nuclear protein MDM1-like isoform X1

Overview
Namenuclear protein MDM1-like isoform X1
Smed IDSMED30031309
Length (bp)2031
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nuclear protein MDM1-like isoform X1 (SMED30031309) t-SNE clustered cells

Violin plots show distribution of expression levels for nuclear protein MDM1-like isoform X1 (SMED30031309) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of nuclear protein MDM1-like isoform X1 (SMED30031309) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for nuclear protein MDM1-like isoform X1 (SMED30031309) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031309

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30031309SMESG000058479.1 SmedASXL_016829SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031309SMESG000058479.1 dd_Smed_v4_10635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031309SMESG000058479.1 dd_Smed_v4_10635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031309SMESG000058479.1 dd_Smed_v4_10635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031309SMESG000058479.1 dd_Smed_v4_10635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031309SMESG000058479.1 dd_Smed_v4_10635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30031309SMESG000058479.1 dd_Smed_v4_10635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30031309SMESG000058479.1 Contig48316newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031309SMESG000058479.1 Contig48316uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30031309SMESG000058479.1 dd_Smed_v6_10635_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30031309SMESG000058479.1 dd_Smed_v4_10635_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031309SMESG000058479.1 dd_Smed_v4_10635_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Human
Match: MDM1 (Mdm1 nuclear protein [Source:HGNC Symbol;Acc:HGNC:29917])

HSP 1 Score: 52.7582 bits (125), Expect = 2.141e-6
Identity = 28/89 (31.46%), Postives = 46/89 (51.69%), Query Frame = 1
Query:  979 HGKSKRFDTEYSANF---------DNKWKNLENELDKSREENEARQSNQQSKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTKFN 1218
            H +  + ++EY A F            W +++         N   Q +  + W+ E+ ELR+KA+ YR+R +GTHFSR+HL +I +  N
Sbjct:  253 HQRLGKVNSEYRAKFLSPAQYLYKAGAWTHVKG--------NMPNQGSLNAMWYAEVKELREKAEFYRKRVQGTHFSRDHLNQILSDSN 333          
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Xenopus
Match: psmb7 (proteasome (prosome, macropain) subunit, beta type, 7 [Source:Xenbase;Acc:XB-GENE-946042])

HSP 1 Score: 50.8322 bits (120), Expect = 7.445e-6
Identity = 33/98 (33.67%), Postives = 51/98 (52.04%), Query Frame = 1
Query:  988 SKRFDTEYSANFDNKWKNLENELDKSREENEARQSNQQ----SKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTKFNKSSIDDYQDNDHLSEQI 1269
