Reticulon-like protein

Overview
NameReticulon-like protein
Smed IDSMED30031297
Length (bp)1080
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Reticulon-like protein (SMED30031297) t-SNE clustered cells

Violin plots show distribution of expression levels for Reticulon-like protein (SMED30031297) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Reticulon-like protein (SMED30031297) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Reticulon-like protein (SMED30031297) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN4 (reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085])

HSP 1 Score: 103.99 bits (258), Expect = 9.511e-26
Identity = 55/184 (29.89%), Postives = 102/184 (55.43%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHL 703
            K++D++ WR+  KT  +  + L L +SL  FS++SV AY  L  L V  SFR+Y           + +  + YL+ ++ +++     ++   +G V+  + ++R L L++D  +SLK  V ++  TY+GA FN +TL IL  + +F VP IY+ +Q ++D+   L    +   ++++  K+  L
Sbjct:   11 KVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGL 194          
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN4 (reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085])

HSP 1 Score: 108.612 bits (270), Expect = 3.737e-25
Identity = 62/202 (30.69%), Postives = 111/202 (54.95%), Query Frame = 2
Query:  119 SDTEH-----SAV-ENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY---MKFSGQSDNNF-IQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            SDTE      SA+   E     ++D++ WR+  KT  +  + L L +SL  FS++SV AY  L  L V  SFR+Y   ++   +SD     + YL+ ++ +++     ++   +G V+  + ++R L L++D  +SLK  V ++  TY+GA FN +TL IL  + +F VP IY+ +Q ++D+   L    +   ++++  K+
Sbjct:  983 SDTEKEDRSPSAIFSAELSKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKI 1184          
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN3 (reticulon 3 [Source:HGNC Symbol;Acc:HGNC:10469])

HSP 1 Score: 102.834 bits (255), Expect = 8.170e-25
Identity = 58/181 (32.04%), Postives = 101/181 (55.80%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            ++ D+I WR+  KT  +  + L + +SL  FSVISV++Y  L  L V  SFR+Y           + +  + YLD DI ++      +    +  ++  +  I  L L+ED  +SLKL VF++ MTY+GA FN +TL IL  L++F VP +Y+ Y+ ++D+   +  ++   ++ ++  K+
Sbjct:   66 QVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKL 246          
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN4 (reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085])

HSP 1 Score: 101.293 bits (251), Expect = 9.849e-25
Identity = 55/169 (32.54%), Postives = 96/169 (56.80%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNK 658
             ++D++ WR+  KT  +  + L L +SL  FS++SV AY  L  L V  SFR+Y           + +  + YL+ ++ +++     ++   +G V+  + ++R L L++D  +SLK  V ++  TY+GA FN +TL IL  + +F VP IY+ +Q ++D+ Y  L NK
Sbjct:   28 PVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDH-YLGLANK 195          
BLAST of Reticulon-like protein vs. Ensembl Human
Match: RTN3 (reticulon 3 [Source:HGNC Symbol;Acc:HGNC:10469])

HSP 1 Score: 102.064 bits (253), Expect = 1.160e-24
Identity = 58/180 (32.22%), Postives = 100/180 (55.56%), Query Frame = 2
Query:  167 ILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            + D+I WR+  KT  +  + L + +SL  FSVISV++Y  L  L V  SFR+Y           + +  + YLD DI ++      +    +  ++  +  I  L L+ED  +SLKL VF++ MTY+GA FN +TL IL  L++F VP +Y+ Y+ ++D+   +  ++   ++ ++  K+
Sbjct:   48 VHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKL 227          
BLAST of Reticulon-like protein vs. Ensembl Celegans
Match: ret-1 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECZ2])

HSP 1 Score: 81.2629 bits (199), Expect = 1.188e-17
Identity = 61/196 (31.12%), Postives = 105/196 (53.57%), Query Frame = 2
Query:  152 AKDF--KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQ-----SDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADK---MRHLPV 709
            A DF  KILD+I WR+  K+A +L   L +   L  + +++V+ Y+ L  L  A  FR++ K   Q     S++ F ++ L +D+ + + K  A  + F+        K++ L+ +E   ES+K G+ L+ +TYI + F+  TL IL  L VF VPK+Y++ Q  +D     ++  +  V + + +K   +R  PV
Sbjct:   20 ATDFPGKILDVIYWRDAKKSAIVLSLALLVLFVLAKYPLLTVVTYSLLLALGAAAGFRVFKKVEAQIKKTDSEHPFSEI-LAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQNIIDEKLPFLRSAPV 214          
BLAST of Reticulon-like protein vs. Ensembl Celegans
Match: ret-1 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECZ2])

HSP 1 Score: 79.337 bits (194), Expect = 3.160e-17
Identity = 57/190 (30.00%), Postives = 102/190 (53.68%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQ-----SDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADK---MRHLPV 709
            K+LD+I WR+  K+A +L   L +   L  + +++V+ Y+ L  L  A  FR++ K   Q     S++ F ++ L +D+ + + K  A  + F+        K++ L+ +E   ES+K G+ L+ +TYI + F+  TL IL  L VF VPK+Y++ Q  +D     ++  +  V + + +K   +R  PV
Sbjct:    8 KVLDVIYWRDAKKSAIVLSLALLVLFVLAKYPLLTVVTYSLLLALGAAAGFRVFKKVEAQIKKTDSEHPFSEI-LAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQNIIDEKLPFLRSAPV 196          
BLAST of Reticulon-like protein vs. Ensembl Celegans
Match: ret-1 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECZ2])

HSP 1 Score: 77.411 bits (189), Expect = 3.687e-16
Identity = 56/190 (29.47%), Postives = 102/190 (53.68%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQ-----SDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADK---MRHLPV 709
            ++LD+I WR+  K+A +L   L +   L  + +++V+ Y+ L  L  A  FR++ K   Q     S++ F ++ L +D+ + + K  A  + F+        K++ L+ +E   ES+K G+ L+ +TYI + F+  TL IL  L VF VPK+Y++ Q  +D     ++  +  V + + +K   +R  PV
Sbjct:   56 EVLDVIYWRDAKKSAIVLSLALLVLFVLAKYPLLTVVTYSLLLALGAAAGFRVFKKVEAQIKKTDSEHPFSEI-LAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQNIIDEKLPFLRSAPV 244          
BLAST of Reticulon-like protein vs. Ensembl Celegans
Match: ret-1 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECZ2])

HSP 1 Score: 77.411 bits (189), Expect = 3.687e-16
Identity = 56/190 (29.47%), Postives = 102/190 (53.68%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQ-----SDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADK---MRHLPV 709
            ++LD+I WR+  K+A +L   L +   L  + +++V+ Y+ L  L  A  FR++ K   Q     S++ F ++ L +D+ + + K  A  + F+        K++ L+ +E   ES+K G+ L+ +TYI + F+  TL IL  L VF VPK+Y++ Q  +D     ++  +  V + + +K   +R  PV
Sbjct:   56 EVLDVIYWRDAKKSAIVLSLALLVLFVLAKYPLLTVVTYSLLLALGAAAGFRVFKKVEAQIKKTDSEHPFSEI-LAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQNIIDEKLPFLRSAPV 244          
BLAST of Reticulon-like protein vs. Ensembl Celegans
Match: ret-1 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:G5ECZ2])

HSP 1 Score: 76.6406 bits (187), Expect = 3.694e-15
Identity = 59/197 (29.95%), Postives = 104/197 (52.79%), Query Frame = 2
Query:  158 DFK-----ILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQ-----SDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADK---MRHLPV 709
            DFK     +LD+I WR+  K+A +L   L +   L  + +++V+ Y+ L  L  A  FR++ K   Q     S++ F ++ L +D+ + + K  A  + F+        K++ L+ +E   ES+K G+ L+ +TYI + F+  TL IL  L VF VPK+Y++ Q  +D     ++  +  V + + +K   +R  PV
Sbjct:  291 DFKTVPPCVLDVIYWRDAKKSAIVLSLALLVLFVLAKYPLLTVVTYSLLLALGAAAGFRVFKKVEAQIKKTDSEHPFSEI-LAQDLTLPQEKVHAQADVFVEHATCIANKLKKLVFVESPLESIKFGLVLWSLTYIASWFSGFTLAILGLLGVFSVPKVYESNQEAIDPHLATISGHLKNVQNIIDEKLPFLRSAPV 486          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0079043)

