCEQDMRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCS 327          
BLAST of WntP-4 vs. Ensembl Human
Match: WNT2 (Wnt family member 2 [Source:HGNC Symbol;Acc:HGNC:12780])

HSP 1 Score: 145.591 bits (366), Expect = 3.020e-39
Identity = 86/315 (27.30%), Postives = 152/315 (48.25%), Query Frame = 3
Query:   96 KNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTY--CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDIS--LVINDPFIE--EDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGF 1013
            + +  S+  +CD +    S   +LC   P+V+  I+   +    EC  Q + HRW+C   +R   LF +++ + S+E+A++ AI++AG+ + +T+ACS+G++K C C   +   +  +K    +  C++N+DYG  F   F+D                    K +K + A +  + L+NN   R  + + ++ +CKC G SG+CT + CW  + DF K G+                K      + M +D +   V N+ F +  ++ L++   S DYC  + + G  G  GR C   + G  SC  +CC  G+
Sbjct:   31 RATGGSSRVMCDNVPGLVSSQRQLCHRHPDVMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDA-------------------KERKGKDA-RALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGD------------YLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGY 313          
BLAST of WntP-4 vs. Ensembl Human
Match: WNT2B (Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:12781])

HSP 1 Score: 141.354 bits (355), Expect = 1.597e-37
Identity = 88/316 (27.85%), Postives = 146/316 (46.20%), Query Frame = 3
Query:  123 ICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQ-----LTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            ICD I    S   +LC   P+++  +       + EC  Q ++HRW+C   +R   +F +++ + S+EAA++ AI++AG+ + +T+ACS+G+L  C C    +   G + DQ        C++N+ YG  F + F+D                   EKR K   A    + L+NN   R  + + ++ +CKC G SG+CT + CW+ L DF + G+ L+ +Y  A ++              G   +   +        L++   S DYC  +   G  G  GR C   + G   C  +CC  G+   +   V QC
Sbjct:   52 ICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTR---GRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAK-----------------EKRLKDARAL---MNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTD--------LVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQC 336          
BLAST of WntP-4 vs. Ensembl Human
Match: WNT16 (Wnt family member 16 [Source:HGNC Symbol;Acc:HGNC:16267])

HSP 1 Score: 140.584 bits (353), Expect = 2.074e-37
Identity = 99/316 (31.33%), Postives = 148/316 (46.84%), Query Frame = 3
Query:  147 NSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDC-----------GCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD-QLTYCNENVDYGKSFTEIFLDGPVKLSI----KSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            NS    LC  KP ++  I       ++EC  Q ++ RW+C           G S  LF   +   +KE A++ A+  AG+ + VT++CS G++  C C    Q+    ++      C+++V YG  F+  FLD P+  +     K LL MN                    L+NN   R  + K M   C+C G SG+C  K CWKT+  F KIG  LK+KY N+ ++    K+++R+       I        I +D L+++  S +YC  + KLGI G  GREC   + G   CN LCC  G+       VE+C
Sbjct:   43 NSRQKELCKRKPYLLPSIREGARLGIQECGSQFRHERWNCMITAAATTAPMGASP-LFGYELSSGTKETAFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMN--------------------LHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIP-------IHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERC 330          
BLAST of WntP-4 vs. Ensembl Human
Match: WNT7B (Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:12787])

HSP 1 Score: 140.198 bits (352), Expect = 2.677e-37
Identity = 100/351 (28.49%), Postives = 158/351 (45.01%), Query Frame = 3
Query:    6 IIFIFMISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGC--SNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD-QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            I ++F+   +  + LG     L  +  L      N  P +  R R        +C  +P+ I +I       + EC  Q ++ RW+C       +F Q +   S+EAA+  AIT AG+ + VT ACS+G+L  C C  ++Q      +  +   C+ +V YG  F+  F+D                   E +K +R      + L+NN   R V+   M+ +CKC G SG+CT+K CW TLP F ++G  LK KY  A ++  +   R+R+   +          P   E  L+++  S +YC  +   G  G  GR C   + G   C+ +CC  G+   +   V QCN
Sbjct:    9 IFYVFLCFGVLYVKLGA----LSSVVALGANIICNKIPGLAPRQR-------AICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDA-----------------REIKKNARR----LMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM--ETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCN 325          
BLAST of WntP-4 vs. Ensembl Celegans
Match: cwn-1 (pep chromosome:WBcel235:II:130983:133598:-1 gene:WBGene00000857.1 transcript:K10B4.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-1)

HSP 1 Score: 131.339 bits (329), Expect = 2.858e-34
Identity = 83/304 (27.30%), Postives = 158/304 (51.97%), Query Frame = 3
Query:  162 RLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVE-----KYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEED---QLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            R C +  +++  +   + AA  EC  Q    RW+C   + +  +++      + ++E+A+++AI++A + Y VT+ C+RG  + C C   + D SG ++ Q   C++NV +G   ++ F+D   +  +  +++ +  T +    +  +     + L+NN   R V+ KS+  +CKC G SG+C  + CW +LP+F  IG A+K+K+  A ++  + +  I       E   +V+ +   +      L+++ PS D+C  +   GI G  GR+C    +    C+ LCC  G+ K  ++V E+CN
Sbjct:   54 RFCKKNIDLMESVRSGSLAAHAECQFQFHKRRWNCTLIDPVTHEVIPDVFLYENTRESAFVHAISSAAVAYKVTRDCARGISERCGCDYSKNDHSGKSQFQYQGCSDNVKFGIGVSKEFVDSAQRRVL--MMKDDNGTSLLGPSQLSADGMHMINLHNNQAGRQVLEKSLRRECKCHGMSGSCEMRTCWDSLPNFRHIGMAIKDKFDGAAEVKVVKEDGI-------EKPRIVMKNSQFKRHTNADLVYMTPSPDFCESDPLRGILGTKGRQCTLAPNAIDDCSLLCCGRGYEKKVQIVEEKCN 348          
BLAST of WntP-4 vs. Ensembl Celegans
Match: cwn-2 (pep chromosome:WBcel235:IV:10067824:10070251:1 gene:WBGene00000858.1 transcript:W01B6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-2)

HSP 1 Score: 125.561 bits (314), Expect = 3.304e-32
Identity = 82/299 (27.42%), Postives = 140/299 (46.82%), Query Frame = 3
Query:  159 SRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGC--SNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            +++C    + +  +++    A++EC +Q   HRW+C    S  +   I +  ++EAA+  AI +AG+T+ + + C +G L  C CS + +  +         C +NV+YG  F+  F+D              I+ K    K++    +  +   NN   R ++ +  + KCKC G SGAC  K CW  LP   ++G+ L+NKY  A ++    +     NL +  D +            L+F+  S DYC  +   G  G  GR C+  + G   C++LCC  G+    + V  +CN
Sbjct:   56 AQVCELFKDHMPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTGMLGPIHKMATREAAFTYAILSAGVTHEIGRRCKQGLLTSCGCSDETKPKNVPTDWSWGGCGDNVEYGYKFSRDFID--------------IREKEHDPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMKTCWMQLPSMEQVGKILRNKYDKAIRVQINDRG----NLQLLADEATKERKTRALPTDLVFMDDSPDYCRFDRHSGTLGTEGRVCKRGSGGAEGCDSLCCGRGYNTYTQEVKSKCN 336          
BLAST of WntP-4 vs. Ensembl Celegans
Match: egl-20 (Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05])

HSP 1 Score: 123.635 bits (309), Expect = 2.591e-31
Identity = 88/328 (26.83%), Postives = 149/328 (45.43%), Query Frame = 3
Query:  123 ICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRL-------FQQIVEK----YSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSA-------DQQDLSGMNKDQLTY--CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            +C R+   N     LC+E P  I  +A     A+ EC  + K+ RW+C   + +       FQ I+ K     +KEAA+LNAI  A I + +TK C+ G+L  C C +         +    M++DQ ++  C++NV +G  + + FLD             + +T    + K+ +     +  +NN V R  I +++  +C+C G SG+C  K CW  +  FS++ +               + ++  K L   E     I    +  +++ ++  S  YC  N+  GI G +GREC   +    SC+ LCC  G+    ++   QC
Sbjct:   63 LCRRLDGLNPNQQALCAENPFSIPFVARGVREAIRECENKFKFERWNCSSRDEVTETRHGKFQDILGKTLRSANKEAAFLNAIMAASIVHSITKGCNTGNLTECGCDSKPGMQRYQAESDPSMSRDQFSWGGCSDNVPHGIRYAKKFLD-------------DWETAQFDKTKNVAHL---VRRHNNFVGREAIAQNIRRQCRCHGVSGSCEFKTCWLQMQKFSQVSD---LLKKRYDHFAVQVTRKATKRLRRKERTERKIP---LRGNEMAYVHRSPSYCEKNLTAGILGTSGRECIHNSYSSESCDLLCCGRGYNTRLEIRQTQC 368          
BLAST of WntP-4 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355988:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 109.383 bits (272), Expect = 2.108e-26
Identity = 81/333 (24.32%), Postives = 149/333 (44.74%), Query Frame = 3
Query:  105 SNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCS-NRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQ----------LTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDF----SKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVIN-DPFIEE--DQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            S S+P +C  +        R+C E P +I  +     +AL  C    +   W+C  +   +    ++  S+E+AY+ AI+ AG+++ + +ACS+G +  C C    Q    +   Q             C++NV +G +F   F+D           + + +   E R +        + L+NN V R +++ +M  +CKC G SG+C +K CWK +P F    S++ +  +   L      ++  +      S G       N D   ++  ++L++L  S +YC  ++K        REC +      +C N+CC  G+   +++V E C+
Sbjct:   38 SGSSPILCKNVPGLTPQQKRMCHENPNIIKYLISGLRSALHTCEYTFQREAWNCTLTLPGVGTSPLQIASRESAYVYAISAAGVSHSLARACSKGLIDDCGCGETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVD-----------QYDRQHATEPRSQ--------MNLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWKVMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMRNELIYLDASPNYCAIDVK-------DRECGE------NCPNICCGRGWRTTREIVDEPCH 338          
BLAST of WntP-4 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355953:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 109.383 bits (272), Expect = 2.108e-26
Identity = 81/333 (24.32%), Postives = 149/333 (44.74%), Query Frame = 3
Query:  105 SNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCS-NRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQ----------LTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDF----SKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVIN-DPFIEE--DQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            S S+P +C  +        R+C E P +I  +     +AL  C    +   W+C  +   +    ++  S+E+AY+ AI+ AG+++ + +ACS+G +  C C    Q    +   Q             C++NV +G +F   F+D           + + +   E R +        + L+NN V R +++ +M  +CKC G SG+C +K CWK +P F    S++ +  +   L      ++  +      S G       N D   ++  ++L++L  S +YC  ++K        REC +      +C N+CC  G+   +++V E C+
Sbjct:   38 SGSSPILCKNVPGLTPQQKRMCHENPNIIKYLISGLRSALHTCEYTFQREAWNCTLTLPGVGTSPLQIASRESAYVYAISAAGVSHSLARACSKGLIDDCGCGETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVD-----------QYDRQHATEPRSQ--------MNLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWKVMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMRNELIYLDASPNYCAIDVK-------DRECGE------NCPNICCGRGWRTTREIVDEPCH 338          
BLAST of WntP-4 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0088512)

HSP 1 Score: 118.627 bits (296), Expect = 1.006e-29
Identity = 90/318 (28.30%), Postives = 142/318 (44.65%), Query Frame = 3
Query:  102 SSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCG--CSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQ--DLSGMNKDQ---LTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIG-------EXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGF 1013
            SS ++  +C RI         +C E P+ +  +        +EC  Q + HRW+C       +F  ++   S+EAAY  AI +AG  Y VT AC+RG++  C C    +     G   D+      C+ +VD+G  +   F+D                   E  + SR+     + L+NN   R ++ K + T CKC G SG+C  K CWK+LP F  +G       +  K       K    L    +K+         V++ P  +  +L++L  S +YC  +++ G +G +GR C+    GP SC+ LCC  G 
Sbjct:   22 SSFTSVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDA-----------------RELERDSRT----LMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWP--KRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGH 316          
BLAST of WntP-4 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0339383)