             +R  +EY++NF +  + L  +    R + +  + +      + W  EI ELR+KA  YR+R +GTHFSR HL +I +  NK    D   N    EQ+
Sbjct:  312 CRRIKSEYTSNFLSPSEYLYKDGAWVRAKKQMHEQDSHLPLGALWVAEINELREKADYYRRREQGTHFSRNHLNQILSVNNK--FWDVSSNSSSEEQV 407          
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Mouse
Match: Mdm1 (transformed mouse 3T3 cell double minute 1 [Source:MGI Symbol;Acc:MGI:96951])

HSP 1 Score: 56.6102 bits (135), Expect = 9.126e-8
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 1
Query:  979 HGKSKRFDTEYSANFDNKWKNLENELDKSR-EENEARQSNQQSKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTKFN 1218
            H +  + ++EY A F +  +        +R +EN + Q +  + W+ E+ ELR+KA+ YR+R +GTHFSR+HL +I +  N
Sbjct:  254 HQRLGKVNSEYRAKFLSPAQYFYKAGAWTRVKENLSNQGSLNAMWYAEVKELREKAESYRKRVQGTHFSRDHLNQIMSDSN 334          
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Mouse
Match: Mdm1 (transformed mouse 3T3 cell double minute 1 [Source:MGI Symbol;Acc:MGI:96951])

HSP 1 Score: 56.6102 bits (135), Expect = 1.042e-7
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 1
Query:  979 HGKSKRFDTEYSANFDNKWKNLENELDKSR-EENEARQSNQQSKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTKFN 1218
            H +  + ++EY A F +  +        +R +EN + Q +  + W+ E+ ELR+KA+ YR+R +GTHFSR+HL +I +  N
Sbjct:  299 HQRLGKVNSEYRAKFLSPAQYFYKAGAWTRVKENLSNQGSLNAMWYAEVKELREKAESYRKRVQGTHFSRDHLNQIMSDSN 379          
BLAST of nuclear protein MDM1-like isoform X1 vs. UniProt/SwissProt
Match: sp|Q5ZMW6|MDM1_CHICK (Nuclear protein MDM1 OS=Gallus gallus OX=9031 GN=MDM1 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.216e-8
Identity = 41/118 (34.75%), Postives = 57/118 (48.31%), Query Frame = 1
Query:  943 HETMNPQRLHLPHGKSKRFDTEYSANF---------DNKWKNLENELDKSREENEARQSNQQSKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTKFNKSSIDDYQDNDHLSEQI 1269
            H +  P  LH   GK    +TEY + F         D  W  +     +S+  N+A Q+   S W+ E+ ELR +A+ YRQR  GTHFSR HL ++ +  N  S+ D   N    E I
Sbjct:  242 HISQKPLSLHTHRGK---MNTEYRSKFLSPAQYFYKDGAWSRI-----RSKVPNQASQNPLNSMWYMEVRELRARAKAYRQRIEGTHFSRYHLNQLLSDNN--SLWDVSSNSSSEEGI 349          
BLAST of nuclear protein MDM1-like isoform X1 vs. UniProt/SwissProt
Match: sp|Q5PQN4|MDM1_RAT (Nuclear protein MDM1 OS=Rattus norvegicus OX=10116 GN=Mdm1 PE=1 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 6.091e-7
Identity = 29/81 (35.80%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  979 HGKSKRFDTEYSANFDNKWKNLENELDKSR-EENEARQSNQQSKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTKFN 1218
            H +  + ++EY A F +  + L      +R +E+ + Q +  + W+ E+ ELR+KA+ YR+R +GTHFSR+HL +I +  N
Sbjct:  298 HQRLGKVNSEYRAKFLSPAQYLYKAGAWTRVKESLSHQGSLNAMWYAEVKELREKAESYRKRVQGTHFSRDHLNQIMSDSN 378          
BLAST of nuclear protein MDM1-like isoform X1 vs. UniProt/SwissProt