HSP 1 Score: 93.2041 bits (230), Expect = 4.069e-22
Identity = 57/184 (30.98%), Postives = 98/184 (53.26%), Query Frame = 2
Query:  176 IILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQ----SDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIG 715
            +I WR+  K+  +  + L    ++  FSVISV AY  L  L    +FR+Y   +      ++ +  + YL+ D+ ++  K        +  ++ F+ ++R L L+ED  +S+K GV L+  TY+GA FN MTL IL  + +F +PK+Y+  +  +D    L+ +K    L+ + DK+R    IG
Sbjct:    9 LIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSK----LTEITDKIRVAIPIG 188          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0079040)

HSP 1 Score: 93.5893 bits (231), Expect = 7.187e-22
Identity = 57/188 (30.32%), Postives = 100/188 (53.19%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQ----SDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIG 715
            ++  +I WR+  K+  +  + L    ++  FSVISV AY  L  L    +FR+Y   +      ++ +  + YL+ D+ ++  K        +  ++ F+ ++R L L+ED  +S+K GV L+  TY+GA FN MTL IL  + +F +PK+Y+  +  +D    L+ +K    L+ + DK+R    IG
Sbjct:   37 QVESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSK----LTEITDKIRVAIPIG 220          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0301540)

HSP 1 Score: 93.5893 bits (231), Expect = 7.187e-22
Identity = 57/188 (30.32%), Postives = 100/188 (53.19%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQ----SDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIG 715
            ++  +I WR+  K+  +  + L    ++  FSVISV AY  L  L    +FR+Y   +      ++ +  + YL+ D+ ++  K        +  ++ F+ ++R L L+ED  +S+K GV L+  TY+GA FN MTL IL  + +F +PK+Y+  +  +D    L+ +K    L+ + DK+R    IG
Sbjct:   37 QVESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSK----LTEITDKIRVAIPIG 220          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0301539)

HSP 1 Score: 93.5893 bits (231), Expect = 7.187e-22
Identity = 57/188 (30.32%), Postives = 100/188 (53.19%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQ----SDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIG 715
            ++  +I WR+  K+  +  + L    ++  FSVISV AY  L  L    +FR+Y   +      ++ +  + YL+ D+ ++  K        +  ++ F+ ++R L L+ED  +S+K GV L+  TY+GA FN MTL IL  + +F +PK+Y+  +  +D    L+ +K    L+ + DK+R    IG
Sbjct:   37 QVESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSK----LTEITDKIRVAIPIG 220          
BLAST of Reticulon-like protein vs. Ensembl Fly
Match: Rtnl1 (gene:FBgn0053113 transcript:FBtr0079039)

HSP 1 Score: 93.5893 bits (231), Expect = 7.187e-22
Identity = 57/188 (30.32%), Postives = 100/188 (53.19%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQ----SDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIG 715
            ++  +I WR+  K+  +  + L    ++  FSVISV AY  L  L    +FR+Y   +      ++ +  + YL+ D+ ++  K        +  ++ F+ ++R L L+ED  +S+K GV L+  TY+GA FN MTL IL  + +F +PK+Y+  +  +D    L+ +K    L+ + DK+R    IG
Sbjct:   37 QVESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSK----LTEITDKIRVAIPIG 220          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn4a (reticulon 4a [Source:ZFIN;Acc:ZDB-GENE-030710-1])

HSP 1 Score: 104.375 bits (259), Expect = 5.907e-26
Identity = 57/191 (29.84%), Postives = 105/191 (54.97%), Query Frame = 2
Query:  134 SAVENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            S +E +    ++++++ WR+  +T  +  + L L +SL   S+ISVL+Y  L  L V  SFR+Y           D +  ++YLDKD  +       +++  +  ++  + ++R L L+ED  +SLK  V ++ +TY+GA FN +TL IL  +  F  P IY+ +Q ++D+ Y L+  +   V+ ++  K+
Sbjct:   14 SGMEIKHWKEQVVELLYWRDLQRTGVVFGAGLFLLLSLSMCSIISVLSYVALALLSVTVSFRIYKGILQAVQKSEDGHPFKMYLDKDTALPAEMVHKYSDSTLVHINTVIKELRRLFLVEDLVDSLKFAVLMWILTYVGALFNGLTLIILGFIGAFSCPVIYEKHQAQIDHYYGLVNKQFKDVVGKIQAKI 204          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn4a (reticulon 4a [Source:ZFIN;Acc:ZDB-GENE-030710-1])

HSP 1 Score: 103.605 bits (257), Expect = 7.573e-26
Identity = 56/187 (29.95%), Postives = 103/187 (55.08%), Query Frame = 2
Query:  146 NEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            +E    ++++++ WR+  +T  +  + L L +SL   S+ISVL+Y  L  L V  SFR+Y           D +  ++YLDKD  +       +++  +  ++  + ++R L L+ED  +SLK  V ++ +TY+GA FN +TL IL  +  F  P IY+ +Q ++D+ Y L+  +   V+ ++  K+
Sbjct:    2 SEMDSKQVVELLYWRDLQRTGVVFGAGLFLLLSLSMCSIISVLSYVALALLSVTVSFRIYKGILQAVQKSEDGHPFKMYLDKDTALPAEMVHKYSDSTLVHINTVIKELRRLFLVEDLVDSLKFAVLMWILTYVGALFNGLTLIILGFIGAFSCPVIYEKHQAQIDHYYGLVNKQFKDVVGKIQAKI 188          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn4a (reticulon 4a [Source:ZFIN;Acc:ZDB-GENE-030710-1])

HSP 1 Score: 103.605 bits (257), Expect = 7.573e-26
Identity = 56/187 (29.95%), Postives = 103/187 (55.08%), Query Frame = 2
Query:  146 NEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            +E    ++++++ WR+  +T  +  + L L +SL   S+ISVL+Y  L  L V  SFR+Y           D +  ++YLDKD  +       +++  +  ++  + ++R L L+ED  +SLK  V ++ +TY+GA FN +TL IL  +  F  P IY+ +Q ++D+ Y L+  +   V+ ++  K+
Sbjct:    2 SEMDSKQVVELLYWRDLQRTGVVFGAGLFLLLSLSMCSIISVLSYVALALLSVTVSFRIYKGILQAVQKSEDGHPFKMYLDKDTALPAEMVHKYSDSTLVHINTVIKELRRLFLVEDLVDSLKFAVLMWILTYVGALFNGLTLIILGFIGAFSCPVIYEKHQAQIDHYYGLVNKQFKDVVGKIQAKI 188          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn4a (reticulon 4a [Source:ZFIN;Acc:ZDB-GENE-030710-1])

HSP 1 Score: 102.449 bits (254), Expect = 8.379e-25
Identity = 61/213 (28.64%), Postives = 108/213 (50.70%), Query Frame = 2
Query:  107 IMSISDTEHSAVENEAKDFK-------------ILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            I S  D      + E K+ K             +++++ WR+  +T  +  + L L +SL   S+ISVL+Y  L  L V  SFR+Y           D +  ++YLDKD  +       +++  +  ++  + ++R L L+ED  +SLK  V ++ +TY+GA FN +TL IL  +  F  P IY+ +Q ++D+ Y L+  +   V+ ++  K+
Sbjct:   34 ISSFGDASPKQAKPEEKEEKPTVAPYKCNSSCSLVELLYWRDLQRTGVVFGAGLFLLLSLSMCSIISVLSYVALALLSVTVSFRIYKGILQAVQKSEDGHPFKMYLDKDTALPAEMVHKYSDSTLVHINTVIKELRRLFLVEDLVDSLKFAVLMWILTYVGALFNGLTLIILGFIGAFSCPVIYEKHQAQIDHYYGLVNKQFKDVVGKIQAKI 246          
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Match: rtn1b (reticulon 1b [Source:ZFIN;Acc:ZDB-GENE-030710-3])