HSP 1 Score: 116.316 bits (290), Expect = 4.712e-29
Identity = 88/312 (28.21%), Postives = 138/312 (44.23%), Query Frame = 3
Query:  120 FICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCG--CSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQ--DLSGMNKDQ---LTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIG-------EXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGF 1013
             +C RI         +C E P+ +  +        +EC  Q + HRW+C       +F  ++   S+EAAY  AI +AG  Y VT AC+RG++  C C    +     G   D+      C+ +VD+G  +   F+D                   E  + SR+     + L+NN   R ++ K + T CKC G SG+C  K CWK+LP F  +G       +  K       K    L    +K+         V++ P  +  +L++L  S +YC  +++ G +G +GR C+    GP SC+ LCC  G 
Sbjct:    1 MLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDA-----------------RELERDSRT----LMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWP--KRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGH 289          
BLAST of WntP-4 vs. Ensembl Fly
Match: wg (gene:FBgn0284084 transcript:FBtr0079432)

HSP 1 Score: 105.916 bits (263), Expect = 1.609e-24
Identity = 59/211 (27.96%), Postives = 99/211 (46.92%), Query Frame = 3
Query:  162 RLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSN-----RLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQD-----------LSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGE 746
            RL  + P V+  +    + A+ EC  Q +  RW+C   N      LF +IV++  +E +++ AIT+A +T+ + +ACS G ++ C C    Q            ++G+   +   C++N+ +G  F+  F+D   +         N++ KM               L+NN   R  +   M  +CKC G SG+CT K CW  L +F  IG+
Sbjct:   70 RLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVDTGER-------GRNLREKMN--------------LHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGD 259          

HSP 2 Score: 52.373 bits (124), Expect = 5.472e-7
Identity = 21/57 (36.84%), Postives = 36/57 (63.16%), Query Frame = 3
Query:  876 LMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            L++L PS  +C  N++ GI G +GR+C + + G   C  +CC  G+ + + +VVE+C
Sbjct:  387 LVYLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERC 443          
BLAST of WntP-4 vs. Ensembl Fly
Match: Wnt4 (gene:FBgn0010453 transcript:FBtr0334799)

HSP 1 Score: 95.9005 bits (237), Expect = 4.090e-21
Identity = 53/191 (27.75%), Postives = 89/191 (46.60%), Query Frame = 3
Query:  168 CSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLD--GPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFS 734
            C ++  +   ++ A   A   C +Q +Y RW+C    R  + I +K  KE A+++A+T A +T+ + +AC+ G +  C C   + +    +  Q   CN+N+ +GK  T  FLD  G     +  +LR                       +++ V    +   M  KCKC G SG+C+ K CWK + DF+
Sbjct:  253 CRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQDF-QWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILR-----------------------HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFN 419          
BLAST of WntP-4 vs. Ensembl Fly
Match: Wnt4 (gene:FBgn0010453 transcript:FBtr0089291)

HSP 1 Score: 95.9005 bits (237), Expect = 4.090e-21
Identity = 53/191 (27.75%), Postives = 89/191 (46.60%), Query Frame = 3
Query:  168 CSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLD--GPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFS 734
            C ++  +   ++ A   A   C +Q +Y RW+C    R  + I +K  KE A+++A+T A +T+ + +AC+ G +  C C   + +    +  Q   CN+N+ +GK  T  FLD  G     +  +LR                       +++ V    +   M  KCKC G SG+C+ K CWK + DF+
Sbjct:  253 CRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSIETRGKRNIFKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREAQDF-QWGGCNDNLKHGKRVTRSFLDLRGGDGDEVSEILR-----------------------HDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFN 419          
BLAST of WntP-4 vs. Ensembl Zebrafish
Match: wnt4b (wingless-type MMTV integration site family, member 4b [Source:ZFIN;Acc:ZDB-GENE-000411-1])

HSP 1 Score: 155.992 bits (393), Expect = 2.621e-43
Identity = 97/339 (28.61%), Postives = 175/339 (51.62%), Query Frame = 3
Query:   63 TNLHRIAILSQ-KNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD--QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEED---QLMFLRPSFDYCFPNMKLGIKGVNGRECEDVAS-GPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            TN   +A LS+ +  S + P  C R+R  +     +C  + EV+  +  A+   +EEC  Q +  RW+C  + R   +F +++ + ++EAA+++A+++A +   VT+ CSRG+L+ C C    + + G++ +  Q + C++N+ YG +F++ F+D P                  +R K  S+ +  + ++NN   R  I+ +M+ +CKC G SG+C  + CWK +P F ++G  LK ++  A ++             +G   +L+  DP ++      L++L PS D+C  +   GI G  GR C   +   P  C  LCC  GF   +  VV++C+
Sbjct:   27 TNWLSLARLSRSRPVSGAEP--CGRLRGLSPGQVGVCRARGEVMESVRKASEMVIEECQHQFRNRRWNCSTTPRGINVFGRVMNQGTREAAFVHALSSAAVAVAVTRGCSRGELERCGC---DRKVRGVSPEGFQWSGCSDNLSYGVAFSQTFVDEP------------------ERAKGMSSGRPLMNIHNNEAGRKAILHNMQVECKCHGVSGSCELRTCWKVMPPFRRVGAVLKERFDGATEVRLTR---------VGSRTALLPRDPQVKPPATRDLVYLAPSPDFCRLDPDNGIPGTAGRRCNGTSRLAPDGCELLCCGPGFRAGRAEVVQRCS 333          
BLAST of WntP-4 vs. Ensembl Zebrafish
Match: wnt4b (wingless-type MMTV integration site family, member 4b [Source:ZFIN;Acc:ZDB-GENE-000411-1])

HSP 1 Score: 155.992 bits (393), Expect = 2.621e-43
Identity = 97/339 (28.61%), Postives = 175/339 (51.62%), Query Frame = 3
Query:   63 TNLHRIAILSQ-KNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD--QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEED---QLMFLRPSFDYCFPNMKLGIKGVNGRECEDVAS-GPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            TN   +A LS+ +  S + P  C R+R  +     +C  + EV+  +  A+   +EEC  Q +  RW+C  + R   +F +++ + ++EAA+++A+++A +   VT+ CSRG+L+ C C    + + G++ +  Q + C++N+ YG +F++ F+D P                  +R K  S+ +  + ++NN   R  I+ +M+ +CKC G SG+C  + CWK +P F ++G  LK ++  A ++             +G   +L+  DP ++      L++L PS D+C  +   GI G  GR C   +   P  C  LCC  GF   +  VV++C+
Sbjct:   27 TNWLSLARLSRSRPVSGAEP--CGRLRGLSPGQVGVCRARGEVMESVRKASEMVIEECQHQFRNRRWNCSTTPRGINVFGRVMNQGTREAAFVHALSSAAVAVAVTRGCSRGELERCGC---DRKVRGVSPEGFQWSGCSDNLSYGVAFSQTFVDEP------------------ERAKGMSSGRPLMNIHNNEAGRKAILHNMQVECKCHGVSGSCELRTCWKVMPPFRRVGAVLKERFDGATEVRLTR---------VGSRTALLPRDPQVKPPATRDLVYLAPSPDFCRLDPDNGIPGTAGRRCNGTSRLAPDGCELLCCGPGFRAGRAEVVQRCS 333          
BLAST of WntP-4 vs. Ensembl Zebrafish
Match: wnt4b (wingless-type MMTV integration site family, member 4b [Source:ZFIN;Acc:ZDB-GENE-000411-1])

HSP 1 Score: 155.992 bits (393), Expect = 2.621e-43
Identity = 97/339 (28.61%), Postives = 175/339 (51.62%), Query Frame = 3
Query:   63 TNLHRIAILSQ-KNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD--QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEED---QLMFLRPSFDYCFPNMKLGIKGVNGRECEDVAS-GPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            TN   +A LS+ +  S + P  C R+R  +     +C  + EV+  +  A+   +EEC  Q +  RW+C  + R   +F +++ + ++EAA+++A+++A +   VT+ CSRG+L+ C C    + + G++ +  Q + C++N+ YG +F++ F+D P                  +R K  S+ +  + ++NN   R  I+ +M+ +CKC G SG+C  + CWK +P F ++G  LK ++  A ++             +G   +L+  DP ++      L++L PS D+C  +   GI G  GR C   +   P  C  LCC  GF   +  VV++C+
Sbjct:   27 TNWLSLARLSRSRPVSGAEP--CGRLRGLSPGQVGVCRARGEVMESVRKASEMVIEECQHQFRNRRWNCSTTPRGINVFGRVMNQGTREAAFVHALSSAAVAVAVTRGCSRGELERCGC---DRKVRGVSPEGFQWSGCSDNLSYGVAFSQTFVDEP------------------ERAKGMSSGRPLMNIHNNEAGRKAILHNMQVECKCHGVSGSCELRTCWKVMPPFRRVGAVLKERFDGATEVRLTR---------VGSRTALLPRDPQVKPPATRDLVYLAPSPDFCRLDPDNGIPGTAGRRCNGTSRLAPDGCELLCCGPGFRAGRAEVVQRCS 333          
BLAST of WntP-4 vs. Ensembl Zebrafish
Match: wnt4b (wingless-type MMTV integration site family, member 4b [Source:ZFIN;Acc:ZDB-GENE-000411-1])

HSP 1 Score: 155.992 bits (393), Expect = 2.621e-43
Identity = 97/339 (28.61%), Postives = 175/339 (51.62%), Query Frame = 3
Query:   63 TNLHRIAILSQ-KNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD--QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEED---QLMFLRPSFDYCFPNMKLGIKGVNGRECEDVAS-GPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            TN   +A LS+ +  S + P  C R+R  +     +C  + EV+  +  A+   +EEC  Q +  RW+C  + R   +F +++ + ++EAA+++A+++A +   VT+ CSRG+L+ C C    + + G++ +  Q + C++N+ YG +F++ F+D P                  +R K  S+ +  + ++NN   R  I+ +M+ +CKC G SG+C  + CWK +P F ++G  LK ++  A ++             +G   +L+  DP ++      L++L PS D+C  +   GI G  GR C   +   P  C  LCC  GF   +  VV++C+
Sbjct:   27 TNWLSLARLSRSRPVSGAEP--CGRLRGLSPGQVGVCRARGEVMESVRKASEMVIEECQHQFRNRRWNCSTTPRGINVFGRVMNQGTREAAFVHALSSAAVAVAVTRGCSRGELERCGC---DRKVRGVSPEGFQWSGCSDNLSYGVAFSQTFVDEP------------------ERAKGMSSGRPLMNIHNNEAGRKAILHNMQVECKCHGVSGSCELRTCWKVMPPFRRVGAVLKERFDGATEVRLTR---------VGSRTALLPRDPQVKPPATRDLVYLAPSPDFCRLDPDNGIPGTAGRRCNGTSRLAPDGCELLCCGPGFRAGRAEVVQRCS 333          
BLAST of WntP-4 vs. Ensembl Zebrafish
Match: wnt6b (wingless-type MMTV integration site family, member 6b [Source:ZFIN;Acc:ZDB-GENE-070912-513])

HSP 1 Score: 155.606 bits (392), Expect = 3.346e-43
Identity = 99/358 (27.65%), Postives = 174/358 (48.60%), Query Frame = 3
Query:    3 IIIFIFMISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQ-----DLSGMN-----KDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            + +F  ++ P+  I L  ++ +     ++   NS      IC + +      + LC  +PE++N +A      + EC  Q ++ RW+C   N+ F +I+++  +E A++ AIT AG+T+ VT+ACS G+L  C C A +       L+ M      K +   C ++V++G   ++ F+D                    +R+K +S  +  ++L+NN   R  +   M T+CKC G SG+CT + CWK +P F ++G+ L  ++  A K+      +    + +G++I      P  ++D L++   S D+C PN K G  G  GR C   A   + C+ LCC  G      ++ E C
Sbjct:   10 LALFFILLCPVNIIGLWWAVGS----PLVMDPNS------ICRKTKRLAGKQAELCQTQPEIVNEVAKGAKLGVRECQYQFRFRRWNCTSQNKYFGKILQQDIRETAFVYAITAAGVTHAVTQACSMGELLQCGCEATRSRGPPPRLASMGPTEGVKWEWGGCGDDVEFGYEKSKQFMDA-------------------RRRKGKSDIRTLIDLHNNEAGRLAVKNYMRTECKCHGLSGSCTLRTCWKKMPHFREVGDRLLERFNGASKVMGGNDGKTL--IPVGQNIK-----PPDKQD-LIYSAESPDFCLPNRKTGSLGTRGRTCNSTALDVSGCDLLCCERGHRDETVVLEENC 330          
BLAST of WntP-4 vs. Ensembl Xenopus
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100491282])

