Mediator of RNA polymerase II transcription subunit 19

Overview
NameMediator of RNA polymerase II transcription subunit 19
Smed IDSMED30031314
Length (bp)1062
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mediator of RNA polymerase II transcription subunit 19 (SMED30031314) t-SNE clustered cells

Violin plots show distribution of expression levels for Mediator of RNA polymerase II transcription subunit 19 (SMED30031314) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mediator of RNA polymerase II transcription subunit 19 (SMED30031314) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mediator of RNA polymerase II transcription subunit 19 (SMED30031314) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031314

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30031314h1SMcG0003379 dd_Smed_v4_4283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Human
Match: MED19 (mediator complex subunit 19 [Source:HGNC Symbol;Acc:HGNC:29600])

HSP 1 Score: 92.0485 bits (227), Expect = 2.640e-21
Identity = 53/143 (37.06%), Postives = 72/143 (50.35%), Query Frame = 2
Query:  155 SVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTPNAIVVDDKSKHRSSE 583
            S A CGPFYL+     S+               LTG+TNLITHY L   Y+KFCGK  KE LS+FLP++ G +D+P S + SSL SL  KPP+          ++   FRL+   LP+  +    Q P         + R+ +
Sbjct:   75 SGAGCGPFYLMRELPGSTE--------------LTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQD 203          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Human
Match: MED19 (mediator complex subunit 19 [Source:HGNC Symbol;Acc:HGNC:29600])

HSP 1 Score: 91.2781 bits (225), Expect = 3.086e-21
Identity = 53/143 (37.06%), Postives = 72/143 (50.35%), Query Frame = 2
Query:  155 SVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTPNAIVVDDKSKHRSSE 583
            S A CGPFYL+     S+               LTG+TNLITHY L   Y+KFCGK  KE LS+FLP++ G +D+P S + SSL SL  KPP+          ++   FRL+   LP+  +    Q P         + R+ +
Sbjct:   58 SGAGCGPFYLMRELPGSTE--------------LTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQD 186          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Human
Match: MED19 (mediator complex subunit 19 [Source:HGNC Symbol;Acc:HGNC:29600])

HSP 1 Score: 91.2781 bits (225), Expect = 3.086e-21
Identity = 53/143 (37.06%), Postives = 72/143 (50.35%), Query Frame = 2
Query:  155 SVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTPNAIVVDDKSKHRSSE 583
            S A CGPFYL+     S+               LTG+TNLITHY L   Y+KFCGK  KE LS+FLP++ G +D+P S + SSL SL  KPP+          ++   FRL+   LP+  +    Q P         + R+ +
Sbjct:   58 SGAGCGPFYLMRELPGSTE--------------LTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQD 186          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Human
Match: MED19 (mediator complex subunit 19 [Source:HGNC Symbol;Acc:HGNC:29600])

HSP 1 Score: 92.4337 bits (228), Expect = 5.676e-21
Identity = 52/130 (40.00%), Postives = 69/130 (53.08%), Query Frame = 2
Query:  149 NWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTP 538
            + S A CGPFYL+     S+               LTG+TNLITHY L   Y+KFCGK  KE LS+FLP++ G +D+P S + SSL SL  KPP+          ++   FRL+   LP+  +    Q P
Sbjct:   73 DKSGAGCGPFYLMRELPGSTE--------------LTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPP 188          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Human
Match: MED19 (mediator complex subunit 19 [Source:HGNC Symbol;Acc:HGNC:29600])

HSP 1 Score: 92.0485 bits (227), Expect = 5.756e-21
Identity = 52/130 (40.00%), Postives = 69/130 (53.08%), Query Frame = 2
Query:  149 NWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTP 538
            + S A CGPFYL+     S+               LTG+TNLITHY L   Y+KFCGK  KE LS+FLP++ G +D+P S + SSL SL  KPP+          ++   FRL+   LP+  +    Q P
Sbjct:   56 DKSGAGCGPFYLMRELPGSTE--------------LTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPP 171          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Celegans
Match: mdt-19 (Mediator of RNA polymerase II transcription subunit 19 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4F2])