HSP 1 Score: 99.7525 bits (247), Expect = 2.931e-24
Identity = 51/181 (28.18%), Postives = 105/181 (58.01%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            + ++++ WR+  K+  +  S L +  SL  FSV+SV+AY  L  L    SFR+Y           + +  ++YLD ++ ++  +   + E     +++ + ++R L L++D  +SLK  V ++ +TY+GA FN +TL I+V + +F +P +Y+ YQ ++D    L+  +++ V++++ +K+
Sbjct:   24 QAMELLYWRDLKKSGLVFGSLLLMLFSLTQFSVVSVVAYLALASLSATISFRVYKSVLQAVQKTDEGHPFKVYLDVEMSLSHDQMQKYAENVQYYINSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLIMVVVCMFSMPVVYEKYQAQIDQYVDLIRTQVNSVVAKIQEKV 204          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: rgs3 (regulator of G-protein signaling 3 [Source:Xenbase;Acc:XB-GENE-5900212])

HSP 1 Score: 99.3673 bits (246), Expect = 3.776e-23
Identity = 64/192 (33.33%), Postives = 105/192 (54.69%), Query Frame = 2
Query:  167 ILDIILWRNPLKTAAILLS--CLT-LEISLIC---FSVISVLAYAGLTFLIVATSFRMYMKF-----SGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPV 709
            + D++ WR+      ILLS  CLT + +SL+C   FSVISV AY  L  L V  + R+Y K       G   N F Q YLD D+K+   ++   T   +  +   +  +RSL L+E+  +SLK  V +Y +TY+GA FN +T+ +L  +  F  P +Y+ +Q ++D+   L++ K++   S++   ++  P 
Sbjct:  127 VKDLLYWRD------ILLSAGCLTGVTLSLLCLSQFSVISVFAYGCLIILSVTLTLRLYTKLLHALKRGNGANPF-QYYLDADLKLTTKQAEEITARVLSLLSTTICTLRSLFLVEELKDSLKFLVIIYLLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHYVSLVSKKVNAFRSKIQGTVKKPPA 311          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: rgs3 (regulator of G-protein signaling 3 [Source:Xenbase;Acc:XB-GENE-5900212])

HSP 1 Score: 96.2857 bits (238), Expect = 4.217e-22
Identity = 61/178 (34.27%), Postives = 99/178 (55.62%), Query Frame = 2
Query:  173 DIILWRNPLKTAAILLSCLT-LEISLIC---FSVISVLAYAGLTFLIVATSFRMYMKF-----SGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSR 679
            D++ WR+ L +A     CLT + +SL+C   FSVISV AY  L  L V  + R+Y K       G   N F Q YLD D+K+   ++   T   +  +   +  +RSL L+E+  +SLK  V +Y +TY+GA FN +T+ +L  +  F  P +Y+ +Q ++D+   L++ K++   S+
Sbjct:  124 DLLYWRDILLSAG----CLTGVTLSLLCLSQFSVISVFAYGCLIILSVTLTLRLYTKLLHALKRGNGANPF-QYYLDADLKLTTKQAEEITARVLSLLSTTICTLRSLFLVEELKDSLKFLVIIYLLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHYVSLVSKKVNAFRSK 296          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: rgs3 (regulator of G-protein signaling 3 [Source:Xenbase;Acc:XB-GENE-5900212])

HSP 1 Score: 96.2857 bits (238), Expect = 5.197e-22
Identity = 61/180 (33.89%), Postives = 100/180 (55.56%), Query Frame = 2
Query:  167 ILDIILWRNPLKTAAILLSCLT-LEISLIC---FSVISVLAYAGLTFLIVATSFRMYMKF-----SGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSR 679
            + D++ WR+ L +A     CLT + +SL+C   FSVISV AY  L  L V  + R+Y K       G   N F Q YLD D+K+   ++   T   +  +   +  +RSL L+E+  +SLK  V +Y +TY+GA FN +T+ +L  +  F  P +Y+ +Q ++D+   L++ K++   S+
Sbjct:  134 VKDLLYWRDILLSAG----CLTGVTLSLLCLSQFSVISVFAYGCLIILSVTLTLRLYTKLLHALKRGNGANPF-QYYLDADLKLTTKQAEEITARVLSLLSTTICTLRSLFLVEELKDSLKFLVIIYLLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHYVSLVSKKVNAFRSK 308          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: rgs3 (regulator of G-protein signaling 3 [Source:Xenbase;Acc:XB-GENE-5900212])

HSP 1 Score: 95.9005 bits (237), Expect = 6.298e-22
Identity = 61/178 (34.27%), Postives = 99/178 (55.62%), Query Frame = 2
Query:  173 DIILWRNPLKTAAILLSCLT-LEISLIC---FSVISVLAYAGLTFLIVATSFRMYMKF-----SGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSR 679
            D++ WR+ L +A     CLT + +SL+C   FSVISV AY  L  L V  + R+Y K       G   N F Q YLD D+K+   ++   T   +  +   +  +RSL L+E+  +SLK  V +Y +TY+GA FN +T+ +L  +  F  P +Y+ +Q ++D+   L++ K++   S+
Sbjct:  133 DLLYWRDILLSAG----CLTGVTLSLLCLSQFSVISVFAYGCLIILSVTLTLRLYTKLLHALKRGNGANPF-QYYLDADLKLTTKQAEEITARVLSLLSTTICTLRSLFLVEELKDSLKFLVIIYLLTYVGAVFNGITVLLLCVIGAFTFPILYKQHQTQVDHYVSLVSKKVNAFRSK 305          
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Match: ENSXETT00000037176.1 (reticulon 3 [Source:NCBI gene;Acc:549516])

HSP 1 Score: 93.9745 bits (232), Expect = 7.275e-22
Identity = 56/194 (28.87%), Postives = 104/194 (53.61%), Query Frame = 2
Query:  134 SAVENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGF---IGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            S+   +     + D++ WR+  ++  +    + L +SL  FS+ISV++Y  L+ L V  S+R+Y           + +  +  L+KDI ++   S AF +     +  V+  +  I  L L+ED  +SLKL + ++ MTY+GA FN +TL IL  L+ F  P +Y+ Y+V++D+   L+ + +  +  ++  K+
Sbjct:   33 SSAGEKGSGCAVQDLLYWRDVKQSGMVFGGTMVLLLSLAAFSIISVISYLVLSLLAVTISYRVYKSVLQAVQKTDEGHPFKPLLEKDIALS---SDAFQKALSTSLAHVNHALKYIVRLFLVEDLVDSLKLALLMWLMTYVGAVFNGITLLILGVLLAFTAPIVYEKYKVQIDHYVSLVHSHVKSITEKIQAKL 223          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn4 (reticulon 4 [Source:MGI Symbol;Acc:MGI:1915835])

HSP 1 Score: 104.375 bits (259), Expect = 4.844e-26
Identity = 54/184 (29.35%), Postives = 103/184 (55.98%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHL 703
            K++D++ WR+  KT  +  + L L +SL  FS++SV AY  L  L V  SFR+Y           + +  + YL+ ++ +++     ++   +G V++ + ++R L L++D  +SLK  V ++  TY+GA FN +TL IL  + +F +P IY+ +Q ++D+   L    +   ++++  K+  L
Sbjct:   11 KVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAKIPGL 194          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn2 (reticulon 2 (Z-band associated protein) [Source:MGI Symbol;Acc:MGI:107612])

HSP 1 Score: 103.99 bits (258), Expect = 6.457e-26
Identity = 55/190 (28.95%), Postives = 102/190 (53.68%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMK-----FSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGP 718
            K+ D++ W++   + A+    +   + L+ FS++SV A+  L  L    S R+Y K       G   N F Q YLD D+ + + ++   ++     V +   ++R   L+ED  +SLKL +  Y +T++GA FN +TL IL  + +F VP +Y+ +Q ++D    L+TN++S + +++  K+     + P
Sbjct:    4 KVADLLYWKDTRTSGAVFTGLMASLLCLLHFSIVSVAAHLALLGLCATISLRVYRKVLQAVHRGDGTNPF-QAYLDMDLTLTREQTERLSQQIASHVVSTATQLRHFFLVEDLVDSLKLALLFYILTFVGAIFNGLTLVILGVVALFTVPLLYRQHQAQIDQYVGLVTNQLSHIKAKIRAKIPGTGTLAP 192          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn4 (reticulon 4 [Source:MGI Symbol;Acc:MGI:1915835])