HSP 1 Score: 155.992 bits (393), Expect = 3.707e-43
Identity = 101/349 (28.94%), Postives = 171/349 (49.00%), Query Frame = 3
Query:   57 SITNLHRIAILSQKN------------SSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRL--FQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVIND----PFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            S  +L RI  LS +              S S    C++++       ++C    EV++ +      A+EEC  Q +  RW+C   + L  F ++V + ++EAA++ AI++AG+ + VT+ACS GDL+ C C      +S     Q + C++N+ YG +F++ F+D                  + +R K  S+ +  + L+NN   R  I+ +M  +CKC G SG+C  K CWK +P F K+G  LK K+  A ++ +           +G    LV  +    P  +ED L++L  S D+C  ++K G+ G  GR+C   +     C  +CC  GF   +  ++E+C+
Sbjct:    6 STASLRRIVFLSAQGNLWEYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQGF-QWSGCSDNIAYGVAFSQSFVD------------------VRERSKGGSSSRALMNLHNNDAGRKAILNNMRVECKCHGVSGSCEVKTCWKAMPTFRKVGNVLKEKFDGATEVEQK---------KIGSTKVLVPKNSQFKPHTDED-LVYLDSSPDFCDHDLKNGVLGTTGRQCNKTSKAIDGCELMCCGRGFHTEEVEIIERCS 325          
BLAST of WntP-4 vs. Ensembl Xenopus
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100491282])

HSP 1 Score: 155.606 bits (392), Expect = 4.307e-43
Identity = 99/354 (27.97%), Postives = 176/354 (49.72%), Query Frame = 3
Query:   12 FIFMISPLFKISLGNSI--TNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRL--FQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVIND----PFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
             + MI  +F  +  N +    L  +  +S++ +       C++++       ++C    EV++ +      A+EEC  Q +  RW+C   + L  F ++V + ++EAA++ AI++AG+ + VT+ACS GDL+ C C      +S     Q + C++N+ YG +F++ F+D                  + +R K  S+ +  + L+NN   R  I+ +M  +CKC G SG+C  K CWK +P F K+G  LK K+  A ++ +           +G    LV  +    P  +ED L++L  S D+C  ++K G+ G  GR+C   +     C  +CC  GF   +  ++E+C+
Sbjct:   10 LLMMILAVFSANASNWLYLAKLSSVGSISEEET-------CEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQGF-QWSGCSDNIAYGVAFSQSFVD------------------VRERSKGGSSSRALMNLHNNDAGRKAILNNMRVECKCHGVSGSCEVKTCWKAMPTFRKVGNVLKEKFDGATEVEQK---------KIGSTKVLVPKNSQFKPHTDED-LVYLDSSPDFCDHDLKNGVLGTTGRQCNKTSKAIDGCELMCCGRGFHTEEVEIIERCS 327          
BLAST of WntP-4 vs. Ensembl Xenopus
Match: WNT2 (Wnt family member 2 [Source:NCBI gene;Acc:100038261])

HSP 1 Score: 150.599 bits (379), Expect = 3.178e-41
Identity = 91/322 (28.26%), Postives = 153/322 (47.52%), Query Frame = 3
Query:  108 NSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTY--CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDIS--LVINDPFIE--EDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            N+ P +  R R       +LC   PE++ +I +       EC  Q ++HRW+C    R   LF +++ + S+E+A+++AI++AGI + +T+ACS+G+LK C C   ++  S  +K    +  C++N+DYG  F   F+D                    K +K + A +  + L+NN   R  + + M+ +CKC G SG+CT + CW  + DF K G+                K      + M +D +   V N  F +   + L++   S DYC  +  +G  G  GR C   + G  SC  +CC  G+   +   + +C
Sbjct:   31 NNIPGLVTRQR-------QLCQRYPEIMQVIGLGAVEWTTECQHQFRHHRWNCNIMERDQSLFGKLILRSSRESAFVHAISSAGIVFAITRACSQGELKSCSCDPTKKGSSKDSKGGFDWDGCSDNIDYGIRFARTFVDA-------------------KERKGKDA-RALMNLHNNKAGRKAVKRFMKQECKCHGVSGSCTVRTCWMAMGDFRKSGD------------YLRRKYNGAIQVVMNQDGTGFTVANTRFKKPTNNDLVYFENSPDYCVRDRDVGSLGTAGRICNQTSRGMDSCEVMCCGRGYDTARITKMSKC 313          
BLAST of WntP-4 vs. Ensembl Xenopus
Match: WNT2 (Wnt family member 2 [Source:NCBI gene;Acc:100038261])

HSP 1 Score: 150.599 bits (379), Expect = 5.095e-41
Identity = 91/322 (28.26%), Postives = 153/322 (47.52%), Query Frame = 3
Query:  108 NSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTY--CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDIS--LVINDPFIE--EDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            N+ P +  R R       +LC   PE++ +I +       EC  Q ++HRW+C    R   LF +++ + S+E+A+++AI++AGI + +T+ACS+G+LK C C   ++  S  +K    +  C++N+DYG  F   F+D                    K +K + A +  + L+NN   R  + + M+ +CKC G SG+CT + CW  + DF K G+                K      + M +D +   V N  F +   + L++   S DYC  +  +G  G  GR C   + G  SC  +CC  G+   +   + +C
Sbjct:   45 NNIPGLVTRQR-------QLCQRYPEIMQVIGLGAVEWTTECQHQFRHHRWNCNIMERDQSLFGKLILRSSRESAFVHAISSAGIVFAITRACSQGELKSCSCDPTKKGSSKDSKGGFDWDGCSDNIDYGIRFARTFVDA-------------------KERKGKDA-RALMNLHNNKAGRKAVKRFMKQECKCHGVSGSCTVRTCWMAMGDFRKSGD------------YLRRKYNGAIQVVMNQDGTGFTVANTRFKKPTNNDLVYFENSPDYCVRDRDVGSLGTAGRICNQTSRGMDSCEVMCCGRGYDTARITKMSKC 327          
BLAST of WntP-4 vs. Ensembl Xenopus
Match: WNT2B (Wnt family member 2B [Source:NCBI gene;Acc:100491761])

HSP 1 Score: 147.902 bits (372), Expect = 7.217e-40
Identity = 89/317 (28.08%), Postives = 149/317 (47.00%), Query Frame = 3
Query:  123 ICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTY--CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDIS--LVINDPF--IEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            ICD I    +   +LC + P+++  I       + EC  Q ++HRW+C   +R   +F + + + S+E A++ AI+ AG+ Y +T+ACS+G+LK C C   ++  S   + +  +  C++++D+G  F + F+D                   EKR K   A    + L+NN   R  + + M  +CKC G SG+CT + CW+ + DF K G+                K      ++M +D S   V N  F    +  L++   S DYC  +   G  G  GR C+ V+ G   C  +CC  G+   +   + +C
Sbjct:   72 ICDNIPGLVNKQRQLCQKHPDIMQAIGEGAKEWIRECQHQFRHHRWNCSTLDRDHTVFGRAMLRSSRETAFVYAISYAGVVYALTRACSQGELKSCSCDPKKRGRSKDERGEFDWGGCSDHIDFGIKFAKDFVDAK-----------------EKRLKDARAL---MNLHNNRCGRMAVKRFMNLECKCHGVSGSCTLRTCWRAMSDFRKTGD------------FLRRKYNGAIQVTMNQDGSGFAVANQNFRKATKKDLVYFENSPDYCLMDKTAGSLGTAGRVCDKVSRGTDGCEVMCCGRGYDTTRVTRITKC 356          
BLAST of WntP-4 vs. Ensembl Mouse
Match: Wnt4 (wingless-type MMTV integration site family, member 4 [Source:MGI Symbol;Acc:MGI:98957])

HSP 1 Score: 155.606 bits (392), Expect = 4.101e-43
Identity = 91/302 (30.13%), Postives = 154/302 (50.99%), Query Frame = 3
Query:  162 RLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRL--FQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVIND----PFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            ++C    EV++ +      A+EEC  Q +  RW+C   + L  F ++V + ++EAA++ AI++AG+ + VT+ACS G+L+ C C      +S     Q + C++N+ YG +F++ F+D                  + +R K  S+ +  + L+NN   R  I+  M  +CKC G SG+C  K CW+ +P F ++G ALK K+  A ++             +G   +LV  +    P  +ED L++L PS D+C  +++ G+ G  GR C   +     C  LCC  GF   +  + E+C 
Sbjct:   55 QMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQG-FQWSGCSDNIAYGVAFSQSFVD------------------VRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRR---------VGSSRALVPRNAQFKPHTDED-LVYLEPSPDFCEQDIRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCG 327          
BLAST of WntP-4 vs. Ensembl Mouse
Match: Wnt2 (wingless-type MMTV integration site family, member 2 [Source:MGI Symbol;Acc:MGI:98954])

HSP 1 Score: 148.288 bits (373), Expect = 2.184e-40
Identity = 87/315 (27.62%), Postives = 152/315 (48.25%), Query Frame = 3
Query:   96 KNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTY--CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDIS--LVINDPFIE--EDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGF 1013
            + +  S+  +CD +    S   +LC   P+V+  I +  +    EC  Q + HRW+C   +R   LF +++ + S+E+A++ AI++AG+ + +T+ACS+G+LK C C   ++  +  +K    +  C++N+DYG  F   F+D                    K +K + A +  + L+NN   R  + + ++ +CKC G SG+CT + CW  + DF K G+                K      + M +D +   V N  F +  ++ L++   S DYC  + + G  G  GR C   + G  SC  +CC  G+
Sbjct:   31 RATGGSSRVMCDNVPGLVSRQRQLCHRHPDVMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGELKSCSCDPKKKGSAKDSKGTFDWGGCSDNIDYGIKFARAFVDA-------------------KERKGKDA-RALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGD------------YLWRKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGY 313          
BLAST of WntP-4 vs. Ensembl Mouse
Match: Wnt16 (wingless-type MMTV integration site family, member 16 [Source:MGI Symbol;Acc:MGI:2136018])

HSP 1 Score: 142.124 bits (357), Expect = 5.309e-38
Identity = 96/310 (30.97%), Postives = 147/310 (47.42%), Query Frame = 3
Query:  147 NSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---------LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD-QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            NS    LC  KP ++  I       ++EC  Q ++ RW+C  +           LF   +   +KE A++ AI  AG+ + VT++CS G++  C C    Q+    ++      C+++V YG  F+  FLD P++ +                K+SR    + + L+NN   R  + K M   C+C G SG+C  K CWKT+  F KIG  LK+KY N+ ++    K+       M          P +++D L+++  S +YC  N KLGI G  GREC   + G   CN LCC  G+       VE+C
Sbjct:   53 NSRQKELCKRKPYLLPSIREGARLGIQECRSQFRHERWNCMVATTTSTQLATAPLFGYELSSGTKETAFIYAIMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSPSEGWHWGGCSDDVQYGMWFSRKFLDLPIRNTTG--------------KESR--VLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHFLKDKYENSIQISDKTKR------KMRRREKDQRQTPILKDD-LLYVHKSPNYCVENKKLGIPGTQGRECNRTSGGADGCNLLCCGRGYNTHVVRHVERC 339          
BLAST of WntP-4 vs. Ensembl Mouse
Match: Wnt7b (wingless-type MMTV integration site family, member 7B [Source:MGI Symbol;Acc:MGI:98962])

HSP 1 Score: 141.354 bits (355), Expect = 7.208e-38
Identity = 100/351 (28.49%), Postives = 159/351 (45.30%), Query Frame = 3
Query:    6 IIFIFMISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGC--SNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD-QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            I ++F+   +  + LG     L  +  L      N  P +  R R        +C  +P+ I +I       ++EC  Q ++ RW+C       +F Q +   S+EAA+  AIT AG+ + VT ACS+G+L  C C  ++Q      +  +   C+ +V YG  F+  F+D                   E +K +R      + L+NN   R V+   M+ +CKC G SG+CT+K CW TLP F ++G  LK KY  A ++  +   R+R+   +          P   E  L+++  S +YC  +   G  G  GR C   + G   C+ +CC  G+   +   V QCN
Sbjct:    9 IFYVFLCFGVLYVKLGA----LSSVVALGANIICNKIPGLAPRQR-------AICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDA-----------------REIKKNARR----LMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM--ETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCN 325          
BLAST of WntP-4 vs. Ensembl Mouse
Match: Wnt2b (wingless-type MMTV integration site family, member 2B [Source:MGI Symbol;Acc:MGI:1261834])