Match: sp|Q5RC32|MDM1_PONAB (Nuclear protein MDM1 OS=Pongo abelii OX=9601 GN=MDM1 PE=2 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 2.392e-6
Identity = 56/204 (27.45%), Postives = 104/204 (50.98%), Query Frame = 1
Query:  631 TEYQTKYAWREPLAKQSQ---EHNKTSENQSKFDLKLKIYNNFL--SEYQQQFRPYEFVNENRFKRMMTAHEKNPTETHLQIIPDNRDHGRRAITPPPRLHYKDKLVASHETMNPQRLHLP--HGKSKRFDTEYSANFDNKWKNLENELDKSR-EENEARQSNQQSKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTKFN 1218
            +EYQ ++ W+   +K++      N+   N+S+F    K  N+ +  +EY++ F+    V E + +  +   E    ET   + P+ + +    I  P +L  + +L   H+   P++   P  H +  + ++EY A F +  + L      +R + N   Q +  + W+ E+ ELR+KA+ YR+R +GTHFSR+HL +I +  N
Sbjct:  189 SEYQRQFVWK--TSKETAPAFSANQVFHNKSQFVPPFK-GNSIIHETEYKRNFKGLSPVKEPKLRNDL--RENRNLET---VSPEKKSN---KIDDPLKLEAEMELKDLHQ---PKKKLAPWKHQRLGKVNSEYRAKFLSPAQYLYKAGAWTRVKGNMPNQGSLNAMWYAEVKELREKAEFYRKRVQGTHFSRDHLNQILSDSN 378          
BLAST of nuclear protein MDM1-like isoform X1 vs. TrEMBL
Match: A0A1S3H0L5 (serine/arginine repetitive matrix protein 1 OS=Lingula unguis OX=7574 GN=LOC106150973 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.431e-16
Identity = 69/228 (30.26%), Postives = 112/228 (49.12%), Query Frame = 1
Query:  631 TEYQTKYAWREPLAKQSQEHNKTSENQSKFDLKLKIYNNF--LSEYQQQFRPY-EFV-------NENRFKRMMTAHE--KNPTETHLQIIPDNRDHGRRAITPPPRLHY----KDKLVASHETMNPQRLHLPHGKSKRFDTEYSANF---------DNKWKNL---------ENELDKSREENEARQSNQQSKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTK 1212
            +EYQ +++W++P+        +     S  DL     +N    +EY  QF+P+ +F        +EN  +     H+  ++ +E  L++ PD R        PP  +H      DK +   E++NPQR+  PHGK + + +EY +NF         D  W+           ENE D +    +    +  + WF E++ELRKKA+EYR+R +GTHFSREHL ++  +
Sbjct:  202 SEYQKEFSWKKPVESVPLLQAEQVVYNSSMDLPPYKSDNIPRTTEYNNQFKPWTDFYKPVEPKKSENGPEGGRKKHKMKRSKSEAELRLSPDKR--------PPAGIHQVTSPDDKRLVK-ESLNPQRIFFPHGKYRNYRSEYHSNFRPPWKYTYEDGAWRGANPPHIMPVKENESD-AEAGQQPPPPSPGANWFAEVVELRKKAEEYRKRAQGTHFSREHLAQLLAQ 419          
BLAST of nuclear protein MDM1-like isoform X1 vs. TrEMBL
Match: A0A1S3H4F2 (nuclear protein MDM1-like isoform X3 OS=Lingula unguis OX=7574 GN=LOC106151943 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.070e-16
Identity = 69/227 (30.40%), Postives = 111/227 (48.90%), Query Frame = 1
Query:  631 TEYQTKYAWREPLAKQSQEHNKTSENQSKFDLKLKIYNNF--LSEYQQQFRPY-EFVNENRFKRMMTAHE---------KNPTETHLQIIPDNRDHGRRAITPPPRLHY----KDKLVASHETMNPQRLHLPHGKSKRFDTEYSANF---------DNKWKNLENELDKSREENEAR-QSNQQ-------SKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTK 1212
            +EYQ +++W++P+        +     S  DL     +N    +EY  QF+P+ +F      K+     E         ++ +E  L++ PD R        PP  +H      DK +   E++NPQR+  PHGK + + +EY +NF         D  W+          +ENE+  ++ QQ       + WF E++ELRKKA+EYR+R +GTHFSREHL ++  +