HSP 1 Score: 109.383 bits (272), Expect = 1.455e-25
Identity = 59/202 (29.21%), Postives = 111/202 (54.95%), Query Frame = 2
Query:  119 SDTEH------SAVENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY---MKFSGQSDNNF-IQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            SDTE       + +  E     ++D++ WR+  KT  +  + L L +SL  FS++SV AY  L  L V  SFR+Y   ++   +SD     + YL+ ++ +++     ++   +G V++ + ++R L L++D  +SLK  V ++  TY+GA FN +TL IL  + +F +P IY+ +Q ++D+   L    +   ++++  K+
Sbjct:  953 SDTEKEDRSLTAVLSAELNKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAKI 1154          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn3 (reticulon 3 [Source:MGI Symbol;Acc:MGI:1339970])

HSP 1 Score: 103.99 bits (258), Expect = 1.888e-25
Identity = 60/181 (33.15%), Postives = 101/181 (55.80%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            ++ D+I WR+  KT  +  + L + +SL  FSVISV++Y  L  L V  SFR+Y           + +  + YLD DI ++      +    +  V+  +  I  L L+ED  +SLKL VF++ MTY+GA FN +TL IL  L+VF VP +Y+ Y+ ++D+   +  ++   ++ ++  K+
Sbjct:   67 QVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKL 247          
BLAST of Reticulon-like protein vs. Ensembl Mouse
Match: Rtn3 (reticulon 3 [Source:MGI Symbol;Acc:MGI:1339970])

HSP 1 Score: 103.219 bits (256), Expect = 2.648e-25
Identity = 60/180 (33.33%), Postives = 100/180 (55.56%), Query Frame = 2
Query:  167 ILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            + D+I WR+  KT  +  + L + +SL  FSVISV++Y  L  L V  SFR+Y           + +  + YLD DI ++      +    +  V+  +  I  L L+ED  +SLKL VF++ MTY+GA FN +TL IL  L+VF VP +Y+ Y+ ++D+   +  ++   ++ ++  K+
Sbjct:   49 VHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHVNKALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLVFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKL 228          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q9JK11|RTN4_RAT (Reticulon-4 OS=Rattus norvegicus OX=10116 GN=Rtn4 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.807e-25
Identity = 60/202 (29.70%), Postives = 112/202 (55.45%), Query Frame = 2
Query:  119 SDTEH------SAVENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY---MKFSGQSDNNF-IQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            SDTE       + +  E     ++D++ WR+  KT  +  + L L +SL  FS++SV AY  L  L V  SFR+Y   ++   +SD     + YL+ ++ +++     ++   +G V++ + ++R L L++D  +SLK  V ++  TY+GA FN +TL IL  + +F +P IY+ +QV++D+   L    +   ++++  K+
Sbjct:  954 SDTEKEDRSLSAVLSAELSKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQVQIDHYLGLANKSVKDAMAKIQAKI 1155          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q99P72|RTN4_MOUSE (Reticulon-4 OS=Mus musculus OX=10090 GN=Rtn4 PE=1 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 1.018e-24
Identity = 59/202 (29.21%), Postives = 111/202 (54.95%), Query Frame = 2
Query:  119 SDTEH------SAVENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY---MKFSGQSDNNF-IQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            SDTE       + +  E     ++D++ WR+  KT  +  + L L +SL  FS++SV AY  L  L V  SFR+Y   ++   +SD     + YL+ ++ +++     ++   +G V++ + ++R L L++D  +SLK  V ++  TY+GA FN +TL IL  + +F +P IY+ +Q ++D+   L    +   ++++  K+
Sbjct:  953 SDTEKEDRSLTAVLSAELNKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNSTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSIPVIYERHQAQIDHYLGLANKSVKDAMAKIQAKI 1154          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q9NQC3|RTN4_HUMAN (Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.794e-24
Identity = 62/202 (30.69%), Postives = 111/202 (54.95%), Query Frame = 2
Query:  119 SDTEH-----SAV-ENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY---MKFSGQSDNNF-IQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            SDTE      SA+   E     ++D++ WR+  KT  +  + L L +SL  FS++SV AY  L  L V  SFR+Y   ++   +SD     + YL+ ++ +++     ++   +G V+  + ++R L L++D  +SLK  V ++  TY+GA FN +TL IL  + +F VP IY+ +Q ++D+   L    +   ++++  K+
Sbjct:  983 SDTEKEDRSPSAIFSAELSKTSVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKI 1184          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q08D83|RTN3_BOVIN (Reticulon-3 OS=Bos taurus OX=9913 GN=RTN3 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 3.965e-24
Identity = 58/181 (32.04%), Postives = 101/181 (55.80%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            ++ D+I WR+  KT  +  + L + +SL  FSVISV++Y  L  L V  SFR+Y           + +  + YLD DI ++      +    +  ++  +  I  L L+ED  +SLKL VF++ MTY+GA FN +TL IL  L+VF +P +Y+ Y+ ++D+   +  ++   ++ ++  K+
Sbjct:   67 QVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRVYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYVNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLVFSIPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKL 247          
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Match: sp|Q5RBL9|RTN3_PONAB (Reticulon-3 OS=Pongo abelii OX=9601 GN=RTN3 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 5.800e-24
Identity = 58/180 (32.22%), Postives = 100/180 (55.56%), Query Frame = 2
Query:  167 ILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            + D+I WR+  KT  +  + L + +SL  FSVISV++Y  L  L V  SFR+Y           + +  + YLD DI ++      +    +  ++  +  I  L L+ED  +SLKL VF++ MTY+GA FN +TL IL  L++F VP +Y+ Y+ ++D+   +  ++   ++ ++  K+
Sbjct:   48 VHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKL 227          
BLAST of Reticulon-like protein vs. TrEMBL
Match: Q5DE04 (Reticulon-like protein OS=Schistosoma japonicum OX=6182 GN=EWB00_003282 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 8.531e-43
Identity = 74/191 (38.74%), Postives = 118/191 (61.78%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQ 736
            K+  II WR+P+ T  IL   L +E S +C S IS +AY GL+ L+     RMY  F  +++NNF++ YL+++I + + K+   +      ++  +++ R + L+ D   S+K  V LY +TYIGA+FNF+TLCIL T  +FCVPK Y+ YQ E+D +  L  +KI +V+S++  ++  LP+IG   R  +
Sbjct:   22 KVRSIIYWRHPIITGVILTLLLIVEFSFMCLSAISFIAYIGLSLLVSVNLVRMYYHFVAKTENNFVREYLEREITVPQDKAEKVSRRLTEVINKGLVRTREIFLLTDPAASIKFAVLLYLLTYIGAQFNFLTLCILFTFGIFCVPKFYERYQPEIDKILELAKSKIDMVVSQVKSQIEKLPIIGGGGRKEK 212          
BLAST of Reticulon-like protein vs. TrEMBL
Match: A0A183QUW5 (Reticulon-like protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 9.945e-42
Identity = 74/192 (38.54%), Postives = 113/192 (58.85%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQQ 739
            K+  I+ WR P+ T  IL   L +E S +C S IS +AY GL  L+     RMY  F  +++NNF+  YL+++I + + K+   +      ++  +++ R + L+ D   S+K  V LY +TYIGA+FNF+TLCIL T  VFCVPK Y+ YQ E+D +  L  +KI +V S++   +  LP+IG   +   Q
Sbjct:   22 KVRSIVYWRQPIVTGVILTLLLIVEFSFMCLSAISFIAYIGLALLVSVNLLRMYYHFVAKTENNFVSEYLEREITVPQDKAEKVSRRLTEVLNKGLIRTREIFLLTDPAASVKFAVLLYLLTYIGAQFNFLTLCILFTFGVFCVPKFYERYQPEIDKMIELAKSKIHMVSSQVKTHLEKLPIIGSGLKEKTQ 213          
BLAST of Reticulon-like protein vs. TrEMBL
Match: A0A3Q0KD50 (Reticulon-like protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 1.516e-41
Identity = 73/192 (38.02%), Postives = 113/192 (58.85%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQQ 739
            K+  I+ WR P+ T  IL   L +E S +C S IS +AY GL  L+     RMY  F  +++NNF++ YL+++I + + K+   +      ++  +++ R + L+ D   S+K  V LY +TYIGA+FNF+TLCIL T  VFCVPK Y+ YQ E+D +  L  +KI +V S+    +  +P+IG   +   Q
Sbjct:   12 KVRSIVYWRQPIVTGVILTLLLIVEFSFMCLSAISFIAYIGLALLVSVNLLRMYYHFVAKTENNFVREYLEREITVPQDKAEKVSRRLTEVLNKGLIRTREIFLLTDPAASVKFAVLLYLLTYIGAQFNFLTLCILFTFGVFCVPKFYERYQPEIDKMIELAKSKIHMVSSQFKTHLEKVPIIGSGLKEKTQ 203          
BLAST of Reticulon-like protein vs. TrEMBL
Match: G4V8C2 (Reticulon-like protein OS=Schistosoma mansoni OX=6183 GN=Smp_020370 PE=4 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 2.212e-41
Identity = 73/192 (38.02%), Postives = 113/192 (58.85%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQQ 739
            K+  I+ WR P+ T  IL   L +E S +C S IS +AY GL  L+     RMY  F  +++NNF++ YL+++I + + K+   +      ++  +++ R + L+ D   S+K  V LY +TYIGA+FNF+TLCIL T  VFCVPK Y+ YQ E+D +  L  +KI +V S+    +  +P+IG   +   Q
Sbjct:   22 KVRSIVYWRQPIVTGVILTLLLIVEFSFMCLSAISFIAYIGLALLVSVNLLRMYYHFVAKTENNFVREYLEREITVPQDKAEKVSRRLTEVLNKGLIRTREIFLLTDPAASVKFAVLLYLLTYIGAQFNFLTLCILFTFGVFCVPKFYERYQPEIDKMIELAKSKIHMVSSQFKTHLEKVPIIGSGLKEKTQ 213          
BLAST of Reticulon-like protein vs. TrEMBL
Match: A0A183N941 (Reticulon-like protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS24815 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 2.844e-41
Identity = 73/192 (38.02%), Postives = 113/192 (58.85%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQQ 739
            K+  I+ WR P+ T  IL   L +E S +C S IS +AY GL  L+     RMY  F  +++NNF++ YL+++I + + K+   +      ++  + + R + L+ D   S+K  V LY +TYIGA+FNF+TLC+L T  VFCVPK Y+ YQ E+D +  L  +KI +V S++   +  LP+IG   +   Q
Sbjct:   12 KVRSIVYWRQPIVTGVILTLLLIVEFSFMCLSAISFIAYIGLALLVSVNLLRMYYHFVAKTENNFVREYLEREITVPQDKAEKVSRRLTEVLNKGLTRTREIFLLTDPAASVKFAVLLYLLTYIGAQFNFLTLCVLFTFGVFCVPKFYERYQPEIDKMIELAKSKIDMVSSQVKTHLEKLPIIGSGRKEKAQ 203          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: rtn4a (reticulon-4-like [Source:NCBI gene;Acc:103037090])