HSP 1 Score: 140.198 bits (352), Expect = 4.454e-37
Identity = 88/316 (27.85%), Postives = 145/316 (45.89%), Query Frame = 3
Query:  123 ICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQ-----LTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            ICD I    S   +LC   P+++  +       + EC  Q ++HRW+C   +R   +F + + + S+EAA++ AI++AG+ + +T+ACS+G+L  C C    +   G + DQ        C++N+ YG  F + F+D                   EKR K   A    + L+NN   R  + + ++ +CKC G SG+CT + CW+ L DF + G+ L+ +Y  A ++              G   +   +        L++   S DYC  +   G  G  GR C   + G   C  +CC  G+   +   V QC
Sbjct:   69 ICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRAMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTR---GRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDA-----------------KEKRLKDARAL---MNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRHATRTD--------LVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQC 353          
BLAST of WntP-4 vs. UniProt/SwissProt
Match: sp|Q9QXQ5|WNT4_RAT (Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 2.235e-43
Identity = 93/302 (30.79%), Postives = 153/302 (50.66%), Query Frame = 3
Query:  162 RLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRL--FQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVIND----PFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            ++C    EV++ +      A+EEC  Q +  RW+C   + L  F ++V + ++EAA++ AI++AG+ + VT+ACS GDL+ C C      +S     Q + C++N+ YG +F++ F+D                  + +R K  S+ +  + L+NN   R  I+  M  +CKC G SG+C  K CW+ +P F ++G ALK K+  A ++             +G   +LV  +    P  +ED L++L PS D+C  +M+ G+ G  GR C   +     C  LCC  GF      + E+C 
Sbjct:   55 QMCKRNLEVMDSVRHGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQGF-QWSGCSDNIAYGVAFSQSFVD------------------VRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPR---------RVGSSRALVPRNAQFKPHTDED-LVYLEPSPDFCEQDMRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAHVELAERCG 327          
BLAST of WntP-4 vs. UniProt/SwissProt
Match: sp|P56705|WNT4_HUMAN (Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4)

HSP 1 Score: 157.147 bits (396), Expect = 6.080e-43
Identity = 92/302 (30.46%), Postives = 155/302 (51.32%), Query Frame = 3
Query:  162 RLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRL--FQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVIND----PFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            ++C    EV++ +      A+EEC  Q +  RW+C   + L  F ++V + ++EAA++ AI++AG+ + VT+ACS G+L+ C C      +S     Q + C++N+ YG +F++ F+D                  + +R K  S+ +  + L+NN   R  I+  M  +CKC G SG+C  K CW+ +P F ++G ALK K+  A ++             +G   +LV  +    P  +ED L++L PS D+C  +M+ G+ G  GR C   +     C  LCC  GF   +  + E+C+
Sbjct:   55 QMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQG-FQWSGCSDNIAYGVAFSQSFVD------------------VRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRR---------VGSSRALVPRNAQFKPHTDED-LVYLEPSPDFCEQDMRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCS 327          
BLAST of WntP-4 vs. UniProt/SwissProt
Match: sp|P49338|WNT4_XENLA (Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.136e-42
Identity = 100/354 (28.25%), Postives = 176/354 (49.72%), Query Frame = 3
Query:   12 FIFMISPLFKISLGNSI--TNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRL--FQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVIND----PFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
             + MI  +F  +  N +    L  +  +S++ +       C++++       ++C    EV++ +      A+EEC  Q +  RW+C   + L  F ++V + ++EAA++ AI++AG+ + VT+ACS GDL+ C C      +S     Q + C++N+ YG +F++ F+D                  + +R K  S+ +  + L+NN   R  I+ +M  +CKC G SG+C  K CWK +P F K+G  LK K+  A ++ +           +G    LV  +    P  +ED L++L  S D+C  ++K G+ G  GR+C   +     C  +CC  GF   +  +VE+C+
Sbjct:   10 LLMMILAVFSANASNWLYLAKLSSVGSISEEET-------CEKLKGPIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDTLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQGF-QWSGCSDNILYGVAFSQSFVD------------------VRERSKGGSSSRALMNLHNNEAGRKAILNNMRVECKCHGVSGSCEVKTCWKAMPTFRKVGNVLKEKFDGATEVEQK---------KIGSTKVLVPKNSQFKPHTDED-LVYLDSSPDFCDHDLKNGVLGTTGRQCNKTSKAIDGCELMCCGRGFHTEEVEIVERCS 327          
BLAST of WntP-4 vs. UniProt/SwissProt
Match: sp|P22724|WNT4_MOUSE (Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.869e-42
Identity = 91/302 (30.13%), Postives = 154/302 (50.99%), Query Frame = 3
Query:  162 RLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRL--FQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVIND----PFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            ++C    EV++ +      A+EEC  Q +  RW+C   + L  F ++V + ++EAA++ AI++AG+ + VT+ACS G+L+ C C      +S     Q + C++N+ YG +F++ F+D                  + +R K  S+ +  + L+NN   R  I+  M  +CKC G SG+C  K CW+ +P F ++G ALK K+  A ++             +G   +LV  +    P  +ED L++L PS D+C  +++ G+ G  GR C   +     C  LCC  GF   +  + E+C 
Sbjct:   55 QMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQG-FQWSGCSDNIAYGVAFSQSFVD------------------VRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRR---------VGSSRALVPRNAQFKPHTDED-LVYLEPSPDFCEQDIRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCG 327          
BLAST of WntP-4 vs. UniProt/SwissProt
Match: sp|P49337|WNT4_CHICK (Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 2.112e-41
Identity = 94/302 (31.13%), Postives = 156/302 (51.66%), Query Frame = 3
Query:  162 RLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRL--FQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVIND----PFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            ++C    EV++ +      A+EEC  Q +  RW+C   + L  F ++V + ++EAA++ AI++AG+ + VT+ACS G+L  C C    Q  S     Q + C++N+ YG +F++ F+D                  + +R K  S+ +  + L+NN   R  I+ +M  +CKC G SG+C  K CWK +P F K+G  LK K+  A ++ +           +G    LV  +    P  +ED L++L  S D+C  ++K G+ G +GR+C   +     C  +CC  GF   +  VVE+C+
Sbjct:   55 QMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDTLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELDKCGCDRTVQGGSPQGF-QWSGCSDNIAYGVAFSQSFVD------------------VRERSKGASSNRALMNLHNNEAGRKAILNNMRVECKCHGVSGSCEFKTCWKAMPPFRKVGNVLKEKFDGATEVEQS---------EIGSTKVLVPKNSQFKPHTDED-LVYLDSSPDFCDHDLKNGVLGTSGRQCNKTSKAIDGCELMCCGRGFHTDEVEVVERCS 327          
BLAST of WntP-4 vs. TrEMBL
Match: C3U5B3 (Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 701.434 bits (1809), Expect = 0.000e+0
Identity = 386/388 (99.48%), Postives = 387/388 (99.74%), Query Frame = 3
Query:    3 IIIFIFMISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCNXXXXXXXXXXXXXXXXMTTKFYCKIPQTSKKFHKYYLNG 1166
            IIIFIFMISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLT CNENVDYGKSFTEIFLDGPVKLSIKSL+RMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEALKNKYLNAKKLPRILKKRIRKNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCNCKFKWCCKVECEKCEKMTTKFYCKIPQTSKKFHKYYLNG
Sbjct:    5 IIIFIFMISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTNCNENVDYGKSFTEIFLDGPVKLSIKSLIRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEALKNKYLNAKKLPRILKKRIRKNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCNCKFKWCCKVECEKCEKMTTKFYCKIPQTSKKFHKYYLNG 392          
BLAST of WntP-4 vs. TrEMBL
Match: A0A210PF61 (Protein Wnt OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10942 PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.470e-45
Identity = 107/351 (30.48%), Postives = 177/351 (50.43%), Query Frame = 3
Query:    3 IIIFIFMISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR--LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            + + +   +P   +     +      A+   + + +S P + D       +  + C   PE I  ++    AA+ EC KQ K+ RW+C  S    +F  +++K ++E A++ AI +AG+ + VT ACS G+L  C C   +     +   +   C++N+ YG SF++ F+D P  L  +S    N++ KM               L+NN V R VI  +M+ +C+C G SG+C  + CWK+LPDF  +GE LK KY  + ++ R  +KR+R+      ++        ++ D L+++  S +YC PN K GI G  GR C    +GP SC+ LCC  G+       VE+C+
Sbjct:   14 VGVLVLTWTPSLSLDSWMHLGVASLAAVPQDRGTCSSVPGLVD-------LQQQECLRNPESILCVSRGAKAAITECQKQFKFERWNCTTSQNYSVFGPVLKKGTRETAFIYAILSAGVVHAVTTACSLGNLTDCSCDTSRYGEHTVEGWKWGGCSDNIHYGVSFSKRFVDAPETLMHQS--SQNLRNKMN--------------LHNNEVGRQVIQSAMKLRCRCHGVSGSCAVQTCWKSLPDFQLVGEKLKAKYEWSVRIARRARKRLRRRDKTKRNVP-------VDADNLVYVHRSPNYCRPNPKKGILGTRGRLCNKTMTGPESCDLLCCGRGYNTQVLRHVERCH 334          
BLAST of WntP-4 vs. TrEMBL
Match: A0A097ZRW5 (Protein Wnt OS=Euperipatoides kanangrensis OX=488523 GN=Wnt6 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 7.004e-45
Identity = 105/351 (29.91%), Postives = 170/351 (48.43%), Query Frame = 3
Query:    3 IIIFIFMISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIE---EDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            +++F F+I P+  I L  ++ +     +L           IC + R      + +C  +PEV+  +A        EC  Q ++ RW+C  S R F +++ +  +E A+LNAIT AG+T+ VT+ACS G L  C C    + +S     +   C +N+D+G   +  F+D                     R K  S  K  + L+NN   R  +   M T+CKC G SG+CT K CW+ LP F  +G+ LK K+  A K+           ++  + +S++     I+   +D L++   S D+C PN K+G  G +GREC   + G   C  LCC+ G+ K+++ + E C
Sbjct:    8 VVVFFFLICPVNIIGLWWAVGSP---LVLDPTR-------ICRKTRRLRGKQAEICQNEPEVVREVAKGAQIGTVECQFQFRHRRWNCSTSRRSFGKVLMQDIRETAFLNAITAAGVTFAVTQACSAGHLLQCTCDRSIKGISTDGDWEWGGCGDNIDFGYKKSREFMDA--------------------RDKKGSDVKTLILLHNNEAGRIAVKNYMRTECKCHGLSGSCTLKTCWRKLPIFRDVGDRLKEKFDGAAKV-----------MAGNDGLSIIPVGATIKPPAKDDLIYSEDSPDFCEPNKKVGSLGTHGRECNHTSQGVGGCELLCCSRGYEKLQQNITENC 317          
BLAST of WntP-4 vs. TrEMBL
Match: A0A1S3HCK0 (Protein Wnt OS=Lingula unguis OX=7574 GN=LOC106154046 PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 2.920e-44
Identity = 97/324 (29.94%), Postives = 168/324 (51.85%), Query Frame = 3
Query:   87 LSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSN--RLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTY--CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            L   + S +T  ICD +   N+    LC    E++N + M    A++EC  Q K  RW+C   +   +F  ++++ ++EAA+++AI+ AG+ + VT+ACS G+L+ C C    + ++G + D  T+  C++N+ YG +F++ F+D                    +R + +   +  + L+NN   R  + K M+ +CKC G SG+C  K CW+ +P F ++G  LK K+  A +  +      R+ + + +        P   ED L++L PS D+C P+  +G  G  GR C   +     C+ +CC  GF   +K+VVE+C
Sbjct:   27 LGMSSISINTEQICDELIGLNNRQKVLCKRNVEIMNSVTMGARTAIDECQYQFKNRRWNCSTVDPVSVFGNVLDQGTREAAFVHAISAAGVAHSVTRACSSGELEKCGC---DRTINGKSPDGFTWSGCSDNIAYGNAFSKAFVDA------------------RERHRHKGGGRALMNLHNNEAGRRSVEKHMKVECKCHGVSGSCELKTCWRAMPTFREVGARLKEKFDGATEAIQERIGTRRQLVPVNKQFK-----PHTHED-LVYLVPSPDFCDPDPSIGSLGTRGRLCNSSSKAIDGCDLMCCGRGFKTRRKMVVERC 323          
BLAST of WntP-4 vs. TrEMBL
Match: A0A1S3HE00 (Protein Wnt OS=Lingula unguis OX=7574 GN=LOC106154046 PE=3 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.969e-44
Identity = 95/316 (30.06%), Postives = 165/316 (52.22%), Query Frame = 3
Query:  111 STPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSN--RLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTY--CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            +T  ICD +   N+    LC    E++N + M    A++EC  Q K  RW+C   +   +F  ++++ ++EAA+++AI+ AG+ + VT+ACS G+L+ C C    + ++G + D  T+  C++N+ YG +F++ F+D                    +R + +   +  + L+NN   R  + K M+ +CKC G SG+C  K CW+ +P F ++G  LK K+  A +  +      R+ + + +        P   ED L++L PS D+C P+  +G  G  GR C   +     C+ +CC  GF   +K+VVE+C
Sbjct:    7 NTEQICDELIGLNNRQKVLCKRNVEIMNSVTMGARTAIDECQYQFKNRRWNCSTVDPVSVFGNVLDQGTREAAFVHAISAAGVAHSVTRACSSGELEKCGC---DRTINGKSPDGFTWSGCSDNIAYGNAFSKAFVDA------------------RERHRHKGGGRALMNLHNNEAGRRSVEKHMKVECKCHGVSGSCELKTCWRAMPTFREVGARLKEKFDGATEAIQERIGTRRQLVPVNKQFK-----PHTHED-LVYLVPSPDFCDPDPSIGSLGTRGRLCNSSSKAIDGCDLMCCGRGFKTRRKMVVERC 295          
BLAST of WntP-4 vs. Ensembl Cavefish
Match: wnt4b (protein Wnt-4 [Source:NCBI gene;Acc:103021666])