HSP 1 Score: 56.225 bits (134), Expect = 4.168e-9
Identity = 42/146 (28.77%), Postives = 71/146 (48.63%), Query Frame = 2
Query:  254 LTGATNLITHYGLLSTYHKFCG-KPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTPNAIVVDDKSKHRSSENRKRKRRDSNLTHS--LNELATTNQISANNADTNQ 682
            + G  +L+  Y L      F G +  KE +SSFLP+I G   + A++  SSL +L  KPP+ K+IS  +++S+   F+L                 +A  VD++ +H      +R++ + NL +S  LN +    Q  A   D ++
Sbjct:   35 IQGNHDLLMSYELGPVEGGFSGSRRVKEKISSFLPHIIGEFHLDATKEASSLRALIEKPPIHKEISNLTSSSMQ-GFKL-----------------SAGPVDERYRHLF----ERRKEEPNLAYSEKLNLIRVRQQYDAYGFDDDE 158          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Zebrafish
Match: med19a (mediator complex subunit 19a [Source:NCBI gene;Acc:767651])

HSP 1 Score: 83.9593 bits (206), Expect = 2.921e-18
Identity = 43/85 (50.59%), Postives = 54/85 (63.53%), Query Frame = 2
Query:  254 LTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQ 508
            LTG TNLITHY L   Y+KFCGK  KE LS+FLP + G +D P  ++GSSL SL  KPPV  +  +    +L   FRL+   LP+
Sbjct:   78 LTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGVQDGSSLRSLIEKPPVCGNSFSPLTGALLTGFRLHTGPLPE 162          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Zebrafish
Match: med19a (mediator complex subunit 19a [Source:NCBI gene;Acc:767651])

HSP 1 Score: 83.9593 bits (206), Expect = 2.921e-18
Identity = 43/85 (50.59%), Postives = 54/85 (63.53%), Query Frame = 2
Query:  254 LTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQ 508
            LTG TNLITHY L   Y+KFCGK  KE LS+FLP + G +D P  ++GSSL SL  KPPV  +  +    +L   FRL+   LP+
Sbjct:   78 LTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGVQDGSSLRSLIEKPPVCGNSFSPLTGALLTGFRLHTGPLPE 162          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Zebrafish
Match: med19b (mediator complex subunit 19b [Source:NCBI gene;Acc:445021])

HSP 1 Score: 80.4925 bits (197), Expect = 4.923e-17
Identity = 43/95 (45.26%), Postives = 56/95 (58.95%), Query Frame = 2
Query:  254 LTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTP 538
            LTG TNLITHY L   Y+KFCGK  KE LS+FLP + G +D P  ++ SSL SL  KPPV  +  +    ++   FRL+   LP+  +    Q P
Sbjct:   74 LTGHTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDSPGIQDNSSLRSLIEKPPVCNNSFSPLTGAMLTGFRLHTGPLPEQYRLMHIQPP 168          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Zebrafish
Match: med19b (mediator complex subunit 19b [Source:NCBI gene;Acc:445021])

HSP 1 Score: 75.0998 bits (183), Expect = 5.267e-15
Identity = 39/79 (49.37%), Postives = 50/79 (63.29%), Query Frame = 2
Query:  254 LTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLY 490
            LTG TNLITHY L   Y+KFCGK  KE LS+FLP + G +D P  ++ SSL SL  KPPV  +  +    ++   FRL+
Sbjct:   74 LTGHTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDSPGIQDNSSLRSLIEKPPVCNNSFSPLTGAMLTGFRLH 152          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Xenopus
Match: tnrc18 (zinc finger protein 469 [Source:Xenbase;Acc:XB-GENE-6458544])