HSP 1 Score: 104.375 bits (259), Expect = 3.510e-26
Identity = 55/181 (30.39%), Postives = 105/181 (58.01%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            ++++++ WR+  +T     + L L +SL   S++SV+AY  L  L V  SFR+Y           D +  ++YL++DI ++      ++E  + + +  V ++R L L+ED  +SLK  V ++ +TY+G  FN +TL I+  + VF  P +Y+ +QV++D+ Y L+ N++  V+ ++  K+
Sbjct:    9 QVVELLHWRDLQRTGVCFGASLFLLLSLSVCSIVSVIAYISLALLSVTISFRIYKGIIQAVQKSEDGHPFKMYLEQDIAISSDLVHKYSELALARFNTLVKELRRLFLVEDLVDSLKFAVLMWLLTYVGGLFNGLTLIIIAHIAVFTWPVVYEKHQVQIDHYYELVNNQVKDVMKKIQAKI 189          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: rtn4a (reticulon-4-like [Source:NCBI gene;Acc:103037090])

HSP 1 Score: 103.219 bits (256), Expect = 7.319e-26
Identity = 55/180 (30.56%), Postives = 104/180 (57.78%), Query Frame = 2
Query:  167 ILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            +++++ WR+  +T     + L L +SL   S++SV+AY  L  L V  SFR+Y           D +  ++YL++DI ++      ++E  + + +  V ++R L L+ED  +SLK  V ++ +TY+G  FN +TL I+  + VF  P +Y+ +QV++D+ Y L+ N++  V+ ++  K+
Sbjct:    6 VVELLHWRDLQRTGVCFGASLFLLLSLSVCSIVSVIAYISLALLSVTISFRIYKGIIQAVQKSEDGHPFKMYLEQDIAISSDLVHKYSELALARFNTLVKELRRLFLVEDLVDSLKFAVLMWLLTYVGGLFNGLTLIIIAHIAVFTWPVVYEKHQVQIDHYYELVNNQVKDVMKKIQAKI 185          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: rtn3 (reticulon-3-like [Source:NCBI gene;Acc:103032175])

HSP 1 Score: 101.293 bits (251), Expect = 7.010e-25
Identity = 57/192 (29.69%), Postives = 108/192 (56.25%), Query Frame = 2
Query:  131 HSAVENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            H A   ++K F + D++ WR+P KT  +  + L L +SL  FSVISV++Y  L  L V  +FR+Y          S+ +  +  ++KD+ +         +  +  ++  + K+  L L+ED  +SLKL V ++ +TY+GA FN +T+ IL  +++F VP +Y+  + ++D+   +   +I+  +++L +K+
Sbjct:   21 HPAASKDSK-FSVHDLVHWRDPKKTGVVFGTSLLLLLSLAAFSVISVISYLLLALLCVTITFRIYKSVVQAVQKSSEGHPFKALMEKDVSVPPETFRKHVDASLTYINRALKKMSRLFLVEDLVDSLKLAVAMWLLTYVGAVFNGITILILADILIFSVPPLYEKNKTQIDHYIDVARTQINATVAKLQEKL 211          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000040030.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:11469403:11477568:1 gene:ENSAMXG00000040046.1 transcript:ENSAMXT00000040030.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 2.973e-24
Identity = 52/176 (29.55%), Postives = 103/176 (58.52%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSR 679
            +++D++ WR+   T  +  + L L +SL   S+ISVL+Y  L  L V  +FR+Y           + +  + YLD+++ +       +++  +G+++A ++++R L L+ED  +SLK  VF++ +TY+GA FN +T+ IL  +  F  P +Y+ +Q ++D+   L+ N++  V+ +
Sbjct:    5 RVVDLLYWRDVKNTGVVFGASLLLLLSLSVCSIISVLSYVALALLSVTITFRIYKGILQAIQKSDEGHPFKQYLDQEVALPAQLVHKYSDIALGRINATMVELRRLFLVEDLVDSLKFAVFMWILTYVGALFNGLTILILGLIGAFSCPIVYEKHQTQIDHYVALINNQVKDVVGK 180          
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000000849.2 (reticulon-3-A-like [Source:NCBI gene;Acc:103021356])