HSP 1 Score: 151.369 bits (381), Expect = 1.370e-41
Identity = 87/317 (27.44%), Postives = 164/317 (51.74%), Query Frame = 3
Query:  126 CDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD--QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEED---QLMFLRPSFDYCFPNMKLGIKGVNGRECEDVAS-GPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            C R+R  ++    +C  + EV+  +  A    +EEC  Q +  RW+C  + R   +F +++ + ++EAA+++A+++A +   VT+ CSRG+L+ C C    + + G++ +  Q + C++N+ YG +F++ F+D P                  +R K  S+ +  + ++NN   R  I+ +M+ +CKC G SG+C  + CWK +P F ++G  LK ++  A ++             +G   +L+  DP ++      L++L  S D+C  + + GI G  GR C   +   P  C  +CC  GF   +  V+++C+
Sbjct:   47 CGRLRGLSAGQVGVCRARGEVMESVRKAAEMVIEECQHQFRNRRWNCSTTPRGINVFGRVMNQGTREAAFVHALSSAAVAVAVTRGCSRGELERCGC---DRKVRGVSPEGFQWSGCSDNLSYGVAFSQTFVDEP------------------ERAKGTSSGRPLMNIHNNEAGRKAILHNMQVECKCHGVSGSCELRTCWKVMPPFRRVGAVLKERFDGATEVRLTR---------VGSRTALLPKDPLVKPPAARDLVYLSASPDFCRLDPENGIPGTAGRRCNGTSRLAPDGCELVCCGPGFRAGRAEVIQRCS 333          
BLAST of WntP-4 vs. Ensembl Cavefish
Match: wnt6b (Wnt family member 6 [Source:NCBI gene;Acc:103041984])

HSP 1 Score: 149.058 bits (375), Expect = 9.454e-41
Identity = 95/346 (27.46%), Postives = 165/346 (47.69%), Query Frame = 3
Query:    3 IIIFIFMISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMN----------KDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYG 1010
            +  F  ++ P+  I L  ++ +     ++   NS      IC + +      + LC  +PE+++ +A      + EC  Q ++ RW+C   N+ F +I+++  +E A++ AIT AG+T+ VT+ACS GDL  C C + +                 K +   C ++V++G   ++ F+D                    KR+K +S  +  ++L+NN   R  +   M T+CKC G SG+CT + CWK +P F ++G+ L  ++  A K+      +    + +G +I      P  ++D L++   S D+C PN K G  G  GR C   A   + C+ LCC  G
Sbjct:    9 LAFFFILLCPVNIIGLWWAVGS----PLVMDPNS------ICRKTKRLAGKQAELCQTQPEIVHEVAKGARLGVRECQYQFRFRRWNCTSHNKYFGKILQQDIRETAFVYAITAAGVTHAVTQACSMGDLLQCGCESIRSRAPPPRPPGVPHTEGVKWEWGGCGDDVEFGYEKSKQFMDA-------------------KRRKGKSDIRTLIDLHNNEAGRLAVKNYMRTECKCHGLSGSCTLRTCWKKMPHFREVGDRLLERFNGAFKVMGGNDGKTL--IPVGHNIK-----PPDKQD-LIYSAESPDFCLPNRKTGSLGTRGRTCNSTALDVSGCDLLCCERG 317          
BLAST of WntP-4 vs. Ensembl Cavefish
Match: wnt6a (protein Wnt-6-like [Source:NCBI gene;Acc:103038704])

HSP 1 Score: 144.821 bits (364), Expect = 3.758e-39
Identity = 88/327 (26.91%), Postives = 150/327 (45.87%), Query Frame = 3
Query:  123 ICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQC------------SADQQDLSGMNKDQ-----LTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGREC--EDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            IC R +     ++ LC  KPE+I  +A      + EC  Q + HRW+C   ++   +I+++  +E A++N I  AG+ + VT+ACS+G+L  C C             A +   S M+  Q        C ++VD+G   +  F+D                    +R+K +S  +  ++L+NN   R  +   M  +CKC G SG+CT + CW+ LP F ++G  L   +  A ++      +    + + +D++L   D  I  D+      S D+C  + + G +G   R C      +GP +C+ LCC+ G   +     E C
Sbjct:   42 ICRRSKPPGGAHAELCQTKPEIIQEVAKGARLGMRECQHQFRQHRWNCSSHSKSLGKILQQDIRETAFVNGIMAAGVLHAVTQACSQGELLECGCVTLKNSPGSPKERASEHMPSPMSALQDLRWEWGGCGDDVDFGYEISRQFMD-------------------TRRRKGKSDIRTLVDLHNNEAGRLAVKTHMRAECKCHGLSGSCTLRSCWRKLPLFRQVGNHLMESFRTAVRVMGGNDGKSL--IPVEQDVTLPGTDSLIYSDE------SPDFCQASRRTGSEGTQYRACNSNSTETGPGACDWLCCSKGHTVLALEYQENC 341          
BLAST of WntP-4 vs. Ensembl Cavefish
Match: wnt7ba (Wnt family member 7B [Source:NCBI gene;Acc:103028473])

HSP 1 Score: 143.665 bits (361), Expect = 7.950e-39
Identity = 105/339 (30.97%), Postives = 159/339 (46.90%), Query Frame = 3
Query:  120 FICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGC--SNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD-QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIE--EDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCNXXXXXXXXXXXXXXXXMTTKFYCK 1121
             IC++I         +C  +P+ I +I       + EC  Q +Y RW+C       +F Q +   SKEAA+  AIT AG+ + VT ACS+G+L  C C  ++Q      +  +   C+ +V YG  F+  F+D                   E +K +R      + L+NN   R V+ + M+ +CKC G SG+CT+K CW TLP F +IG            +   ++      L     + L  +  +I+  +  L++L  S +YC  ++  G  G  GR C   +  P  C  +CC  G    +   V QCNCKF+WCC V+C  C +MT  F CK
Sbjct:   30 IICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRYGRWNCSALGERTVFGQELRVGSKEAAFTYAITAAGVAHAVTAACSQGNLSHCGCDREKQGYHDHEEGWKWGGCSADVKYGVEFSRRFVDA-----------------REIKKNARR----LMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIG----YVLKERYGVAVQVEAVRATRLRQPSFLRLKQSHGYIKPTDTDLVYLERSPNYCEEDVATGSAGTRGRLCNHTSPHPDGCGLMCCGRGHDTHQYTRVWQCNCKFQWCCFVKCNTCSEMTEVFTCK 343          
BLAST of WntP-4 vs. Ensembl Cavefish
Match: wnt7ba (Wnt family member 7B [Source:NCBI gene;Acc:103028473])

HSP 1 Score: 143.665 bits (361), Expect = 8.707e-39
Identity = 105/339 (30.97%), Postives = 159/339 (46.90%), Query Frame = 3
Query:  120 FICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGC--SNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD-QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIE--EDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCNXXXXXXXXXXXXXXXXMTTKFYCK 1121
             IC++I         +C  +P+ I +I       + EC  Q +Y RW+C       +F Q +   SKEAA+  AIT AG+ + VT ACS+G+L  C C  ++Q      +  +   C+ +V YG  F+  F+D                   E +K +R      + L+NN   R V+ + M+ +CKC G SG+CT+K CW TLP F +IG            +   ++      L     + L  +  +I+  +  L++L  S +YC  ++  G  G  GR C   +  P  C  +CC  G    +   V QCNCKF+WCC V+C  C +MT  F CK
Sbjct:   40 IICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRYGRWNCSALGERTVFGQELRVGSKEAAFTYAITAAGVAHAVTAACSQGNLSHCGCDREKQGYHDHEEGWKWGGCSADVKYGVEFSRRFVDA-----------------REIKKNARR----LMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIG----YVLKERYGVAVQVEAVRATRLRQPSFLRLKQSHGYIKPTDTDLVYLERSPNYCEEDVATGSAGTRGRLCNHTSPHPDGCGLMCCGRGHDTHQYTRVWQCNCKFQWCCFVKCNTCSEMTEVFTCK 353          
BLAST of WntP-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010914.1 (pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 gene:ENSPMAG00000009890.1 transcript:ENSPMAT00000010914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 1.448e-33
Identity = 87/300 (29.00%), Postives = 140/300 (46.67%), Query Frame = 3
Query:  162 RLCSEKPEVINLIAMATSAALEECNKQLKYHRWDC--GCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQL-TYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKME-KRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            +LC    + +  IA     A+ EC  Q +  RW+C  G  + +F ++    S+E A+ +AI+ AG+ + V++AC  G+L  C CS   +    + +D L   C +N++YG  F   F+D   +       +   + + +   + S    +  + L+NN   R  +    +  CKC G SG+C+ K CW  L DF K+G+ LK KY +A       + ++       E  +   + P      L++L  S DYC  N   G  G  GR C   + G   C  +CC  G+   K  VVE+CN
Sbjct:   60 KLCHLYQDHVPHIADGARLAVRECQHQFRTRRWNCSAGEGDSVFGRLTHIGSRETAFAHAISAAGVAHAVSRACREGELATCGCSRAPRPRE-LQRDWLWGGCGDNLEYGYRFAREFVDAREREQGGQQQQQQQQQQQQLAARHSVEHSRTLMNLHNNEAGRRAVYGLADVACKCHGVSGSCSLKTCWLQLADFRKVGKFLKEKYDSASAARAGRRAKL-------EPANRKFSPP--SAGDLVYLDASPDYCVRNETTGSLGTIGRSCNKTSEGMDGCELMCCGRGYDHFKATVVERCN 349          
BLAST of WntP-4 vs. Ensembl Sea Lamprey
Match: wnt3 (wingless-type MMTV integration site family, member 3 [Source:ZFIN;Acc:ZDB-GENE-081003-1])