HSP 1 Score: 82.0333 bits (201), Expect = 2.184e-17
Identity = 47/123 (38.21%), Postives = 66/123 (53.66%), Query Frame = 2
Query:  170 GPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTP 538
            GPFY++          +P  S       LTG+ NLI HY L  ++ KFCGK  KE LS+FLP++ G +D P +++ SSL SL  KPP+  +  T    +L   FRL+   LP+  +    Q P
Sbjct:   72 GPFYIL--------RELPGLSD------LTGSVNLILHYNLEHSFSKFCGKKMKEKLSNFLPDLPGMIDTPGAQDNSSLRSLIEKPPICGNSFTPLTGALLTGFRLHTGPLPEQCRLMHIQPP 180          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Xenopus
Match: tnrc18 (zinc finger protein 469 [Source:Xenbase;Acc:XB-GENE-6458544])

HSP 1 Score: 81.2629 bits (199), Expect = 3.024e-17
Identity = 47/123 (38.21%), Postives = 66/123 (53.66%), Query Frame = 2
Query:  170 GPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTP 538
            GPFY++          +P  S       LTG+ NLI HY L  ++ KFCGK  KE LS+FLP++ G +D P +++ SSL SL  KPP+  +  T    +L   FRL+   LP+  +    Q P
Sbjct:   72 GPFYIL--------RELPGLSD------LTGSVNLILHYNLEHSFSKFCGKKMKEKLSNFLPDLPGMIDTPGAQDNSSLRSLIEKPPICGNSFTPLTGALLTGFRLHTGPLPEQCRLMHIQPP 180          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Mouse
Match: Med19 (mediator complex subunit 19 [Source:MGI Symbol;Acc:MGI:1914234])