HSP 1 Score: 97.0561 bits (240), Expect = 2.696e-23
Identity = 56/204 (27.45%), Postives = 107/204 (52.45%), Query Frame = 2
Query:   95 SFNSIMSISDTEHSAVENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
              NS  ++ ++  S VE         +++ WR+  ++A +    L + +SL  FS+ISV++Y  L  L V  +FR+Y           + +  +  LD+DI +    +  +T+  +  ++  ++  R LLL++D  +SLKL   ++ +TY+GA FN +TL IL  +  FC P +Y+  + ++D    L+  ++   L +L +K+
Sbjct:   12 ELNSSNTLHNSARSVVE---------ELVYWRDMKRSALVFGGSLLVLVSLATFSLISVVSYLLLALLCVTITFRVYKSVFQAVQKSDEGHPFKFLLDRDISITPETAHRYTDVLLLNLNRALIHTRRLLLVDDVVDSLKLAGLMWILTYVGAVFNGVTLLILADITFFCAPLVYEKNKTQIDRYVELVKTQLEEKLEKLQEKL 206          
BLAST of Reticulon-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006786.1 (pep scaffold:Pmarinus_7.0:GL481818:2303:8766:1 gene:ENSPMAG00000006114.1 transcript:ENSPMAT00000006786.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 2.074e-25
Identity = 57/176 (32.39%), Postives = 97/176 (55.11%), Query Frame = 2
Query:  167 ILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRL 682
            +LD++ WR+   +AA+    L L +SL  FSV+SVLAY  L  L V  S+R+Y           D +  + YLD D+ M+   +  + +  +  V+  +  +R L L+ D  +S+K  V L+ +TY+GA FN +T+ IL  +  F VP +Y+ YQV++D    ++   +  V+ ++
Sbjct:   10 VLDLLYWRDIKTSAAVFGGSLLLLLSLTQFSVVSVLAYLTLAVLSVTISYRVYKSVLQAVQKTEDGHPFREYLDADLAMSPETAQKYVDTALSHVNCQLRHLRRLFLVHDLVDSIKFAVVLWLLTYVGALFNGLTIVILALIGAFTVPMVYEKYQVQIDQQVGMVRKHVGEVVEKV 185          
BLAST of Reticulon-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007319.1 (pep scaffold:Pmarinus_7.0:GL490398:662:6495:-1 gene:ENSPMAG00000006605.1 transcript:ENSPMAT00000007319.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 1.225e-17
Identity = 53/170 (31.18%), Postives = 98/170 (57.65%), Query Frame = 2
Query:  182 LWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY---MKFSGQSDNNF-IQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSR 679
            +WR+   +A +  +   L ++L  FSV+SV+ Y  L  L V  SFR+Y   ++   +SD+    +  L+ D+ ++++      +  + + +A V ++R L L+ED  +SLK  V ++ +TYIGA FN +TL IL  L +F  P +Y+ YQ ++D+   L  + ++ V+++
Sbjct:    9 IWRDVRSSAGVFGATTVLLLALTQFSVVSVVCYVCLAVLSVTVSFRVYKSVLQAVQKSDSGHPFRACLECDLGVSQATVETHLDVALARFNAVVRELRRLFLVEDLVDSLKFAVLMWLLTYIGAIFNGLTLLILGVLTLFTAPVVYEKYQKQIDHYLALARSNLNGVIAK 178          
BLAST of Reticulon-like protein vs. Ensembl Yeast
Match: RTN2 (Reticulon protein; involved in nuclear pore assembly and maintenance of tubular ER morphology; promotes membrane curvature; regulates the ER asymmetry-induced inheritance block during ER stress; role in ER-derived peroxisomal biogenesis; interacts with Sec6p, Yip3p, and Sbh1p; less abundant than RTN1; member of RTNLA (reticulon-like A) subfamily; protein increases in abundance and relocalizes to plasma membrane upon DNA replication stress [Source:SGD;Acc:S000002363])

HSP 1 Score: 48.9062 bits (115), Expect = 6.100e-7
Identity = 44/196 (22.45%), Postives = 87/196 (44.39%), Query Frame = 2
Query:   89 NRSFNSIMSISDTEHSAVENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYM------------KFSGQSDNNFI---QLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELD 631
            N + N   +++++ ++    EA       +I W NP K+ A   + L   + L   +VISVL   G  ++++ TSF + +            +F  Q   + +   + ++D+++                ++ A   +IR L+       +  +GV LYF+  + A F+  T+ I+ T+ ++ VP IY   Q  +D
Sbjct:    4 NTTTNKNANLNNSRNANAPGEAGHQNKTGLIYWTNPSKSGASFAATLVSLLILRNVNVISVLLKIG--YMVLFTSFAVELSTKVLFDKGVVSRFGMQESPDLVGVLKPHIDRELD---------------RLPALEDRIRKLVFAHRTRNNFTIGVSLYFLHGLFAIFSMNTVLIMTTIFLYTVPLIYDRKQARID 182          
BLAST of Reticulon-like protein vs. Ensembl Nematostella
Match: EDO30766 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:A7SZV0])

HSP 1 Score: 105.145 bits (261), Expect = 4.317e-27
Identity = 55/176 (31.25%), Postives = 104/176 (59.09%), Query Frame = 2
Query:  167 ILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQ-----SDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSR 679
            ++D++ W+   KTA +  + L + ISL C S++SV+ +  +  L VA  +R+ M   G      ++N F  L LDK+I++ K K+    E     ++     +R L L+ED  +S+K GV L+ ++Y+GA F+ +TL I   ++VF +PK+Y+ YQ ++D   +++ +++S ++ +
Sbjct:    3 VIDLVYWQEIKKTAIVFSTLLVVLISLSCCSLLSVITFFSMAVLTVALLYRVGMTVMGAIQKSGTENPFKTL-LDKEIEIPKEKAVEMAESLAEHINCLTKSLRRLFLVEDIVDSIKFGVMLWVLSYVGAWFSMLTLIIFAVVMVFSLPKVYEEYQDKIDEHVKVIHSQVSTIIEQ 177          
BLAST of Reticulon-like protein vs. Ensembl Nematostella
Match: EDO36076 (Reticulon-like protein [Source:UniProtKB/TrEMBL;Acc:A7SJN6])

HSP 1 Score: 73.559 bits (179), Expect = 2.467e-15
Identity = 56/190 (29.47%), Postives = 95/190 (50.00%), Query Frame = 2
Query:  173 DIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRM-------YMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMR-HLPVIGP 718
            DIILWR+   TA + +S     + +  FS++SV+    +  LI     R+       +MK   Q   N    YL KDI ++K ++    E   G +    + +R L L+ED  +S+KL V LY ++Y+   F+ +TL  +  + +F VPK Y  Y+ E+++      + I + +  L DK+   +P+  P
Sbjct:    6 DIILWRDVKVTAVVFVSGFVFLVCMTQFSLLSVVTAVAMIALIPMLVIRLLFTARSAFMKTEFQHPLNS---YLSKDINVSKDRADLIGERAAGYIVDSTVSVRRLFLVEDLADSIKLLVVLYILSYLAQWFSGITLTFIGFIGLFTVPKAYDMYREEINSAM----STIKVAVDDLLDKINAAVPLAKP 188          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: rtn3 (reticulon-3-B [Source:NCBI gene;Acc:101170222])

HSP 1 Score: 100.138 bits (248), Expect = 8.099e-24
Identity = 59/202 (29.21%), Postives = 114/202 (56.44%), Query Frame = 2
Query:  101 NSIMSISDTEHSAVENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            +S    +D ++SA + E+K   + D+I WR+P K+  +    L + +SL  FSVISV +Y  L  LIV  SFR+Y          +D +  ++ ++KD+ +         +  +  ++  + ++  L L+ED  +SLKL V ++ +TY+GA FN +TL IL  +++F VP +Y+  + ++D    ++  +++  +++L +K+
Sbjct:   83 SSSQGFADGQNSAAK-ESK-LSVKDLIHWRDPKKSGVVFGLSLLMLLSLAAFSVISVASYLLLALLIVTISFRIYKSVLQAVQKSNDGHPFKMLINKDVSIPPETFRKHVDASLTYINRGLKQMSRLFLVEDLVDSLKLAVVMWLLTYVGAVFNGITLLILADILLFAVPPVYEKNKTQIDQYIDVVRTQVNATVAKLQEKL 282          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: rtn4a (reticulon-4 [Source:NCBI gene;Acc:101163104])

HSP 1 Score: 92.4337 bits (228), Expect = 7.526e-22
Identity = 49/181 (27.07%), Postives = 103/181 (56.91%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            +++D++ WR+   T  +  + L L +SL   S++SV +Y GL  L V   FR+Y           + +  + YLD+++ +++     +++  + K++  + ++R + L+ED  +S+K  V ++ +TY+GA FN +TL IL  +  F  P +Y+ +Q ++D+   L+ N++  V+ ++  K+
Sbjct:    5 QVVDLLYWRDVKNTGVVFGAALLLLLSLTMCSIVSVCSYIGLALLSVTICFRIYKGILQAIQKSDEGHPFKQYLDQEVALSEEMVHKYSDVALSKLNKTIGELRRVFLVEDLVDSIKFAVLMWILTYVGAFFNGLTLIILGLIAAFTCPIVYEKHQAQIDHYVALVNNQVKDVVGKIQAKV 185          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: rtn1b (reticulon 1 [Source:NCBI gene;Acc:101155557])