Sbjct:  216 SEYQKEFSWKKPVESVPLLQAEQVVYNSSMDLPPYKSDNIPRTTEYNNQFKPWTDFYKPVEPKKTENGPEGGRKKHKMKRSKSEAELRLSPDKR--------PPAGIHQVTSPDDKRLV-KESLNPQRIFFPHGKYRNYRSEYHSNFRPPWKYTYEDGAWRGANPPHIMPVKENESDPEAGQQPPPPSPGANWFAEVVELRKKAEEYRKRAQGTHFSREHLAQLLAQ 433          
BLAST of nuclear protein MDM1-like isoform X1 vs. TrEMBL
Match: A0A1S3H3X5 (nuclear protein MDM1-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106151943 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.453e-16
Identity = 69/227 (30.40%), Postives = 111/227 (48.90%), Query Frame = 1
Query:  631 TEYQTKYAWREPLAKQSQEHNKTSENQSKFDLKLKIYNNF--LSEYQQQFRPY-EFVNENRFKRMMTAHE---------KNPTETHLQIIPDNRDHGRRAITPPPRLHY----KDKLVASHETMNPQRLHLPHGKSKRFDTEYSANF---------DNKWKNLENELDKSREENEAR-QSNQQ-------SKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTK 1212
            +EYQ +++W++P+        +     S  DL     +N    +EY  QF+P+ +F      K+     E         ++ +E  L++ PD R        PP  +H      DK +   E++NPQR+  PHGK + + +EY +NF         D  W+          +ENE+  ++ QQ       + WF E++ELRKKA+EYR+R +GTHFSREHL ++  +
Sbjct:  250 SEYQKEFSWKKPVESVPLLQAEQVVYNSSMDLPPYKSDNIPRTTEYNNQFKPWTDFYKPVEPKKTENGPEGGRKKHKMKRSKSEAELRLSPDKR--------PPAGIHQVTSPDDKRLV-KESLNPQRIFFPHGKYRNYRSEYHSNFRPPWKYTYEDGAWRGANPPHIMPVKENESDPEAGQQPPPPSPGANWFAEVVELRKKAEEYRKRAQGTHFSREHLAQLLAQ 467          
BLAST of nuclear protein MDM1-like isoform X1 vs. TrEMBL
Match: A0A1S3H5U0 (nuclear protein MDM1-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106151943 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 3.598e-16
Identity = 69/227 (30.40%), Postives = 111/227 (48.90%), Query Frame = 1
Query:  631 TEYQTKYAWREPLAKQSQEHNKTSENQSKFDLKLKIYNNF--LSEYQQQFRPY-EFVNENRFKRMMTAHE---------KNPTETHLQIIPDNRDHGRRAITPPPRLHY----KDKLVASHETMNPQRLHLPHGKSKRFDTEYSANF---------DNKWKNLENELDKSREENEA-RQSNQQ-------SKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTK 1212
            +EYQ +++W++P+        +     S  DL     +N    +EY  QF+P+ +F      K+     E         ++ +E  L++ PD R        PP  +H      DK +   E++NPQR+  PHGK + + +EY +NF         D  W+          +ENE+  ++ QQ       + WF E++ELRKKA+EYR+R +GTHFSREHL ++  +
Sbjct:  248 SEYQKEFSWKKPVESVPLLQAEQVVYNSSMDLPPYKSDNIPRTTEYNNQFKPWTDFYKPVEPKKTENGPEGGRKKHKMKRSKSEAELRLSPDKR--------PPAGIHQVTSPDDKRLV-KESLNPQRIFFPHGKYRNYRSEYHSNFRPPWKYTYEDGAWRGANPPHIMPVKENESDPEAGQQPPPPSPGANWFAEVVELRKKAEEYRKRAQGTHFSREHLAQLLAQ 465          
BLAST of nuclear protein MDM1-like isoform X1 vs. TrEMBL
Match: R7UH63 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_223023 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.772e-13
Identity = 79/277 (28.52%), Postives = 120/277 (43.32%), Query Frame = 1
Query:  520 IPKDEGLIEKKPKKTDQISREMK-----------NKVSSPYSMPTPAQTEYQTKYAWRE-----PLAKQSQEHNKTSENQSKFDLKLKIYNNFLSEYQQQFRPYEFVNENRFKRMMTAHEKNPTETHLQIIPDNRDHGRRAITPPPRLH-----YKDKLVASHETMNPQRLHLPHGKSKRFDTEYSANF---------DNKWKNLENELDKSREENEARQSNQQSKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTKFNKSSIDDYQDNDHLS 1260