HSP 1 Score: 88.9669 bits (219), Expect = 5.500e-20
Identity = 51/130 (39.23%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  149 NWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTP 538
            + S A  GPFYL+     S+               LTG+TNLITHY L   Y+KFCGK  KE LS+FLP++ G +D+P S + SSL SL  KPP+          ++   FRL+   LP+  +    Q P
Sbjct:   56 DKSTAGSGPFYLMRELPGSTE--------------LTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLSGFRLHTGPLPEQCRLMHIQPP 171          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. UniProt/SwissProt
Match: sp|A0JLT2|MED19_HUMAN (Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 2.764e-20
Identity = 52/130 (40.00%), Postives = 69/130 (53.08%), Query Frame = 2
Query:  149 NWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTP 538
            + S A CGPFYL+     S+               LTG+TNLITHY L   Y+KFCGK  KE LS+FLP++ G +D+P S + SSL SL  KPP+          ++   FRL+   LP+  +    Q P
Sbjct:   56 DKSGAGCGPFYLMRELPGSTE--------------LTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPP 171          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. UniProt/SwissProt
Match: sp|Q8C1S0|MED19_MOUSE (Mediator of RNA polymerase II transcription subunit 19 OS=Mus musculus OX=10090 GN=Med19 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 3.847e-19
Identity = 51/130 (39.23%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  149 NWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTP 538
            + S A  GPFYL+     S+               LTG+TNLITHY L   Y+KFCGK  KE LS+FLP++ G +D+P S + SSL SL  KPP+          ++   FRL+   LP+  +    Q P
Sbjct:   56 DKSTAGSGPFYLMRELPGSTE--------------LTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLSGFRLHTGPLPEQCRLMHIQPP 171          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. UniProt/SwissProt
Match: sp|Q174D3|MED19_AEDAE (Mediator of RNA polymerase II transcription subunit 19 OS=Aedes aegypti OX=7159 GN=MED19 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.023e-18
Identity = 53/122 (43.44%), Postives = 67/122 (54.92%), Query Frame = 2
Query:  146 NNWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPV-QKDISTFSNNSLTDAFRLYNEKLPQ 508
             N S+   GPFYL+           P   GE     LTGATNL+ HYGL  +Y KF GK  KE LSSFLPN+ G +D P   + SSL S+  KPP+  KD+   ++  L   FRL+   LP+
Sbjct:   55 KNPSIVHSGPFYLMKE---------PPGEGE-----LTGATNLMAHYGLEHSYSKFSGKKVKEQLSSFLPNLPGVIDGPGHLDNSSLRSVIEKPPIGGKDLLPLTSVQLA-GFRLHPGPLPE 161          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. UniProt/SwissProt
Match: sp|Q08C81|MD19A_DANRE (Mediator of RNA polymerase II transcription subunit 19-A OS=Danio rerio OX=7955 GN=med19a PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.205e-17
Identity = 43/85 (50.59%), Postives = 54/85 (63.53%), Query Frame = 2
Query:  254 LTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQ 508
            LTG TNLITHY L   Y+KFCGK  KE LS+FLP + G +D P  ++GSSL SL  KPPV  +  +    +L   FRL+   LP+
Sbjct:   78 LTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGVQDGSSLRSLIEKPPVCGNSFSPLTGALLTGFRLHTGPLPE 162          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. UniProt/SwissProt
Match: sp|Q07FY3|MED19_XENTR (Mediator of RNA polymerase II transcription subunit 19 OS=Xenopus tropicalis OX=8364 GN=med19 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.157e-16
Identity = 47/123 (38.21%), Postives = 66/123 (53.66%), Query Frame = 2
Query:  170 GPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTP 538
            GPFY++          +P  S       LTG+ NLI HY L  ++ KFCGK  KE LS+FLP++ G +D P +++ SSL SL  KPP+  +  T    +L   FRL+   LP+  +    Q P
Sbjct:   72 GPFYIL--------RELPGLSD------LTGSVNLILHYNLEHSFSKFCGKKMKEKLSNFLPDLPGMIDTPGAQDNSSLRSLIEKPPICGNSFTPLTGALLTGFRLHTGPLPEQCRLMHIQPP 180          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. TrEMBL
Match: A0A4S2M0T9 (Mediator of RNA polymerase II transcription subunit 19 OS=Opisthorchis felineus OX=147828 GN=MED19 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 2.734e-33
Identity = 75/169 (44.38%), Postives = 103/169 (60.95%), Query Frame = 2
Query:  113 LNKLKIVGNGMNNWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQ-KDISTFSNNSLTDAFRLYNEKLPQ-CAQWFSNQTPNAIVVDDKSKHRSSENRKRKRRDSN 613
            +NKLKIVG+G +NW+VA C PFYL+ T+        P T  E     LTGA NLI HYGL + Y KFC K  +E LS+FLP+++GN+D+PA+ +GS LMSL  +PP++ K++  F+   L  AFRL+   LPQ  A  F+   PN      K  HRS++    +   +N
Sbjct:   28 INKLKIVGSG-HNWAVAPCEPFYLMGTEP-------PATDAE-----LTGAKNLIEHYGLGNAYQKFCSKSLREELSAFLPHLSGNVDVPATVDGSGLMSLIERPPIRGKELRLFAPGQLDHAFRLHPGPLPQEYAALFAAAPPNP---SSKHAHRSTQPGATEAPGTN 180          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. TrEMBL
Match: A0A3R7EXT5 (Mediator of RNA polymerase II transcription subunit 19 OS=Clonorchis sinensis OX=79923 GN=MED19 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 2.824e-33
Identity = 75/169 (44.38%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  113 LNKLKIVGNGMNNWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQ-KDISTFSNNSLTDAFRLYNEKLPQ-CAQWFSNQTPNAIVVDDKSKHRSSENRKRKRRDSN 613
            +NKLKIVG+G +NW+VA C PFYL+ T+        P T  E     LTGA NLI HYGL + Y KFC K  +E LS+FLP+++GN+D+PA+ +GS LMSL  +PP++ K++  F+   L  AFRL+   LPQ  A  F+   PN    + K  HRS++    +   +N
Sbjct:   28 INKLKIVGSG-HNWAVAPCEPFYLMGTEP-------PATDAE-----LTGAKNLIEHYGLGNAYQKFCSKSLREELSAFLPHLSGNVDVPATVDGSGLMSLIERPPIRGKELRLFAPGQLDHAFRLHPGPLPQEYAALFAAAPPNP---NSKHTHRSTQPGATEAPGTN 180          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. TrEMBL
Match: G7YPP5 (Mediator of RNA polymerase II transcription subunit 19 OS=Clonorchis sinensis OX=79923 GN=MED19 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 3.034e-33
Identity = 75/169 (44.38%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  113 LNKLKIVGNGMNNWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQ-KDISTFSNNSLTDAFRLYNEKLPQ-CAQWFSNQTPNAIVVDDKSKHRSSENRKRKRRDSN 613
            +NKLKIVG+G +NW+VA C PFYL+ T+        P T  E     LTGA NLI HYGL + Y KFC K  +E LS+FLP+++GN+D+PA+ +GS LMSL  +PP++ K++  F+   L  AFRL+   LPQ  A  F+   PN    + K  HRS++    +   +N
Sbjct:   28 INKLKIVGSG-HNWAVAPCEPFYLMGTEP-------PATDAE-----LTGAKNLIEHYGLGNAYQKFCSKSLREELSAFLPHLSGNVDVPATVDGSGLMSLIERPPIRGKELRLFAPGQLDHAFRLHPGPLPQEYAALFAAAPPNP---NSKHTHRSTQPGATEAPGTN 180          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. TrEMBL
Match: A0A5J4ND20 (Mediator of RNA polymerase II transcription subunit 19 OS=Paragonimus westermani OX=34504 GN=MED19 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 3.705e-33
Identity = 72/159 (45.28%), Postives = 99/159 (62.26%), Query Frame = 2
Query:  113 LNKLKIVGNGMNNWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQ-KDISTFSNNSLTDAFRLYNEKLPQ-CAQWFSNQTPNAIVVDDKSKHRSSE 583
            +NKLKIVG+G  NW+VA C PFYL+ T+  +                LTGA NLI HYGL + Y KFC KP +E LS+FLP+++GN+D+PAS +GS LMSL  +PP++ K++  F+ + L  AFRL+   LPQ  A  F+   P+A     +  HRS +
Sbjct:   31 INKLKIVGSG-QNWAVAPCEPFYLMGTEPPAPDAA------------LTGAKNLIEHYGLGNAYQKFCSKPLREELSAFLPHLSGNVDVPASADGSGLMSLIERPPIRGKELRLFAPSQLDHAFRLHPGPLPQEYASLFAAAAPSA-----RHSHRSMQ 171          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. TrEMBL
Match: A0A1S8WM62 (Mediator of RNA polymerase II transcription subunit 19 OS=Opisthorchis viverrini OX=6198 GN=MED19 PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 4.296e-33
Identity = 75/169 (44.38%), Postives = 103/169 (60.95%), Query Frame = 2
Query:  113 LNKLKIVGNGMNNWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQ-KDISTFSNNSLTDAFRLYNEKLPQ-CAQWFSNQTPNAIVVDDKSKHRSSENRKRKRRDSN 613
            +NKLKIVG+G +NW+VA C PFYL+ T+        P T  E     LTGA NLI HYGL + Y KFC K  +E LS+FLP+++GN+D+PA+ +GS LMSL  +PP++ K++  F+   L  AFRL+   LPQ  A  F+   PN      K  HRS++    +   +N
Sbjct:   28 INKLKIVGSG-HNWAVAPCEPFYLMGTEP-------PATDAE-----LTGAKNLIEHYGLGNAYQKFCSKSLREELSAFLPHLSGNVDVPATVDGSGLMSLIERPPIRGKELRLFAPGQLDHAFRLHPGPLPQEYAALFAAAPPNP---SSKHTHRSTQPGATEAPGTN 180          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Cavefish
Match: med19a (mediator of RNA polymerase II transcription subunit 19-A [Source:NCBI gene;Acc:103033238])