HSP 1 Score: 82.0333 bits (201), Expect = 6.058e-18
Identity = 53/181 (29.28%), Postives = 103/181 (56.91%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            + +D++ WRN  ++ A+  S L L  SL  FSV+SV AY  L  L    SFR+Y           + +  + YL+ +I +++ + + + +  +   +  + ++R L L++D  +SLK  V ++ +TY+GA FN +TL ILV + +F +P +Y+ +Q ++D    L+  +++ V+ ++  K+
Sbjct:   20 QAIDLLYWRNVKQSGAVFSSVLLLLFSLTQFSVVSVGAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAYLEMEIALSQDQITKYADKILLYTNTCMKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLILVVVSMFTMPVVYEKHQAQIDQYVGLIRTQVNSVVGKIQAKI 200          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: rtn1b (reticulon 1 [Source:NCBI gene;Acc:101155557])

HSP 1 Score: 81.6481 bits (200), Expect = 6.350e-18
Identity = 53/179 (29.61%), Postives = 102/179 (56.98%), Query Frame = 2
Query:  170 LDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKM 694
            +D++ WRN  ++ A+  S L L  SL  FSV+SV AY  L  L    SFR+Y           + +  + YL+ +I +++ + + + +  +   +  + ++R L L++D  +SLK  V ++ +TY+GA FN +TL ILV + +F +P +Y+ +Q ++D    L+  +++ V+ ++  K+
Sbjct:    6 IDLLYWRNVKQSGAVFSSVLLLLFSLTQFSVVSVGAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAYLEMEIALSQDQITKYADKILLYTNTCMKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLILVVVSMFTMPVVYEKHQAQIDQYVGLIRTQVNSVVGKIQAKI 184          
BLAST of Reticulon-like protein vs. Ensembl Medaka
Match: ENSORLT00000043105.1 (pep primary_assembly:ASM223467v1:1:21570:58681:-1 gene:ENSORLG00000025847.1 transcript:ENSORLT00000043105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 7.034e-16
Identity = 46/137 (33.58%), Postives = 72/137 (52.55%), Query Frame = 2
Query:  173 DIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMY----MKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCIL 571
             +I WR P ++AA     L + IS+   SVISVL+Y  L  L V  +FR+Y           + +  +  L+KDI ++        +  +  ++ F  + R LLL+ED  +SLKL   ++ MTY+G  FN +T+ IL
Sbjct:   18 QLINWREPKRSAAAFGLSLLVLISVATLSVISVLSYLVLACLCVTITFRIYKSVIQAIQKSDEGHPFRSLLEKDISISSEAVRELGDQCLLHLNCFTSRTRRLLLVEDLVDSLKLATVMWVMTYVGGMFNGITILIL 154          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000079873.1 (SMESG000079873.1)

HSP 1 Score: 424.091 bits (1089), Expect = 6.293e-151
Identity = 209/210 (99.52%), Postives = 209/210 (99.52%), Query Frame = 2
Query:  110 MSISDTEHSAVENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQQ 739
            MSISDTEHSAVENE KDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQQ
Sbjct:    1 MSISDTEHSAVENEPKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQQ 210          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000079873.1 (SMESG000079873.1)

HSP 1 Score: 414.461 bits (1064), Expect = 3.306e-147
Identity = 206/210 (98.10%), Postives = 207/210 (98.57%), Query Frame = 2
Query:  110 MSISDTEHSAVENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQQ 739
            MSISDTEHSAVENE KDFK  +IILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQQ
Sbjct:    1 MSISDTEHSAVENEPKDFK--NIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQQ 208          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000079873.1 (SMESG000079873.1)

HSP 1 Score: 413.69 bits (1062), Expect = 1.175e-146
Identity = 209/225 (92.89%), Postives = 209/225 (92.89%), Query Frame = 2
Query:  110 MSISDTEHSAVENEAKDFK---------------ILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQQ 739
            MSISDTEHSAVENE KDFK               ILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQQ
Sbjct:    1 MSISDTEHSAVENEPKDFKNRKYFGNQIEILNHPILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGPLFRHHQQ 225          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000002945.1 (SMESG000002945.1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.678e-21
Identity = 62/214 (28.97%), Postives = 103/214 (48.13%), Query Frame = 2
Query:  110 MSISDTEHSAVENE-------AKDFKILDIILWRNPLKTAAILLSCLTLEISLICFSVISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLK----IRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPVIGP 718
            M   D+    +ENE       +    I +II WR P+ + ++L+S L   I +   S ISV+AY GL F+I +   R Y  F      N  Q YL+KD+ +  +K S +        D+   K    + S+ L+E Y + +K  +    + Y+G  FN + L  +    +   PKIY  Y+ ++D+       +I  V++ L +K+  LP++GP
Sbjct:    1 METCDSNEKLIENEFNCSVLESLPRAIKNIISWRCPILSGSLLVSWLVFAIMIKTLSFISVIAYIGLLFIISSMILRFYSNFINNEAANPFQEYLEKDMNVYLTKISDYVHYETTNEDSHFRKAIAYLNSIFLLESYLDGVKFFLVNVALIYVGMCFNLIDLVSVTVFTLLTCPKIYSMYRPQIDDFVIKARERILNVVAILKEKLATLPIVGP 214          
BLAST of Reticulon-like protein vs. Planmine SMEST
Match: SMESG000007676.1 (SMESG000007676.1)

HSP 1 Score: 70.0922 bits (170), Expect = 5.637e-13
Identity = 48/186 (25.81%), Postives = 98/186 (52.69%), Query Frame = 2
Query:  164 KILDIILWRNPLKTAAILLSCLTLEISLIC-FSVISVLAYAGLTFLIVATSFRMYMKFS-----GQSDNNFIQLYLDKDIKMNKSKSSAFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMTLCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHL 703
            K  DI+ W++P+ ++ +L   + +E+ LI  +S+IS++AY+GL  L  +  +++ +KF+      QS+ N         I +         +  +  ++    +IRSL  +  + ++LK   F + +TYIG  FN ++L  + T+I+F +P IY TY+  +D++   +  +I   ++    K + +
Sbjct:  295 KFKDIVCWKDPVMSSVVLSVIMVIELGLILDYSIISLMAYSGLLLLFSSFFYKVAVKFNLVKKCDQSNCN---------ISVTSDDVQLCVDCVLKWIEYLFNEIRSLTYVVSFTKNLKAFTFFWILTYIGQWFNLLSLIFMGTIILFSLPIIYTTYKTTIDHVLDRVRGQIKDSINNFKSKFQQI 471          
The following BLAST results are available for this feature:
BLAST of Reticulon-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RTN49.511e-2629.89reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085][more]
RTN43.737e-2530.69reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085][more]
RTN38.170e-2532.04reticulon 3 [Source:HGNC Symbol;Acc:HGNC:10469][more]
RTN49.849e-2532.54reticulon 4 [Source:HGNC Symbol;Acc:HGNC:14085][more]
RTN31.160e-2432.22reticulon 3 [Source:HGNC Symbol;Acc:HGNC:10469][more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ret-11.188e-1731.12Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
ret-13.160e-1730.00Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
ret-13.687e-1629.47Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
ret-13.687e-1629.47Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
ret-13.694e-1529.95Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rtnl14.069e-2230.98gene:FBgn0053113 transcript:FBtr0079043[more]
Rtnl17.187e-2230.32gene:FBgn0053113 transcript:FBtr0079040[more]
Rtnl17.187e-2230.32gene:FBgn0053113 transcript:FBtr0301540[more]
Rtnl17.187e-2230.32gene:FBgn0053113 transcript:FBtr0301539[more]
Rtnl17.187e-2230.32gene:FBgn0053113 transcript:FBtr0079039[more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtn4a5.907e-2629.84reticulon 4a [Source:ZFIN;Acc:ZDB-GENE-030710-1][more]
rtn4a7.573e-2629.95reticulon 4a [Source:ZFIN;Acc:ZDB-GENE-030710-1][more]
rtn4a7.573e-2629.95reticulon 4a [Source:ZFIN;Acc:ZDB-GENE-030710-1][more]
rtn4a8.379e-2528.64reticulon 4a [Source:ZFIN;Acc:ZDB-GENE-030710-1][more]
rtn1b2.931e-2428.18reticulon 1b [Source:ZFIN;Acc:ZDB-GENE-030710-3][more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs33.776e-2333.33regulator of G-protein signaling 3 [Source:Xenbase... [more]
rgs34.217e-2234.27regulator of G-protein signaling 3 [Source:Xenbase... [more]
rgs35.197e-2233.89regulator of G-protein signaling 3 [Source:Xenbase... [more]
rgs36.298e-2234.27regulator of G-protein signaling 3 [Source:Xenbase... [more]
ENSXETT00000037176.17.275e-2228.87reticulon 3 [Source:NCBI gene;Acc:549516][more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rtn44.844e-2629.35reticulon 4 [Source:MGI Symbol;Acc:MGI:1915835][more]
Rtn26.457e-2628.95reticulon 2 (Z-band associated protein) [Source:MG... [more]
Rtn41.455e-2529.21reticulon 4 [Source:MGI Symbol;Acc:MGI:1915835][more]
Rtn31.888e-2533.15reticulon 3 [Source:MGI Symbol;Acc:MGI:1339970][more]
Rtn32.648e-2533.33reticulon 3 [Source:MGI Symbol;Acc:MGI:1339970][more]
back to top
BLAST of Reticulon-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JK11|RTN4_RAT2.807e-2529.70Reticulon-4 OS=Rattus norvegicus OX=10116 GN=Rtn4 ... [more]
sp|Q99P72|RTN4_MOUSE1.018e-2429.21Reticulon-4 OS=Mus musculus OX=10090 GN=Rtn4 PE=1 ... [more]
sp|Q9NQC3|RTN4_HUMAN1.794e-2430.69Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 S... [more]
sp|Q08D83|RTN3_BOVIN3.965e-2432.04Reticulon-3 OS=Bos taurus OX=9913 GN=RTN3 PE=2 SV=... [more]
sp|Q5RBL9|RTN3_PONAB5.800e-2432.22Reticulon-3 OS=Pongo abelii OX=9601 GN=RTN3 PE=2 S... [more]
back to top
BLAST of Reticulon-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q5DE048.531e-4338.74Reticulon-like protein OS=Schistosoma japonicum OX... [more]
A0A183QUW59.945e-4238.54Reticulon-like protein OS=Schistosoma rodhaini OX=... [more]
A0A3Q0KD501.516e-4138.02Reticulon-like protein OS=Schistosoma mansoni OX=6... [more]
G4V8C22.212e-4138.02Reticulon-like protein OS=Schistosoma mansoni OX=6... [more]
A0A183N9412.844e-4138.02Reticulon-like protein OS=Schistosoma margrebowiei... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtn4a3.510e-2630.39reticulon-4-like [Source:NCBI gene;Acc:103037090][more]
rtn4a7.319e-2630.56reticulon-4-like [Source:NCBI gene;Acc:103037090][more]
rtn37.010e-2529.69reticulon-3-like [Source:NCBI gene;Acc:103032175][more]
ENSAMXT00000040030.12.973e-2429.55pep primary_assembly:Astyanax_mexicanus-2.0:21:114... [more]
ENSAMXT00000000849.22.696e-2327.45reticulon-3-A-like [Source:NCBI gene;Acc:103021356... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000006786.12.074e-2532.39pep scaffold:Pmarinus_7.0:GL481818:2303:8766:1 gen... [more]
ENSPMAT00000007319.11.225e-1731.18pep scaffold:Pmarinus_7.0:GL490398:662:6495:-1 gen... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RTN26.100e-722.45Reticulon protein; involved in nuclear pore assemb... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO307664.317e-2731.25Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
EDO360762.467e-1529.47Reticulon-like protein [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Reticulon-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtn38.099e-2429.21reticulon-3-B [Source:NCBI gene;Acc:101170222][more]
rtn4a7.526e-2227.07reticulon-4 [Source:NCBI gene;Acc:101163104][more]
rtn1b6.058e-1829.28reticulon 1 [Source:NCBI gene;Acc:101155557][more]
rtn1b6.350e-1829.61reticulon 1 [Source:NCBI gene;Acc:101155557][more]
ENSORLT00000043105.17.034e-1633.58pep primary_assembly:ASM223467v1:1:21570:58681:-1 ... [more]
back to top
BLAST of Reticulon-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079873.16.293e-15199.52SMESG000079873.1[more]
SMESG000079873.13.306e-14798.10SMESG000079873.1[more]
SMESG000079873.11.175e-14692.89SMESG000079873.1[more]
SMESG000002945.11.678e-2128.97SMESG000002945.1[more]
SMESG000007676.15.637e-1325.81SMESG000007676.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031297 ID=SMED30031297|Name=Reticulon-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1080bp
AAAAATAACTTGAATACGATTTGTTTTACTGTGTCAATTAAATTTTGTCT
TATACTTACATTTTGCTAAATTTTGGTGTGATTTTTTTAATCGAAGTTTC
AATTCTATAATGTCAATTTCTGATACGGAACACTCAGCAGTTGAAAACGA
GGCTAAAGATTTTAAAATTTTAGACATAATACTCTGGCGAAATCCTTTGA
AAACTGCAGCGATTTTATTATCCTGTTTGACTTTAGAAATCAGTTTAATA
TGCTTTTCAGTAATTTCGGTTTTGGCATATGCAGGACTAACGTTTTTAAT
TGTCGCTACAAGTTTTCGTATGTATATGAAATTTAGTGGACAAAGTGACA
ATAACTTTATTCAGCTATATTTGGATAAAGATATTAAAATGAATAAAAGC
AAATCCTCTGCCTTTACAGAAGGGTTTATAGGCAAAGTAGATGCATTTGT
TTTAAAAATTCGAAGTTTATTGTTGATCGAAGATTATTTTGAATCTCTCA
AGTTGGGTGTTTTTCTATATTTTATGACTTATATCGGAGCTAAATTCAAT
TTCATGACTTTATGCATTTTAGTGACTCTTATCGTATTCTGTGTACCGAA
AATCTATCAAACTTATCAGGTTGAATTAGACAATTTGTATCGACTTTTGA
CAAATAAAATTTCGCTTGTTCTATCAAGATTGGCTGATAAAATGCGCCAT
TTACCAGTGATTGGTCCACTTTTTCGACATCACCAACAATAAATCATCGG
GAATAAAATCGATAACTAGTCACACAAAAACAAAACAACAACAACAGAAG
CTTTACTATTTTTATTTAGTGGATTTTTCATTGTATTAGTTTTGTCGTAT
TTATGAGTTTATTTATCAACGTTGTTTTTTTACTTTTTAAATGATTAGCT
ATTCTCTCCGAAACACTTTAATTTATTTCCCGTGCTTGCTTATTTGTCAC
GAGATCGAATTGGCCTGGCCTGTATAGGACAATGATTTTAATACATTTTC
AGATTGTAAAGTTCATTTTTTAGATTTTCTTTTTTTCTATTAATGTCATT
AACAAATATAATTATAATTTTCAAAAAAAA
back to top

protein sequence of SMED30031297-orf-1

>SMED30031297-orf-1 ID=SMED30031297-orf-1|Name=SMED30031297-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=211bp
MSISDTEHSAVENEAKDFKILDIILWRNPLKTAAILLSCLTLEISLICFS
VISVLAYAGLTFLIVATSFRMYMKFSGQSDNNFIQLYLDKDIKMNKSKSS
AFTEGFIGKVDAFVLKIRSLLLIEDYFESLKLGVFLYFMTYIGAKFNFMT
LCILVTLIVFCVPKIYQTYQVELDNLYRLLTNKISLVLSRLADKMRHLPV
IGPLFRHHQQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000101muscle cell
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR003388Reticulon
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003388ReticulonPFAMPF02453Reticuloncoord: 21..177
e-value: 7.6E-32
score: 110.4
IPR003388ReticulonPROSITEPS50845RETICULONcoord: 20..195
score: 30.202
NoneNo IPR availablePANTHERPTHR45799FAMILY NOT NAMEDcoord: 20..195
NoneNo IPR availablePANTHERPTHR45799:SF2RETICULON-LIKE PROTEINcoord: 20..195
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 138..160