            + K+E LI ++ +K  +I ++ K           + V+ P S      +EYQ ++ W +     PL    Q  +K++     +  +     N  SEY  QF+ Y+ V      R   A  K        + PD+         PP  L+     +  +LV   E++NP     PHGK K  ++EY  NF         D  W  +     +   E EA +    + W+ E++ELRKKA EYR R RGTHFSR HL +++ + N    D Y     LS
Sbjct:  347 LAKEEDLIRRQVEKEREIEQKKKALKGNYAMKYRSGVAPPRSRGPKRLSEYQLQFKWMKGVANSPLLAADQVVHKSNTQIGPYKTETA---NKKSEYATQFKQYQPVQSAEPARK-PAKVKRSRSLEAVVSPDH--------LPPAGLNRVTADFDPRLV--QESLNPNHFSFPHGKFKSSNSEYHRNFRPPKDYVYQDGAWGGVVPPRVEPVMEPEAEEGAPTNSWYSEVMELRKKAAEYRLRARGTHFSRSHLAQLYAQ-NAELWDSYSVVSALS 608          
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Cavefish
Match: mdm1 (Mdm1 nuclear protein [Source:NCBI gene;Acc:557148])

HSP 1 Score: 51.9878 bits (123), Expect = 1.801e-6
Identity = 26/78 (33.33%), Postives = 47/78 (60.26%), Query Frame = 1
Query:  991 KRFDTEYSANFDN--KWKNLENELDKSREENEARQSNQQSKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTKFN 1218
            ++  TEY++NF +  +++  +    +SR   E     +  +W+ E+ +LR KA  YR+R  GTHFSR+HL ++ ++ N
Sbjct:  260 RKVKTEYTSNFRSPLQYRYKDGAWIRSRVSGE-----EGHEWYHEVQDLRAKADAYRKRAWGTHFSRQHLSQVISEQN 332          
BLAST of nuclear protein MDM1-like isoform X1 vs. Planmine SMEST
Match: SMESG000058479.1 (SMESG000058479.1)

HSP 1 Score: 1100.5 bits (2845), Expect = 0.000e+0
Identity = 599/603 (99.34%), Postives = 602/603 (99.83%), Query Frame = 1
Query:   46 MIKSEYERSYQWNPPGGEHYSKNLKNKNKFSEPIMTHKRRVKVTEDNVIIGEPLPTQNNEIIKEDPYFVLGDKTKKFHPSIPYRNMKALDKAKIENKHTNKTNYKIKKIPENPNFSKDDNRNEXXXXXXXXFISEAVQTENDEVEGQIKAKVDTSIQSIPKDEGLIEKKPKKTDQISREMKNKVSSPYSMPTPAQTEYQTKYAWREPLAKQSQEHNKTSENQSKFDLKLKIYNNFLSEYQQQFRPYEFVNENRFKRMMTAHEKNPTETHLQIIPDNRDHGRRAITPPPRLHYKDKLVASHETMNPQRLHLPHGKSKRFDTEYSANFDNKWKNLENELDKSREENEARQSNQQSKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTKFNKSSIDDYQDNDHLSEQIDRRNNHRNQSPIVKRSKSFHHSRRIEPSQTIPNQYNRQKNSSSIEETILTPXXXXXXXXXTIVRKSSRSNSRSPEPKYLNWQQRSAGKPSFDNNLLLDEEASHDTEIKDDFKFNEPLRPSFSNAPEKEYTFQKYFNENPERSKNMRTIDYDXXXXXXXXXXXXXXXXXXXXXXXXXXXLALETLERAKRNRDEIF 1854
            MIKSEYERSYQW PPGGEHYSKNLKNKNKFSEPIMTHKRRVKVTEDNVIIGEPLPTQNNEIIKEDPYFVLGDKTKKFHPSIPYRNMKALDKAKIENKHTNKTNYKIKKIPENPNFSKDDNR+EKKKPKKIKFISEAVQTENDEVEGQIKAKVDTSIQSIPKDEGLIEKKPKKTDQ+SREMKNKVSSPYSMPTPAQTEYQTKYAWREPLAKQSQEHNKTSENQSKFDLKLKIYNNFLSEYQQQFRPYEFVNENRFKRMMTAHEKNPTETHLQIIPDNRDHGRRAITPPPRLHYKDKLVASHETMNPQRLHLPHGKSKRFDTEYSANFDNKWKNLENELDKSREENEARQSNQQSKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTKFNKSSIDDYQDNDHLSEQIDRRNNHRNQSPIVKRSKSFHHSRRIEPSQTIPNQYNRQKNSSSIEETILTPSSGRSSSGSTIVRKSSRSNSRSPEP+YLNWQQRSAGKPSFDNNLLLDEEASHDTEIKDDFKFNEPLRPSFSNAPEKEYTFQKYFNENPERSKNMRTIDYDTVIKSSSVSKMSSVRSVISTSSRSSRSLALETLERAKRNRDEIF
