Secreted peptide prohormone 19

Overview
NameSecreted peptide prohormone 19
Smed IDSMED30031317
Length (bp)466
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Secreted peptide prohormone 19 (SMED30031317) t-SNE clustered cells

Violin plots show distribution of expression levels for Secreted peptide prohormone 19 (SMED30031317) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Secreted peptide prohormone 19 (SMED30031317) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Secreted peptide prohormone 19 (SMED30031317) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031317

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30031317 dd_Smed_v4_1588_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031317 dd_Smed_v4_1588_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031317 Contig35078newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031317 Contig35078uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031317 Contig33894newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30031317 GU295186smed_ncbi_20240424PMID:20967238
Collins JJ et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30031317 GU295186smed_ncbi_20240424PMID:20967238
Collins JJ et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30031317 Contig35078newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30031317 Contig35078uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
nervous systemSMED30031317 ADC84440smed_ncbi_20240424PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30031317 ADC84440smed_ncbi_20240424PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Secreted peptide prohormone 19 vs. TrEMBL
Match: E3T7U8 (Secreted peptide prohormone 19 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.162e-41
Identity = 80/122 (65.57%), Postives = 80/122 (65.57%), Query Frame = 3
Query:   24 MNGTVILCTLIVLLASFPSDGSGRLIIYQYKCFVICNSLAISICL*FTEKRI*LIIYSYFVLIDDLIVKRKHIGHQIFRLKRGYHFFRLRKDEKCLIPGELKSAIKNDLESGSNLCGSDKSF 389
            MNGTVILCTLIVLLASFP DGS                                         DDLIVKRKHIGHQIFRLKRGYHFFRLRKDEKCLIPGELKSAIKNDLESGSNLCGSDKSF
Sbjct:    1 MNGTVILCTLIVLLASFPLDGS-----------------------------------------DDLIVKRKHIGHQIFRLKRGYHFFRLRKDEKCLIPGELKSAIKNDLESGSNLCGSDKSF 81          
BLAST of Secreted peptide prohormone 19 vs. TrEMBL
Match: A0A1I8GSG1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 1.884e-7
Identity = 30/58 (51.72%), Postives = 41/58 (70.69%), Query Frame = 3
Query:  222 IVKRKHIGHQIFRLKRGYHFFRLRKDEKCLIPGELKSAIKNDL----ESGSNLCGSDK 383
            + +  H GHQIFRLK+GYHFFRL+KD++C I GE   A+  D+    +SGS LC +D+
Sbjct: 3286 LAEEGHAGHQIFRLKKGYHFFRLKKDQECAI-GEEARALLADIVKSTQSGS-LCPADR 3341          
BLAST of Secreted peptide prohormone 19 vs. TrEMBL
Match: A0A267HBD7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008027g1 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 2.015e-7
Identity = 25/56 (44.64%), Postives = 40/56 (71.43%), Query Frame = 3
Query:  222 IVKRKHIGHQIFRLKRGYHFFRLRKDEKCLIPGELKSAIKNDLESGS--NLCGSDK 383
            + +  H GHQIFRLK+GYHFFRL+KD++C I  E ++ + + ++S    +LC +D+
Sbjct:   76 LAEEGHAGHQIFRLKKGYHFFRLKKDQECAIGEEARALLADIVKSAQSGSLCPADR 131          
BLAST of Secreted peptide prohormone 19 vs. TrEMBL
Match: E3T7U7 (Gonadotropin-releasing hormone like-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 2.567e-7
Identity = 30/65 (46.15%), Postives = 36/65 (55.38%), Query Frame = 3
Query:  195 SYFVLIDDLIVKRKHIGHQIFRLKRGYHFFRLRKDEKCLIPGELKSAIKNDLESGSNLCGSDKSF 389
            SY    D L  KR H GHQ+FRLK+G+H+FRL+K   C+     K  I       S LC SD SF
Sbjct:   25 SYHFSNDWLPGKRYHTGHQMFRLKKGFHYFRLKKPSNCIFDNYFKQDILKLARKHSGLCPSDLSF 89          
BLAST of Secreted peptide prohormone 19 vs. TrEMBL
Match: A0A267F661 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008027g2 PE=4 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 4.136e-7
Identity = 30/58 (51.72%), Postives = 41/58 (70.69%), Query Frame = 3
Query:  222 IVKRKHIGHQIFRLKRGYHFFRLRKDEKCLIPGELKSAIKNDL----ESGSNLCGSDK 383
            + +  H GHQIFRLK+GYHFFRL+KD++C I GE   A+  D+    +SGS LC +D+
Sbjct:   86 LAEEGHAGHQIFRLKKGYHFFRLKKDQECAI-GEEARALLADIVKSTQSGS-LCPADR 141          
BLAST of Secreted peptide prohormone 19 vs. Planmine SMEST
Match: SMESG000053016.1 (SMESG000053016.1)