HSP 1 Score: 123.635 bits (309), Expect = 3.665e-32
Identity = 92/342 (26.90%), Postives = 154/342 (45.03%), Query Frame = 3
Query:   42 ISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGC---SNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQ-DLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIE---EDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            I +    T    + +  Q  S  S P +C  I        R C    E++  +A      ++EC  Q +  RW+C        +F  ++E+ ++EA++++A+++AG+ + VT+AC+ G    C C    + + SG  K     C+E+ D+G   +  F D                   E R  +RSA    +  +NN   R  I+  M+ KCKC G SG+C  K CW   P F  +G+ LK+KY +A ++     +      S G   +L    P  +   E  L++   S ++C P+ + G  G +GR C   + G   C+ LCC+ G+    +   E+C
Sbjct:   17 IPVSPPTTPCRSLGVGPQWASLGSQPVLCASIPGLVPKQLRFCRNYQELMPSVAEGVRLGIQECQHQFRGRRWNCTTMTEGPAIFGPVLERATREASFVHAVSSAGVGFAVTRACADGTSTICGCDNKHRGEPSGGWK--WGGCSEDADFGVMVSREFADA-----------------RENRPDARSA----MNRHNNEAGRVSILDFMQRKCKCHGLSGSCEVKTCWWAQPSFRTVGDHLKDKYDSASEMLVERHRE-----SRGWVETLRPKYPLFKPPAERDLVYYETSPNFCEPSAETGSLGTHGRPCNLTSHGIDGCDLLCCSRGYNTHTERRREKC 330          
BLAST of WntP-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001922.1 (pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 gene:ENSPMAG00000001738.1 transcript:ENSPMAT00000001922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 1.031e-19
Identity = 74/311 (23.79%), Postives = 130/311 (41.80%), Query Frame = 3
Query:  123 ICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGC--SNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            IC++I         LC  +P+VI +I       + EC  Q ++ RW+C       +F Q ++   +   + +  +  G+   + + C  G  +   CS   +   G +   L     +  +G+  +  FL           +  N +     +   +  ++ F      H    V+ + M+ +CKC G SG+CT+K CW TLP F ++G ALK+KY +   +  +   R  + + +    S     P   + +L+F   S +YC  +   G  G  GR C   +     C+ LCC  G+   +     QCN
Sbjct:    6 ICNKIPGLAPRQRALCQSRPDVIIVIGEGAQLGISECQYQFRFGRWNCTALGERTVFGQELKVAIRSTHFTDIQSGGGLFERIHQRCRYGAHELSLCSQLTRGREGPH-PWLRMTPLDEQFGQKTSSTFLK-------IVYIHYNYRNSDLAQLMQKVPYRRF------HSTDQVLEEKMKLECKCHGVSGSCTTKTCWTTLPKFREVGYALKDKYEHTVHVEPVSGSRYMRPMFLKVKKSRSYRKPL--DTELVFTERSPNYCEEDPATGSAGTRGRLCNRTSPHADGCDLLCCGRGYNTHQYTRAWQCN 300          
BLAST of WntP-4 vs. Ensembl Sea Lamprey
Match: wnt7ba (wingless-type MMTV integration site family, member 7Ba [Source:ZFIN;Acc:ZDB-GENE-041210-178])

HSP 1 Score: 82.4185 bits (202), Expect = 1.031e-18
Identity = 46/157 (29.30%), Postives = 80/157 (50.96%), Query Frame = 3
Query:  120 FICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGC--SNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD-QLTYCNENVDYGKSFTEIFLDG-PVKLSIKSLLRMNIKTKMEKRK 578
             IC++I         LC  +P+ I +I       + EC  Q ++ RW+C       +F Q ++  S+EAA+ +A+ +AG+ Y +T ACS+G+L  C C   +Q      +  +   C+ ++ YG  F+ +F+D   VK + ++L  MN+      RK
Sbjct:    7 IICNKIPGLAPRQRALCQSRPDAIIVIGEGAQLGISECQHQFRFGRWNCSALGEKTVFGQELKVGSREAAFTHAVLSAGVAYAITAACSQGNLSECGCDRAKQGFYNAQEGWRWGGCSADLRYGLEFSRLFVDAREVKQNARTL--MNLHNNAAGRK 161          
BLAST of WntP-4 vs. Ensembl Sea Lamprey
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 76.2554 bits (186), Expect = 6.980e-17
Identity = 46/141 (32.62%), Postives = 69/141 (48.94%), Query Frame = 3
Query:  636 NVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVIND----PFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
              ++  M  +CKC G SG+C  + CW+ LP F KIG  LK K+  A ++             +G    LV  +    P  +ED L+++ PS D+C  + K G+ G  GREC   +     C  +CC  GF   +  +VE+C
Sbjct:    1 QAVVSHMRVECKCHGVSGSCEVRTCWRALPPFRKIGSVLKEKFDGATEVELR---------KIGTRRQLVPRNAQFKPHTDED-LVYVAPSPDFCDADPKAGVAGTAGRECNRTSRALDGCELMCCGRGFHTTRAELVERC 131          
BLAST of WntP-4 vs. Ensembl Nematostella
Match: WNT16 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S694])

HSP 1 Score: 159.844 bits (403), Expect = 1.615e-45
Identity = 98/318 (30.82%), Postives = 160/318 (50.31%), Query Frame = 3
Query:  102 SSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSN--RLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            S NS    C R+   +    R+C +KP+VI  ++   +  + EC KQ KY RW+C  SN   +F  +++   KE+A++ AIT+AG+ + V K+CS+G+L  C C + +   +     +   C++NV+YG   ++ F+D P               K ++R +S+   +  + L+NN   R  ++  M  +C+C G S +C  K C K+LP F ++GEALK +Y +A +   I            +          I    L++L  S +YC+ + KLGI G +GREC   +SG   C+ LCC  G+       V  C+
Sbjct:   10 SGNSVSPSCSRVPGLSLQQLRMCLQKPDVIPSVSQGANIGIHECKKQFKYERWNCSTSNDPTVFGTLLKIAHKESAFVYAITSAGVVHAVGKSCSKGNLTECSCESKRGARNQPKGWEWGGCSDNVNYGVWLSKTFVDAP--------------EKADRRARSQRKARAMMNLHNNEAGREAVLALMRVQCRCHGVSSSCAVKTCSKSLPKFEEVGEALKAEYKDAIRAVYI--------KRKRKLKRKDNKKLRIPSSSLVYLDESPNYCYRDKKLGIDGTSGRECNKNSSGVDGCDLLCCGSGYNTQTVRSVHSCH 305          
BLAST of WntP-4 vs. Ensembl Nematostella
Match: WNT2 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5])

HSP 1 Score: 144.436 bits (363), Expect = 2.047e-39
Identity = 88/303 (29.04%), Postives = 150/303 (49.50%), Query Frame = 3
Query:  123 ICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSN---RLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTY--CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPT-SCNNLCCNYGF 1013
            +C+ I    SI  ++C + P+V+  I       +EEC  Q +  RW+C   N    +F +++ + S+E A++ AI++AG+ + VT++CS G+LK C C    ++  G ++    +  C++N+ YG +F + F+D                   E  K +R+     + L+NNHV R V+  +M   CKC G SG+C+ + CWK++  F  +G+          +       ++    S GE  +  ++      D L++L  S +YC  +   G  G +GREC   AS  T +C+ LCC  GF
Sbjct:   41 MCNSITGLISIQRQMCLDNPDVMVSIGKGAKLGVEECQHQFRDQRWNCSTVNGDATVFGKVMRRASRETAFVYAISSAGVVHEVTRSCSLGELKDCSC----RNKKGRSRKGFEWGGCSDNIQYGLNFAKAFVD-----------------SREVEKDARA----LMNLHNNHVGRRVVKTNMSLDCKCHGVSGSCSVRTCWKSISSFRIVGQ--------HLREKYTTAVQVTVGQSGGELTNAEVSYKKPSRDDLVYLEDSPNYCMVDSNTGSLGTSGRECNGSASDTTGACSLLCCGRGF 310          
BLAST of WntP-4 vs. Ensembl Nematostella
Match: EDO31000 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54])

HSP 1 Score: 137.887 bits (346), Expect = 4.889e-37
Identity = 98/358 (27.37%), Postives = 166/358 (46.37%), Query Frame = 3
Query:    3 IIIFIFMISPLFK---ISLGNSITNLHRIAILSQKNSSNSTPFICDRI-RFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGC----SNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQ--LMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            I+  + M S ++    +SL  + +N +R   LS+KN        CD I +  N    ++C    +V++ +    S AL EC  Q +Y  W+C       + +F   +   ++EAA+++AI++AG+ Y VT+ACS G L   +C  D++     +      C++++D+G +F   F+D                   E+     S  ++ + L+NN   R  + K M+ +CKC G SG+C  K CW+ LP+F  +G+          K        +   L  G+ + +  N  +    Q  L++L  S D+C PN K G  G  GR C   +     C+ +CC  G+V   ++  EQC
Sbjct:    8 ILTQLVMASLVYSSQWLSLALTGSNPNRF--LSKKN--------CDEIGQLLNHRQVQVCKRNIQVMDSVKDGASVALFECQHQFRYRPWNCTTVQFSRSPVFGNSINGGTREAAFVHAISSAGVAYAVTQACSSGRLGQ-KCGCDRKTRGQADGFNWAGCSDDIDFGMTFATRFVDA-----------------RERGSGIGSPARVLMNLHNNRGGRLAVKKFMDLQCKCHGVSGSCNIKTCWRALPNFRIVGD--------YIKEKFDGATEVEYKLIGGKHVLVPKNRKYKPHTQMDLVYLVQSPDFCEPNPKTGSLGTQGRICNRTSQAIDGCDLMCCGRGYVSRTEVRQEQC 329          
BLAST of WntP-4 vs. Ensembl Nematostella
Match: EDO49431 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9])

HSP 1 Score: 137.502 bits (345), Expect = 6.420e-37
Identity = 101/357 (28.29%), Postives = 159/357 (44.54%), Query Frame = 3
Query:    6 IIFIFMISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSN--RLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD--QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXX-XXXXXXXXXXXXXXXXXNLSMGEDISLVI-NDPFIEED---QLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            I+ +FM+S            NL        KN  N      ++IR       R+    PE+I  IA     A+ EC  Q +  +W+C   +   +F +I+++  +E A+  AIT AG+++ + +AC  G L  C C    Q   G++K   Q   C++N+ +  +F++ F+D                     ++K R  F+  + L+NN   R  +  +M  +CKC G S ACT K CWK LPDF  +G+ LK K    +    +        N +  ED +L I + P++       L++   S ++C  N   G  G  GREC   + G   C  +CC  GF    +  VE CN
Sbjct:    8 ILLVFMVSVCISNHEVQGWWNLG-FGFEDLKNDYNIQLSPPNQIRALTQKQIRISRRYPELIQYIAGGARTAIHECQHQFRNRKWNCSAHSPENVFGKILKRACRETAFTYAITAAGVSHAIARACGEGKLSACSCD---QRYRGVSKQGWQWGGCSDNIHFADNFSKRFVDA--------------------QEKGRD-FRAQINLHNNEAGRAAVRNNMIVECKCHGLSEACTVKTCWKRLPDFRLVGDDLKRKFDNASMVEYQQNNNNRNSNRNRNEDPALFIPSKPYLRRPTVYDLVYYEHSPNFCERNPSAGSLGTQGRECNTTSMGTDGCELMCCGRGFTTSSQERVENCN 339          
BLAST of WntP-4 vs. Ensembl Nematostella
Match: EDO37387 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SFU2])

HSP 1 Score: 128.642 bits (322), Expect = 8.857e-34
Identity = 87/306 (28.43%), Postives = 136/306 (44.44%), Query Frame = 3
Query:  162 RLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGC-----SNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD-QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGED-ISLVINDPFIEEDQ----LMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQC 1046
            ++C   P+V+         A+ EC  Q +Y RW+C        N L   ++ +  +E A+++AI +AG+T  V +ACS G L  C C    + L G     +   C +N+DYG   +  FLD                     R+K R    + + ++NN V R  + ++ +TKCKC G  G+C+ K CWKT+PD  +IG+              + K      + MG   + L +             L++   S +YC  N +LGI G  GR C   +    +C NLCC  G+   K  V ++C
Sbjct:   55 KMCRRLPDVVASALQGMQYAIHECLAQFRYRRWNCSSLEMKNRNPLANPLLSRGFRETAFVHAILSAGMTSSVARACSMGKLAKCGC---DESLRGRGTGWEWGGCGDNIDYGIETSAKFLD--------------------SREKGRDLHSM-MNMHNNMVGRTTLSENAKTKCKCHGMCGSCSVKTCWKTVPDIREIGD------------RLMEKYDHATTIGMGNGRLRLHLTRRKARRSSVGRALVYYEDSPNYCIENKELGIFGTRGRICSPESLDTDNCQNLCCERGYTTKKLQVTKRC 324          
BLAST of WntP-4 vs. Ensembl Medaka
Match: wnt4b (wingless-type MMTV integration site family member 4b [Source:NCBI gene;Acc:100301591])