Sbjct:    1 MIKSEYERSYQWTPPGGEHYSKNLKNKNKFSEPIMTHKRRVKVTEDNVIIGEPLPTQNNEIIKEDPYFVLGDKTKKFHPSIPYRNMKALDKAKIENKHTNKTNYKIKKIPENPNFSKDDNRDEKKKPKKIKFISEAVQTENDEVEGQIKAKVDTSIQSIPKDEGLIEKKPKKTDQMSREMKNKVSSPYSMPTPAQTEYQTKYAWREPLAKQSQEHNKTSENQSKFDLKLKIYNNFLSEYQQQFRPYEFVNENRFKRMMTAHEKNPTETHLQIIPDNRDHGRRAITPPPRLHYKDKLVASHETMNPQRLHLPHGKSKRFDTEYSANFDNKWKNLENELDKSREENEARQSNQQSKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTKFNKSSIDDYQDNDHLSEQIDRRNNHRNQSPIVKRSKSFHHSRRIEPSQTIPNQYNRQKNSSSIEETILTPSSGRSSSGSTIVRKSSRSNSRSPEPRYLNWQQRSAGKPSFDNNLLLDEEASHDTEIKDDFKFNEPLRPSFSNAPEKEYTFQKYFNENPERSKNMRTIDYDTVIKSSSVSKMSSVRSVISTSSRSSRSLALETLERAKRNRDEIF 603          
The following BLAST results are available for this feature:
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MDM12.141e-631.46Mdm1 nuclear protein [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
psmb77.445e-633.67proteasome (prosome, macropain) subunit, beta type... [more]
back to top
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mdm19.126e-835.80transformed mouse 3T3 cell double minute 1 [Source... [more]
Mdm11.042e-735.80transformed mouse 3T3 cell double minute 1 [Source... [more]
back to top
BLAST of nuclear protein MDM1-like isoform X1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q5ZMW6|MDM1_CHICK1.216e-834.75Nuclear protein MDM1 OS=Gallus gallus OX=9031 GN=M... [more]
sp|Q5PQN4|MDM1_RAT6.091e-735.80Nuclear protein MDM1 OS=Rattus norvegicus OX=10116... [more]
sp|Q5RC32|MDM1_PONAB2.392e-627.45Nuclear protein MDM1 OS=Pongo abelii OX=9601 GN=MD... [more]
back to top
BLAST of nuclear protein MDM1-like isoform X1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H0L51.431e-1630.26serine/arginine repetitive matrix protein 1 OS=Lin... [more]
A0A1S3H4F23.070e-1630.40nuclear protein MDM1-like isoform X3 OS=Lingula un... [more]
A0A1S3H3X53.453e-1630.40nuclear protein MDM1-like isoform X1 OS=Lingula un... [more]
A0A1S3H5U03.598e-1630.40nuclear protein MDM1-like isoform X2 OS=Lingula un... [more]
R7UH631.772e-1328.52Uncharacterized protein (Fragment) OS=Capitella te... [more]
back to top
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mdm11.801e-633.33Mdm1 nuclear protein [Source:NCBI gene;Acc:557148][more]
back to top
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear protein MDM1-like isoform X1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nuclear protein MDM1-like isoform X1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000058479.10.000e+099.34SMESG000058479.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031309 ID=SMED30031309|Name=nuclear protein MDM1-like isoform X1|organism=Schmidtea mediterranea sexual|type=transcript|length=2031bp
CTTTTTTTTGATATTATTTAATTTTCAGGAATTATTTAATTTTAGATGAT
AAAAAGTGAGTATGAAAGATCCTATCAGTGGAATCCGCCGGGAGGAGAGC
ATTACTCTAAAAATTTGAAAAATAAAAACAAATTTTCAGAACCAATTATG
ACCCATAAAAGACGAGTCAAAGTTACTGAAGACAATGTTATAATCGGTGA
GCCATTACCAACACAAAATAATGAAATAATAAAAGAAGATCCTTATTTTG