HSP 1 Score: 142.895 bits (359), Expect = 5.006e-45
Identity = 80/122 (65.57%), Postives = 80/122 (65.57%), Query Frame = 3
Query:   24 MNGTVILCTLIVLLASFPSDGSGRLIIYQYKCFVICNSLAISICL*FTEKRI*LIIYSYFVLIDDLIVKRKHIGHQIFRLKRGYHFFRLRKDEKCLIPGELKSAIKNDLESGSNLCGSDKSF 389
            MNGTVILCTLIVLLASFPSDGS                                         DDLIVKRKHIGHQIFRLKRGYHFFRLRKDEKCLIP ELKSAIKNDLESGSNLCGSDKSF
Sbjct:    1 MNGTVILCTLIVLLASFPSDGS-----------------------------------------DDLIVKRKHIGHQIFRLKRGYHFFRLRKDEKCLIPVELKSAIKNDLESGSNLCGSDKSF 81          
BLAST of Secreted peptide prohormone 19 vs. Planmine SMEST
Match: SMESG000053015.1 (SMESG000053015.1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.322e-24
Identity = 55/111 (49.55%), Postives = 57/111 (51.35%), Query Frame = 3
Query:   24 MNGTVILCTLIVLLASFPSDGSGRLIIYQYKCFVICNSLAISICL*FTEKRI*LIIYSYFVLIDDLIVKRKHIGHQIFRLKRGYHFFRLRKDEKCLIPGELKSAIKNDLES 356
            MNG VILC LIVLLASFPSDG+                                              KRK  GHQ FR+KRGY  FRL KDEKCLIPGELKSAIKNDLES
Sbjct:    1 MNGPVILCFLIVLLASFPSDGTD---------------------------------------------KRKKTGHQPFRVKRGYQCFRLGKDEKCLIPGELKSAIKNDLES 66          
BLAST of Secreted peptide prohormone 19 vs. Planmine SMEST
Match: SMESG000061019.1 (SMESG000061019.1)

HSP 1 Score: 55.8398 bits (133), Expect = 7.063e-11
Identity = 30/65 (46.15%), Postives = 36/65 (55.38%), Query Frame = 3
Query:  195 SYFVLIDDLIVKRKHIGHQIFRLKRGYHFFRLRKDEKCLIPGELKSAIKNDLESGSNLCGSDKSF 389
            SY    D L  KR H GHQ+FRLK+G+H+FRL+K   C+     K  I       S LC SD SF
Sbjct:   25 SYHFSNDWLPGKRYHTGHQMFRLKKGFHYFRLKKPSNCIFDNYFKQDILKLARKHSGLCPSDLSF 89          
BLAST of Secreted peptide prohormone 19 vs. Planmine SMEST
Match: SMESG000030647.1 (SMESG000030647.1)

HSP 1 Score: 50.447 bits (119), Expect = 5.188e-9
Identity = 20/42 (47.62%), Postives = 29/42 (69.05%), Query Frame = 3
Query:  264 KRGYHFFRLRKDEKCLIPGELKSAIKNDLESGSNLCGSDKSF 389
            KRGYHFFRL+K   C+IP  +K+ I+  +++   LC +DK F
Sbjct:   27 KRGYHFFRLKKSGDCVIPDVMKAMIETKIQNHEQLCAADKKF 68          
BLAST of Secreted peptide prohormone 19 vs. Planmine SMEST
Match: SMESG000073636.1 (SMESG000073636.1)

HSP 1 Score: 49.2914 bits (116), Expect = 1.625e-8
Identity = 22/54 (40.74%), Postives = 35/54 (64.81%), Query Frame = 3
Query:  228 KRKHIGHQIFRLKRGYHFFRLRKDEKCLIPGELKSAIKNDLESGSNLCGSDKSF 389
            KR   GH++FRLK+G+HF +L+++ +C+IP  +K  I N      N+C  D+ F
Sbjct:   28 KRALTGHRMFRLKKGFHFIKLKRNFECVIPDSVKEEIMN-----GNICLEDQEF 76          
The following BLAST results are available for this feature:
BLAST of Secreted peptide prohormone 19 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone 19 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone 19 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone 19 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone 19 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone 19 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone 19 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone 19 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E3T7U81.162e-4165.57Secreted peptide prohormone 19 OS=Schmidtea medite... [more]
A0A1I8GSG11.884e-751.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267HBD72.015e-744.64Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
E3T7U72.567e-746.15Gonadotropin-releasing hormone like-1 OS=Schmidtea... [more]
A0A267F6614.136e-751.72Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Secreted peptide prohormone 19 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone 19 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone 19 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone 19 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone 19 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secreted peptide prohormone 19 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053016.15.006e-4565.57SMESG000053016.1[more]
SMESG000053015.13.322e-2449.55SMESG000053015.1[more]
SMESG000061019.17.063e-1146.15SMESG000061019.1[more]
SMESG000030647.15.188e-947.62SMESG000030647.1[more]
SMESG000073636.11.625e-840.74SMESG000073636.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031317 ID=SMED30031317|Name=Secreted peptide prohormone 19|organism=Schmidtea mediterranea sexual|type=transcript|length=466bp
AAGAACAAATTAGCTTTTCAATAATGAATGGAACGGTTATACTTTGCACT
TTGATCGTGCTCCTTGCGTCATTTCCCTCAGACGGATCAGGTAGGTTAAT
TATTTACCAATACAAGTGCTTTGTAATTTGTAATTCACTAGCTATTAGTA
TTTGTTTATAATTCACTGAGAAAAGGATTTAATTAATTATTTATTCTTAT
TTTGTTTTAATAGATGACTTGATAGTTAAACGGAAGCACATTGGTCATCA
AATATTTAGACTGAAACGTGGATATCACTTTTTTAGATTGAGAAAAGACG
AAAAATGCCTGATTCCTGGGGAATTGAAATCAGCAATTAAAAATGATCTG
GAATCAGGATCAAACTTATGTGGATCAGACAAATCGTTTCTTGCTGAGCT
GGCATCATTGTTATGATAATTACAGATACCTTTTATAATTAAATTAAATA
AAGTTTAATTTATTTT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0002089reproductive organ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..30
score: 0.7
NoneNo IPR availableTMHMMTMhelixcoord: 5..22
NoneNo IPR availableTMHMMTMhelixcoord: 32..51