HSP 1 Score: 85.1149 bits (209), Expect = 9.247e-19
Identity = 45/95 (47.37%), Postives = 57/95 (60.00%), Query Frame = 2
Query:  254 LTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTP 538
            LTG TNLITHY L   Y+KFCGK  KE LS+FLP + G +D P  ++GSSL SL  KPPV  +  +    +L   FRL+   LP+  +    Q P
Sbjct:   77 LTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGVQDGSSLRSLIEKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPP 171          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Cavefish
Match: med19a (mediator of RNA polymerase II transcription subunit 19-A [Source:NCBI gene;Acc:103033238])

HSP 1 Score: 84.3445 bits (207), Expect = 1.336e-18
Identity = 45/95 (47.37%), Postives = 57/95 (60.00%), Query Frame = 2
Query:  254 LTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTP 538
            LTG TNLITHY L   Y+KFCGK  KE LS+FLP + G +D P  ++GSSL SL  KPPV  +  +    +L   FRL+   LP+  +    Q P
Sbjct:   77 LTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGVQDGSSLRSLIEKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPP 171          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Cavefish
Match: med19b (mediator complex subunit 19 [Source:NCBI gene;Acc:103047628])

HSP 1 Score: 82.4185 bits (202), Expect = 7.353e-18
Identity = 44/95 (46.32%), Postives = 57/95 (60.00%), Query Frame = 2
Query:  254 LTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTP 538
            LTG TNLITHY L   Y+KFCGK  KE LS+FLP + G +D P  ++GSSL SL  KPPV  +  +    ++   FRL+   LP+  +    Q P
Sbjct:   79 LTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDNPGLQDGSSLRSLIEKPPVCNNSFSPLTGAMLTGFRLHTGPLPEQYRLMHIQPP 173          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Nematostella
Match: EDO47496 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLX2])

HSP 1 Score: 61.6178 bits (148), Expect = 3.598e-11
Identity = 39/123 (31.71%), Postives = 67/123 (54.47%), Query Frame = 2
Query:  176 FYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGS---SLMSLSNKPPV-QKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQ 532
            FYL+  +  + T+             + G++NL+   GL  +Y KFCGK  KE LS+FLP++ G +D    E G+   SL S+ +KPP+  K++    +++L+  FRL    +P+  ++ + Q
Sbjct:   20 FYLLRNEPPTPTD-------------INGSSNLLVQNGLEQSYQKFCGKKVKENLSAFLPHLPGYID----EKGTPENSLRSVIDKPPIGGKELLPLPSHALS-GFRLNPGPIPEQFRFMTQQ 124          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Medaka
Match: MED19 (mediator complex subunit 19 [Source:NCBI gene;Acc:101157547])

HSP 1 Score: 85.1149 bits (209), Expect = 8.746e-19
Identity = 44/95 (46.32%), Postives = 59/95 (62.11%), Query Frame = 2
Query:  254 LTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTP 538
            LTG TNLITHY L   Y+KFCGK  KE LS+FLP + G +D P +++GSSL SL +KPPV  +  +    ++   FRL+   LP+  +    Q P
Sbjct:   78 LTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDSPGTQDGSSLRSLIDKPPVCGNSFSPLTGTMLTGFRLHTGPLPEQYRLMHIQPP 172          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Planmine SMEST
Match: SMESG000036767.1 (SMESG000036767.1)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 278/279 (99.64%), Postives = 278/279 (99.64%), Query Frame = 2
Query:   20 MSKNDVSDIFQKQSGYENSSGNQSSVAQYPRLNKLKIVGNGMNNWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTPNAIVVDDKSKHRSSENRKRKRRDSNLTHSLNELATTNQISANNADTNQLLINPASNVHDSNSQHGVSMTTKSNSGDNLNKMISPGSSSFSNQNLPPVVISPLTIKP 856
            MSKNDVSDIFQKQSGYENSSGNQSSVAQYPRLNKLKIVGNGMNNWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTPNAIVVDDKSKHRSSENRKRKRRDSNLTHSLNELATTNQISANNADTNQLLINPASNVHDSNSQHGVSMT KSNSGDNLNKMISPGSSSFSNQNLPPVVISPLTIKP
Sbjct:    1 MSKNDVSDIFQKQSGYENSSGNQSSVAQYPRLNKLKIVGNGMNNWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTPNAIVVDDKSKHRSSENRKRKRRDSNLTHSLNELATTNQISANNADTNQLLINPASNVHDSNSQHGVSMTAKSNSGDNLNKMISPGSSSFSNQNLPPVVISPLTIKP 279          
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Planmine SMEST
Match: SMESG000036748.1 (SMESG000036748.1)