HSP 1 Score: 155.221 bits (391), Expect = 4.430e-43
Identity = 90/317 (28.39%), Postives = 164/317 (51.74%), Query Frame = 3
Query:  126 CDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD--QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEED---QLMFLRPSFDYCFPNMKLGIKGVNGRECEDVAS-GPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            C R+R        +C  + EV+  +  A    +EEC  Q +  RW+C  + R   +F +++ + ++EAA+++A+++A +   VT+AC+RG+L+ C C    + + G++ +  Q + C++N+ YG +F++ F+D P                  +R K  SA +  + L+NN   R  I+ +M+ +CKC G SG+C  + CWK +P F ++G  LK ++  A ++             +G   +L+  DP+++      L++L PS D+C  +   GI G  GR C   +   P  C  +CC  G+   +  VV++C+
Sbjct:   47 CGRLRGLTPGQVGVCRARGEVMESVRKAAEMVIEECQHQFRNRRWNCSTTPRGINVFGRVMNQGTREAAFVHALSSAAVAVAVTRACTRGELERCGC---DRKVRGVSPEGFQWSGCSDNLSYGVAFSQTFVDEP------------------ERGKGLSAGRPLMNLHNNEAGRKAILHNMQVECKCHGVSGSCELRTCWKVMPPFRRVGIVLKERFDGATEVRLT---------RIGSRPALLPRDPYVKPPAARDLVYLSPSPDFCHLDPDNGIPGTAGRRCNGTSRLAPDGCELVCCGPGYKAGRAEVVQRCS 333          
BLAST of WntP-4 vs. Ensembl Medaka
Match: wnt2bb (wingless-type MMTV integration site family, member 2Bb [Source:NCBI gene;Acc:100529167])

HSP 1 Score: 152.525 bits (384), Expect = 8.967e-42
Identity = 88/319 (27.59%), Postives = 155/319 (48.59%), Query Frame = 3
Query:  123 ICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTY--CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDIS--LVINDPF--IEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGF--VKVKKLVVEQC 1046
            ICD I    +   +LC   P+++  I   T   + EC  Q ++HRW+C   +R   +F +++ + S+EAA++ AI++AG+ Y +T+ACS+GDL+ C C   ++  +   + +  +  C++N++YG  F + F+D                    K +  R A +  + L+NN   R  + + M+ +CKC G SG+CT + CW  + DF K G+                K      ++M +D +   V N  F    ++ L++   S DYC  +  +G  G  GR C   + G   C  +CC  G+   ++K++   +C
Sbjct:   71 ICDNIPGLVNKQRQLCQRHPDIMQAIGEGTKEWIRECQHQFRHHRWNCSTLDRDHTVFGRVLLRSSREAAFVYAISSAGVVYALTRACSQGDLRTCNCDPHKRGRARDERGEFDWGGCSDNINYGIKFAKAFIDA-------------------KERTVRDA-RALMNLHNNRCGRTAVKRFMKLECKCHGVSGSCTLRTCWMAMSDFRKTGD------------FLRRKYNGAIEVTMNQDGTGFTVANKAFRKATKNDLVYFENSPDYCMQDKTVGSLGTAGRVCNKTSRGTDGCEVMCCGRGYDTTRIKQITKCEC 357          
BLAST of WntP-4 vs. Ensembl Medaka
Match: wnt2bb (wingless-type MMTV integration site family, member 2Bb [Source:NCBI gene;Acc:100529167])

HSP 1 Score: 152.525 bits (384), Expect = 8.967e-42
Identity = 88/319 (27.59%), Postives = 155/319 (48.59%), Query Frame = 3
Query:  123 ICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTY--CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDIS--LVINDPF--IEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGF--VKVKKLVVEQC 1046
            ICD I    +   +LC   P+++  I   T   + EC  Q ++HRW+C   +R   +F +++ + S+EAA++ AI++AG+ Y +T+ACS+GDL+ C C   ++  +   + +  +  C++N++YG  F + F+D                    K +  R A +  + L+NN   R  + + M+ +CKC G SG+CT + CW  + DF K G+                K      ++M +D +   V N  F    ++ L++   S DYC  +  +G  G  GR C   + G   C  +CC  G+   ++K++   +C
Sbjct:   71 ICDNIPGLVNKQRQLCQRHPDIMQAIGEGTKEWIRECQHQFRHHRWNCSTLDRDHTVFGRVLLRSSREAAFVYAISSAGVVYALTRACSQGDLRTCNCDPHKRGRARDERGEFDWGGCSDNINYGIKFAKAFIDA-------------------KERTVRDA-RALMNLHNNRCGRTAVKRFMKLECKCHGVSGSCTLRTCWMAMSDFRKTGD------------FLRRKYNGAIEVTMNQDGTGFTVANKAFRKATKNDLVYFENSPDYCMQDKTVGSLGTAGRVCNKTSRGTDGCEVMCCGRGYDTTRIKQITKCEC 357          
BLAST of WntP-4 vs. Ensembl Medaka
Match: WNT7A (protein Wnt-7a [Source:NCBI gene;Acc:101174500])

HSP 1 Score: 150.984 bits (380), Expect = 1.302e-41
Identity = 96/313 (30.67%), Postives = 156/313 (49.84%), Query Frame = 3
Query:  120 FICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGC--SNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKD-QLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
             IC++I         +C  +P+ I ++       + EC  Q ++ RW+C       +F + ++  SKEAA+  A+  AGI + VT AC+RG L  C C  D+Q L    +  +   C+ +V YG SF+++F+D          ++ N +T               + L+NN V R V+ K+M  +CKC G SG+CT+K CW TLP F ++G  LK KY  A  +  +  +R ++   +    S + + P  ++ +L+++  S +YC  N  +   G  GR C   A  P SC ++CC  G+   +   V QCN
Sbjct:   36 IICNKIPGLAPRQRTICQSRPDAIIVMGEGVQMGIRECQFQFRHGRWNCSALGERTVFGRELKVGSKEAAFTYAVIAAGIAHAVTAACTRGGLSGCDCDQDKQGLYNQEEGWKWGGCSADVRYGLSFSKVFVDA-------REIKQNART--------------LMNLHNNEVGRKVLEKAMRLECKCHGVSGSCTTKTCWTTLPKFRQLGHILKEKYQQAVHVEPVRARRNKRPAFLKVRKSHLYHKP--KDTELVYIEKSPNYCEANSVMDSTGTQGRLCNRTAQQPDSCASMCCGRGYDTHQYSRVWQCN 325          
BLAST of WntP-4 vs. Ensembl Medaka
Match: wnt2ba (protein Wnt-2b-A [Source:NCBI gene;Acc:101164972])

HSP 1 Score: 150.214 bits (378), Expect = 5.350e-41
Identity = 86/318 (27.04%), Postives = 156/318 (49.06%), Query Frame = 3
Query:  123 ICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNR---LFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTY--CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDIS--LVINDPF--IEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            ICD I    +   +LC + P+++  I+      ++EC  Q +  RW+C   +R   +F +++ + S+EAA++ AI++AG+ Y +T+ACS+G+LK C C + ++ L   N  +  +  C++N+++G  F + F+D                     R+K     +  + L+NN   R  + + M+ KCKC G SG+C+ + CW  + DF   G+                K      ++M +D +  +V +  F    +++L+++  S DYC  + K G  G +GREC   + G   C  +CC  G+  +    V  C+
Sbjct:   50 ICDNIPGLVNKQRQLCQKHPDLMQSISDGAKEWIKECQHQFRQQRWNCSTMDRDHTVFGRVILRSSQEAAFVYAISSAGVVYAITRACSQGELKICSCDSHKRGLGSDNNGEFEWGGCSDNINFGIKFAKAFVDA--------------------REKMVKDARALMNLHNNRCGRMAVKRFMKLKCKCHGVSGSCSLRTCWLAMSDFRLTGD------------YLHKKYNNAIEVTMNQDGTGFMVADKDFKGSTKNELVYVESSPDYCIKDSKTGTLGTDGRECNKFSRGLDGCEVMCCGRGYDTMPVKRVTSCD 335          
BLAST of WntP-4 vs. Planmine SMEST
Match: SMESG000049719.1 (SMESG000049719.1)

HSP 1 Score: 691.034 bits (1782), Expect = 0.000e+0
Identity = 381/382 (99.74%), Postives = 381/382 (99.74%), Query Frame = 3
Query:   21 MISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCNXXXXXXXXXXXXXXXXMTTKFYCKIPQTSKKFHKYYLNG 1166
            MISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLT CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEALKNKYLNAKKLPRILKKRIRKNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCNCKFKWCCKVECEKCEKMTTKFYCKIPQTSKKFHKYYLNG
Sbjct:    1 MISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTNCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEALKNKYLNAKKLPRILKKRIRKNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCNCKFKWCCKVECEKCEKMTTKFYCKIPQTSKKFHKYYLNG 382          
BLAST of WntP-4 vs. Planmine SMEST
Match: SMESG000002069.1 (SMESG000002069.1)

HSP 1 Score: 135.961 bits (341), Expect = 4.816e-36
Identity = 92/324 (28.40%), Postives = 150/324 (46.30%), Query Frame = 3
Query:  108 NSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVEKY--------SKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTY--CNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCN 1049
            N+   IC  I  E+S    LC   P ++  I       L EC +Q KY RW+C   N+ F +I+  +         KE A+L +I ++G+ Y +T +CS+GDLK C C   +      N    T+  C++++ +G   + IFLD                       +     +  +  +NN V R V+ K+   KCKC G SGAC+ + CW+ + DF +IG+          K  ++     +K+L+  ++       P   + +L+++  S DYC  +  +G  G  GREC   +S   SC  LCC+ G +  + +V E C+
Sbjct:   44 NNIKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCT-FNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDN--------------------YDRKDQTGQTLMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGD---MLKKLYNKPQKVTYNPFQKSLTFSKN---RFRRP--SKKKLVYIDNSQDYCIQDPSIGHPGTGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCD 338          
BLAST of WntP-4 vs. Planmine SMEST
Match: SMESG000051375.1 (SMESG000051375.1)

HSP 1 Score: 127.102 bits (318), Expect = 1.592e-32
Identity = 93/341 (27.27%), Postives = 140/341 (41.06%), Query Frame = 3
Query:   99 NSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSN-----------------RLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECED---VASGPT----SCNNLCCNYGFVKVKKLVVEQCN 1049
            N+S S   IC           +LC +   ++  +       L EC  Q     W+C   N                     ++V K + EAAY++++ +AG+ + VTKACS+G    C C     D     + + + C+ N+ +G +FT  FLD P K+ +                 S+   K   +L+NNHV R  +I  M  KCKC G SG+C  K C + LPDF  +G+           L     K ++ +      I          ++ L++L  S +YC  N   G  G  GR+C +   +   P     SC  LCC  G  K     VEQC+
Sbjct:   67 NNSPSKTVICQTFSLHQR---KLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNLTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRV-----------------SKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGD----------LLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCH 377          
BLAST of WntP-4 vs. Planmine SMEST
Match: SMESG000051375.1 (SMESG000051375.1)

HSP 1 Score: 126.716 bits (317), Expect = 1.755e-32
Identity = 93/341 (27.27%), Postives = 140/341 (41.06%), Query Frame = 3
Query:   99 NSSNSTPFICDRIRFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSN-----------------RLFQQIVEKYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVINDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECED---VASGPT----SCNNLCCNYGFVKVKKLVVEQCN 1049
            N+S S   IC           +LC +   ++  +       L EC  Q     W+C   N                     ++V K + EAAY++++ +AG+ + VTKACS+G    C C     D     + + + C+ N+ +G +FT  FLD P K+ +                 S+   K   +L+NNHV R  +I  M  KCKC G SG+C  K C + LPDF  +G+           L     K ++ +      I          ++ L++L  S +YC  N   G  G  GR+C +   +   P     SC  LCC  G  K     VEQC+
Sbjct:   55 NNSPSKTVICQTFSLHQR---KLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHNLTIGGHRTKSKPRKKGKTYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRV-----------------SKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGD----------LLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCH 365          
BLAST of WntP-4 vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 125.946 bits (315), Expect = 2.802e-32
Identity = 101/345 (29.28%), Postives = 153/345 (44.35%), Query Frame = 3
Query:   90 SQKNSSNSTPFICDRI-RFENSIYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSN-----RLFQQIVEKYSK------------EAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQLTYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKIFLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEXXXXXXXXXXXXXXXXXXXXXXNLSMGEDISLVI---NDPFIEEDQLMFLRPSFDYCFPNMKLGIKGVNGRECEDVAS-----GPTSCNNLCCNYGFVKVKKLVVEQC 1046
            S K   N+T   C+++ + + SI  R     P VI+         ++EC  Q     W+C   N     R   Q  +K+ K            E+A+L ++T+A + + V+KACS G  K+C C     +    N  Q   C++NV +G +F++ FLD P                  KRK  R+     + L+N+H    ++I +M  KCKC G SG+C +K C++ LPD  K+G+ LK K+  A              L    D  LV     +  I E  L +L+ S ++C+ N   G  G  GR C +           SC +LCC  GF   + LV E+C
Sbjct:   38 STKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIH----GVDIGIQECQHQFFNSYWNCAGHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDN-FQWAGCSDNVHFGAAFSKRFLDSP-----------------HKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAI-------------LVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKC 347          
The following BLAST results are available for this feature:
BLAST of WntP-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WNT41.266e-4330.46Wnt family member 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WNT23.020e-3927.30Wnt family member 2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WNT2B1.597e-3727.85Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT162.074e-3731.33Wnt family member 16 [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT7B2.677e-3728.49Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of WntP-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cwn-12.858e-3427.30pep chromosome:WBcel235:II:130983:133598:-1 gene:W... [more]
cwn-23.304e-3227.42pep chromosome:WBcel235:IV:10067824:10070251:1 gen... [more]
egl-202.591e-3126.83Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05][more]
mom-22.108e-2624.32pep chromosome:WBcel235:V:8355988:8358185:1 gene:W... [more]
mom-22.108e-2624.32pep chromosome:WBcel235:V:8355953:8358185:1 gene:W... [more]
back to top
BLAST of WntP-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt21.006e-2928.30gene:FBgn0004360 transcript:FBtr0088512[more]
Wnt24.712e-2928.21gene:FBgn0004360 transcript:FBtr0339383[more]
wg1.609e-2427.96gene:FBgn0284084 transcript:FBtr0079432[more]
Wnt44.090e-2127.75gene:FBgn0010453 transcript:FBtr0334799[more]
Wnt44.090e-2127.75gene:FBgn0010453 transcript:FBtr0089291[more]
back to top
BLAST of WntP-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt4b2.621e-4328.61wingless-type MMTV integration site family, member... [more]
wnt4b2.621e-4328.61wingless-type MMTV integration site family, member... [more]
wnt4b2.621e-4328.61wingless-type MMTV integration site family, member... [more]
wnt4b2.621e-4328.61wingless-type MMTV integration site family, member... [more]
wnt6b3.346e-4327.65wingless-type MMTV integration site family, member... [more]
back to top
BLAST of WntP-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt43.707e-4328.94Wnt family member 4 [Source:NCBI gene;Acc:10049128... [more]
wnt44.307e-4327.97Wnt family member 4 [Source:NCBI gene;Acc:10049128... [more]
WNT23.178e-4128.26Wnt family member 2 [Source:NCBI gene;Acc:10003826... [more]
WNT25.095e-4128.26Wnt family member 2 [Source:NCBI gene;Acc:10003826... [more]
WNT2B7.217e-4028.08Wnt family member 2B [Source:NCBI gene;Acc:1004917... [more]
back to top
BLAST of WntP-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt44.101e-4330.13wingless-type MMTV integration site family, member... [more]
Wnt22.184e-4027.62wingless-type MMTV integration site family, member... [more]
Wnt165.309e-3830.97wingless-type MMTV integration site family, member... [more]
Wnt7b7.208e-3828.49wingless-type MMTV integration site family, member... [more]
Wnt2b4.454e-3727.85wingless-type MMTV integration site family, member... [more]
back to top
BLAST of WntP-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QXQ5|WNT4_RAT2.235e-4330.79Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt... [more]
sp|P56705|WNT4_HUMAN6.080e-4330.46Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1... [more]
sp|P49338|WNT4_XENLA1.136e-4228.25Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE... [more]
sp|P22724|WNT4_MOUSE2.869e-4230.13Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=... [more]
sp|P49337|WNT4_CHICK2.112e-4131.13Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=... [more]
back to top
BLAST of WntP-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3U5B30.000e+099.48Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=... [more]
A0A210PF614.470e-4530.48Protein Wnt OS=Mizuhopecten yessoensis OX=6573 GN=... [more]
A0A097ZRW57.004e-4529.91Protein Wnt OS=Euperipatoides kanangrensis OX=4885... [more]
A0A1S3HCK02.920e-4429.94Protein Wnt OS=Lingula unguis OX=7574 GN=LOC106154... [more]
A0A1S3HE002.969e-4430.06Protein Wnt OS=Lingula unguis OX=7574 GN=LOC106154... [more]
back to top
BLAST of WntP-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt4b1.370e-4127.44protein Wnt-4 [Source:NCBI gene;Acc:103021666][more]
wnt6b9.454e-4127.46Wnt family member 6 [Source:NCBI gene;Acc:10304198... [more]
wnt6a3.758e-3926.91protein Wnt-6-like [Source:NCBI gene;Acc:103038704... [more]
wnt7ba7.950e-3930.97Wnt family member 7B [Source:NCBI gene;Acc:1030284... [more]
wnt7ba8.707e-3930.97Wnt family member 7B [Source:NCBI gene;Acc:1030284... [more]
back to top
BLAST of WntP-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010914.11.448e-3329.00pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 g... [more]
wnt33.665e-3226.90wingless-type MMTV integration site family, member... [more]
ENSPMAT00000001922.11.031e-1923.79pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 ge... [more]
wnt7ba1.031e-1829.30wingless-type MMTV integration site family, member... [more]
wnt46.980e-1732.62wingless-type MMTV integration site family, member... [more]
back to top
BLAST of WntP-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WntP-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
WNT161.615e-4530.82Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S694][more]
WNT22.047e-3929.04Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5][more]
EDO310004.889e-3727.37Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54][more]
EDO494316.420e-3728.29Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9][more]
EDO373878.857e-3428.43Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SFU2][more]
back to top
BLAST of WntP-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt4b4.430e-4328.39wingless-type MMTV integration site family member ... [more]
wnt2bb8.967e-4227.59wingless-type MMTV integration site family, member... [more]
wnt2bb8.967e-4227.59wingless-type MMTV integration site family, member... [more]
WNT7A1.302e-4130.67protein Wnt-7a [Source:NCBI gene;Acc:101174500][more]
wnt2ba5.350e-4127.04protein Wnt-2b-A [Source:NCBI gene;Acc:101164972][more]
back to top
BLAST of WntP-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049719.10.000e+099.74SMESG000049719.1[more]
SMESG000002069.14.816e-3628.40SMESG000002069.1[more]
SMESG000051375.11.592e-3227.27SMESG000051375.1[more]
SMESG000051375.11.755e-3227.27SMESG000051375.1[more]
SMESG000067888.12.802e-3229.28SMESG000067888.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30031321
GenBankACJ64867.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031321 ID=SMED30031321|Name=WntP-4|organism=Schmidtea mediterranea sexual|type=transcript|length=1259bp
AAATAATTATATTTATTTTTATGATTTCTCCGTTATTCAAAATTTCTCTT
GGAAATTCCATCACAAATCTCCACCGGATAGCTATTTTATCTCAGAAAAA
TTCTTCGAATTCGACGCCATTCATTTGCGACAGGATTCGGTTTGAGAATT
CCATTTATTCAAGATTGTGCAGTGAAAAACCGGAAGTGATCAACCTGATA
GCAATGGCCACCTCTGCCGCCCTGGAAGAATGCAACAAACAGCTTAAATA
TCATCGCTGGGATTGCGGATGCTCCAATAGATTGTTTCAGCAAATTGTAG
AAAAATATTCTAAGGAGGCGGCATATTTGAATGCCATAACCACGGCTGGA
ATCACGTATTACGTAACGAAGGCCTGCAGTCGAGGAGATTTGAAATTCTG
TCAATGTAGTGCAGACCAACAAGACTTGTCCGGAATGAACAAAGACCAAT
TGACGTATTGCAATGAAAATGTGGACTATGGAAAATCATTTACGGAAATA
TTTCTCGACGGACCTGTCAAATTGTCAATTAAATCTCTTCTTAGAATGAA
TATCAAAACGAAAATGGAAAAACGAAAGAAATCGCGATCAGCTTTCAAAA
TATTTCTCGAATTGTATAATAATCATGTCGCAAGAAATGTCATAATTAAG
TCTATGGAGACCAAATGTAAGTGCCAGGGCGCTTCAGGCGCTTGTACTTC
AAAATATTGTTGGAAAACTCTGCCAGATTTTTCGAAAATTGGAGAAGCGC
TAAAAAATAAATATTTAAATGCAAAAAAGTTGCCACGTATTTTGAAAAAG
AGAATCCGAAAGAACCTGTCAATGGGCGAAGACATCAGCTTAGTAATAAA
TGATCCATTCATTGAAGAAGACCAGTTGATGTTCTTGAGACCTTCATTTG
ATTACTGTTTTCCGAATATGAAATTAGGAATCAAAGGGGTTAACGGGAGA
GAATGTGAGGACGTCGCTAGTGGTCCTACCAGTTGCAACAATCTCTGCTG
CAATTACGGATTTGTGAAAGTGAAAAAATTGGTCGTGGAACAGTGCAATT
GTAAATTCAAATGGTGCTGTAAAGTTGAATGCGAAAAATGCGAAAAGATG
ACAACAAAGTTTTACTGCAAAATCCCACAAACATCGAAGAAATTTCATAA
ATATTATCTCAATGGCTAAATTGGTTCTGCGGTTTTGATTTTTGATTTCT
ATGGGTTGCCTTTCCCTTGGGGCTTTTCTATGATTGAGATATTTTTAATG
AACCCCCCG
back to top

protein sequence of SMED30031321-orf-1

>SMED30031321-orf-1 ID=SMED30031321-orf-1|Name=SMED30031321-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=389bp
IIIFIFMISPLFKISLGNSITNLHRIAILSQKNSSNSTPFICDRIRFENS
IYSRLCSEKPEVINLIAMATSAALEECNKQLKYHRWDCGCSNRLFQQIVE
KYSKEAAYLNAITTAGITYYVTKACSRGDLKFCQCSADQQDLSGMNKDQL
TYCNENVDYGKSFTEIFLDGPVKLSIKSLLRMNIKTKMEKRKKSRSAFKI
FLELYNNHVARNVIIKSMETKCKCQGASGACTSKYCWKTLPDFSKIGEAL
KNKYLNAKKLPRILKKRIRKNLSMGEDISLVINDPFIEEDQLMFLRPSFD
YCFPNMKLGIKGVNGRECEDVASGPTSCNNLCCNYGFVKVKKLVVEQCNC
KFKWCCKVECEKCEKMTTKFYCKIPQTSKKFHKYYLNG*
back to top
Aliases
The feature 'WntP-4' has the following synonyms
Synonym
wnt11-3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000140anterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR043158Wnt_C
IPR005817Wnt
Vocabulary: biological process
TermDefinition
GO:0016055Wnt signaling pathway
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
Vocabulary: molecular function
TermDefinition
GO:0005102signaling receptor binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005817WntPRINTSPR01349WNTPROTEINcoord: 104..118
score: 41.31
coord: 223..237
score: 59.18
coord: 123..136
score: 45.78
coord: 291..302
score: 40.64
coord: 148..160
score: 30.77
IPR005817WntSMARTSM00097wnt1_3coord: 44..373
e-value: 2.6E-51
score: 186.5
IPR005817WntPFAMPF00110wntcoord: 53..373
e-value: 1.1E-78
score: 264.9
IPR005817WntPANTHERPTHR12027WNT RELATEDcoord: 40..373
IPR043158Wnt, C-terminal domainGENE3DG3DSA:3.30.2460.20coord: 313..373
e-value: 2.1E-12
score: 49.0
NoneNo IPR availablePANTHERPTHR12027:SF70PROTEIN WNT-16coord: 40..373
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.52