TGTTAGGAGATAAAACTAAAAAATTTCATCCTTCAATTCCCTATAGAAAC
ATGAAAGCCTTAGACAAAGCTAAAATTGAAAATAAACATACAAACAAAAC
CAATTATAAAATAAAGAAAATTCCAGAAAACCCTAATTTTTCAAAAGATG
ATAATAGAAATGAGAAAAAGAAACCTAAAAAAATTAAGTTTATTAGTGAA
GCTGTACAAACAGAAAATGATGAAGTTGAAGGGCAAATCAAAGCAAAAGT
AGACACGTCAATCCAATCAATACCAAAAGATGAGGGACTGATTGAGAAAA
AGCCTAAAAAAACTGATCAAATATCAAGAGAAATGAAAAATAAGGTTTCC
TCTCCTTATTCAATGCCCACACCGGCACAAACCGAATATCAAACAAAATA
CGCATGGCGAGAACCTCTTGCCAAACAATCTCAGGAACATAATAAAACTT
CAGAAAATCAATCGAAGTTTGATTTGAAATTAAAAATTTACAATAATTTT
CTCTCGGAATACCAACAACAATTTCGTCCGTACGAATTTGTCAATGAAAA
CCGATTCAAGCGAATGATGACAGCACATGAAAAAAATCCCACCGAAACAC
ATTTACAAATCATTCCTGATAATCGTGACCACGGTCGACGGGCTATCACC
CCTCCCCCAAGATTGCATTACAAAGATAAATTAGTCGCCTCACATGAAAC
CATGAACCCGCAGCGGTTGCATTTGCCACATGGTAAATCCAAACGATTTG
ATACAGAATATTCAGCAAATTTTGACAATAAATGGAAAAATCTCGAAAAT
GAACTGGATAAAAGTCGAGAAGAAAACGAAGCAAGACAGTCTAATCAACA
ATCAAAATGGTTTAAAGAGATTCTCGAATTGAGAAAAAAAGCACAAGAAT
ATCGACAGAGGACAAGAGGAACTCACTTTTCAAGAGAACATTTGGGGGAG
ATTTTTACGAAATTTAACAAGTCAAGCATCGATGATTATCAAGACAATGA
TCATCTATCTGAACAAATAGACAGGAGAAATAACCATAGAAATCAAAGTC
CGATTGTTAAAAGAAGTAAAAGTTTTCATCACTCAAGACGAATTGAACCA
TCACAAACAATACCGAACCAATATAATAGACAGAAGAATTCATCTAGCAT
AGAAGAAACAATTCTTACGCCATCATCTGGTCGCAGCTCAAGTGGATCAA
CAATAGTTAGAAAATCTAGCAGGAGCAACTCACGAAGTCCCGAACCGAAG
TATTTGAATTGGCAACAAAGAAGCGCTGGTAAACCGTCTTTTGATAATAA
TTTACTATTGGATGAAGAAGCTTCTCATGATACGGAAATCAAAGATGATT
TCAAATTCAATGAACCCCTTCGGCCGAGTTTCAGTAATGCGCCGGAAAAG
GAGTACACATTTCAAAAGTATTTCAATGAAAATCCCGAACGAAGCAAAAA
CATGCGAACGATTGATTATGACACTGTGATTAAAAGTAGTTCTGTCAGTA
AAATGTCATCAGTGAGATCTGTAATATCTACTAGCAGTCGCAGTAGCAGG
AGTCTAGCTTTGGAAACATTGGAAAGAGCTAAACGGAATCGAGATGAGAT
TTTCGATCGAAATCGTAAACAAAATCACCCACATTAATGCTTTATTACAT
TAAACATATCGAAAATTTATTATCATCCGACTCAGAATTACACATATTGG
ATTTATATTGCGATTCATTTTATATACTTTTAGTTTTTTTCTTAATTTTT
GTTAGTAATATTATTATTCAATAAATTCCAG
back to top

protein sequence of SMED30031309-orf-1

>SMED30031309-orf-1 ID=SMED30031309-orf-1|Name=SMED30031309-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=614bp
MIKSEYERSYQWNPPGGEHYSKNLKNKNKFSEPIMTHKRRVKVTEDNVII
GEPLPTQNNEIIKEDPYFVLGDKTKKFHPSIPYRNMKALDKAKIENKHTN
KTNYKIKKIPENPNFSKDDNRNEKKKPKKIKFISEAVQTENDEVEGQIKA
KVDTSIQSIPKDEGLIEKKPKKTDQISREMKNKVSSPYSMPTPAQTEYQT
KYAWREPLAKQSQEHNKTSENQSKFDLKLKIYNNFLSEYQQQFRPYEFVN
ENRFKRMMTAHEKNPTETHLQIIPDNRDHGRRAITPPPRLHYKDKLVASH
ETMNPQRLHLPHGKSKRFDTEYSANFDNKWKNLENELDKSREENEARQSN
QQSKWFKEILELRKKAQEYRQRTRGTHFSREHLGEIFTKFNKSSIDDYQD
NDHLSEQIDRRNNHRNQSPIVKRSKSFHHSRRIEPSQTIPNQYNRQKNSS
SIEETILTPSSGRSSSGSTIVRKSSRSNSRSPEPKYLNWQQRSAGKPSFD
NNLLLDEEASHDTEIKDDFKFNEPLRPSFSNAPEKEYTFQKYFNENPERS
KNMRTIDYDTVIKSSSVSKMSSVRSVISTSSRSSRSLALETLERAKRNRD
EIFDRNRKQNHPH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029136MDM1
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
Vocabulary: biological process
TermDefinition
GO:0046600negative regulation of centriole replication