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 277/279 (99.28%), Postives = 278/279 (99.64%), Query Frame = 2
Query:   20 MSKNDVSDIFQKQSGYENSSGNQSSVAQYPRLNKLKIVGNGMNNWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTPNAIVVDDKSKHRSSENRKRKRRDSNLTHSLNELATTNQISANNADTNQLLINPASNVHDSNSQHGVSMTTKSNSGDNLNKMISPGSSSFSNQNLPPVVISPLTIKP 856
            MSKNDVSDIFQKQSGYENSSGNQSSVAQYPRLNKLKIVGNGMNNWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTPNAIVVDDKSKHRSSENRKRKRR+SNLTHSLNELATTNQISANNADTNQLLINPASNVHDSNSQHGVSMT KSNSGDNLNKMISPGSSSFSNQNLPPVVISPLTIKP
Sbjct:    1 MSKNDVSDIFQKQSGYENSSGNQSSVAQYPRLNKLKIVGNGMNNWSVATCGPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCGKPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSLTDAFRLYNEKLPQCAQWFSNQTPNAIVVDDKSKHRSSENRKRKRRNSNLTHSLNELATTNQISANNADTNQLLINPASNVHDSNSQHGVSMTAKSNSGDNLNKMISPGSSSFSNQNLPPVVISPLTIKP 279          
The following BLAST results are available for this feature:
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MED192.640e-2137.06mediator complex subunit 19 [Source:HGNC Symbol;Ac... [more]
MED193.086e-2137.06mediator complex subunit 19 [Source:HGNC Symbol;Ac... [more]
MED193.086e-2137.06mediator complex subunit 19 [Source:HGNC Symbol;Ac... [more]
MED195.676e-2140.00mediator complex subunit 19 [Source:HGNC Symbol;Ac... [more]
MED195.756e-2140.00mediator complex subunit 19 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mdt-194.168e-928.77Mediator of RNA polymerase II transcription subuni... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
med19a2.921e-1850.59mediator complex subunit 19a [Source:NCBI gene;Acc... [more]
med19a2.921e-1850.59mediator complex subunit 19a [Source:NCBI gene;Acc... [more]
med19b4.923e-1745.26mediator complex subunit 19b [Source:NCBI gene;Acc... [more]
med19b5.267e-1549.37mediator complex subunit 19b [Source:NCBI gene;Acc... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tnrc182.184e-1738.21zinc finger protein 469 [Source:Xenbase;Acc:XB-GEN... [more]
tnrc183.024e-1738.21zinc finger protein 469 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Med195.500e-2039.23mediator complex subunit 19 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0JLT2|MED19_HUMAN2.764e-2040.00Mediator of RNA polymerase II transcription subuni... [more]
sp|Q8C1S0|MED19_MOUSE3.847e-1939.23Mediator of RNA polymerase II transcription subuni... [more]
sp|Q174D3|MED19_AEDAE3.023e-1843.44Mediator of RNA polymerase II transcription subuni... [more]
sp|Q08C81|MD19A_DANRE2.205e-1750.59Mediator of RNA polymerase II transcription subuni... [more]
sp|Q07FY3|MED19_XENTR1.157e-1638.21Mediator of RNA polymerase II transcription subuni... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M0T92.734e-3344.38Mediator of RNA polymerase II transcription subuni... [more]
A0A3R7EXT52.824e-3344.38Mediator of RNA polymerase II transcription subuni... [more]
G7YPP53.034e-3344.38Mediator of RNA polymerase II transcription subuni... [more]
A0A5J4ND203.705e-3345.28Mediator of RNA polymerase II transcription subuni... [more]
A0A1S8WM624.296e-3344.38Mediator of RNA polymerase II transcription subuni... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
med19a9.247e-1947.37mediator of RNA polymerase II transcription subuni... [more]
med19a1.336e-1847.37mediator of RNA polymerase II transcription subuni... [more]
med19b7.353e-1846.32mediator complex subunit 19 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO474963.598e-1131.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MED198.746e-1946.32mediator complex subunit 19 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Mediator of RNA polymerase II transcription subunit 19 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000036767.10.000e+099.64SMESG000036767.1[more]
SMESG000036748.10.000e+099.28SMESG000036748.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031314 ID=SMED30031314|Name=Mediator of RNA polymerase II transcription subunit 19|organism=Schmidtea mediterranea sexual|type=transcript|length=1062bp
TATATAAATCTTATATGATATGTCGAAAAATGATGTATCTGATATATTTC
AGAAACAAAGTGGTTACGAAAATTCATCAGGGAATCAATCTTCAGTCGCA
CAATATCCTCGATTGAATAAACTTAAAATAGTTGGTAATGGAATGAATAA
TTGGTCTGTAGCCACTTGCGGTCCATTTTACTTGATTGATACTGATCAGA
GTTCTTCAACAAATACCATTCCAATTACCTCCGGTGAATCTGCAACCCAA
CCATTAACAGGAGCAACGAATTTAATTACTCATTACGGACTGTTGAGTAC
ATATCACAAATTTTGTGGAAAGCCATTTAAAGAAACTCTTAGTTCTTTCC
TGCCTAATATCACTGGTAATCTCGATATACCTGCATCGGAAAATGGAAGT
AGTTTAATGAGCCTGTCAAATAAGCCTCCTGTTCAAAAAGATATATCGAC
TTTCTCAAACAATAGTTTAACAGACGCCTTTCGGTTGTACAATGAAAAGT
TACCACAATGTGCTCAGTGGTTCAGTAACCAAACTCCAAATGCTATTGTT
GTTGATGATAAAAGTAAGCACAGGAGTTCTGAAAATAGGAAACGCAAACG
TCGTGATTCAAATTTAACACACAGTCTCAATGAACTGGCAACCACCAATC
AGATTTCCGCCAATAATGCCGATACCAATCAATTATTGATCAATCCAGCC
TCGAATGTTCACGACAGCAACTCTCAGCACGGCGTCTCAATGACTACCAA
ATCTAATTCCGGTGACAATCTCAATAAAATGATTTCTCCGGGATCTAGTT
CATTTTCTAATCAAAATCTTCCTCCGGTTGTAATTTCCCCCTTGACTATA
AAACCGAAAAAAGCTAAAAGATCAGATGACGAGGAGAAAAGGAAAAAGAA
GAAAAAAGATAAGAAAAAGAAAAGAGAAAGAAATATTGATTGATTTGAAT
ATTTTTGAAGTTTATGTCTGATTGTTAAAAACTCCTGAACTTTTTGTGAA
TAAAATTATTTTGATTATTTATGCTGTTTTTCAAGATTTATTTTTAGTGT
TCTCAAAATGCA
back to top

protein sequence of SMED30031314-orf-1

>SMED30031314-orf-1 ID=SMED30031314-orf-1|Name=SMED30031314-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=308bp
MSKNDVSDIFQKQSGYENSSGNQSSVAQYPRLNKLKIVGNGMNNWSVATC
GPFYLIDTDQSSSTNTIPITSGESATQPLTGATNLITHYGLLSTYHKFCG
KPFKETLSSFLPNITGNLDIPASENGSSLMSLSNKPPVQKDISTFSNNSL
TDAFRLYNEKLPQCAQWFSNQTPNAIVVDDKSKHRSSENRKRKRRDSNLT
HSLNELATTNQISANNADTNQLLINPASNVHDSNSQHGVSMTTKSNSGDN
LNKMISPGSSSFSNQNLPPVVISPLTIKPKKAKRSDDEEKRKKKKKDKKK
KRERNID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003712transcription cofactor activity
GO:0001104RNA polymerase II transcription cofactor activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0016592mediator complex
Vocabulary: INTERPRO
TermDefinition
IPR019403Mediator_Med19_met
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter