cAMP-dependent protein kinase regulatory subunit

Overview
NamecAMP-dependent protein kinase regulatory subunit
Smed IDSMED30031282
Uniprot Best hitcAMP-dependent protein kinase regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=kin-2 PE=1 SV=3 (E=6.8949e-07)
Length (bp)2296
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cAMP-dependent protein kinase regulatory subunit (SMED30031282) t-SNE clustered cells

Violin plots show distribution of expression levels for cAMP-dependent protein kinase regulatory subunit (SMED30031282) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cAMP-dependent protein kinase regulatory subunit (SMED30031282) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cAMP-dependent protein kinase regulatory subunit (SMED30031282) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031282

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30031282SMESG000078515.1 SmedASXL_016086SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031282SMESG000078515.1 dd_Smed_v4_13623_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031282SMESG000078515.1 dd_Smed_v4_13623_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031282SMESG000078515.1 dd_Smed_v4_13623_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30031282SMESG000078515.1 dd_Smed_v4_13623_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031282SMESG000078515.1 dd_Smed_v6_13623_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30031282SMESG000078515.1 dd_Smed_v4_13623_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30031282SMESG000078515.1 dd_Smed_v4_13623_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30031282SMESG000078515.1 dd_Smed_v4_13623_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 52.373 bits (124), Expect = 2.579e-6
Identity = 53/237 (22.36%), Postives = 106/237 (44.73%), Query Frame = 1
Query:  262 QGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELY--NRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVV----VNANQHVSQYPWLNATIYNE---ELRLSDVNDLDKSVDFETKK-PLHNSLSKRLPYIE 942
            +G KG+ FY +  G V+I                       KDE  +   LD         +L  G  FGE+ +++   VR ++I+  E T  LVV+RE +  N+  +E+Q ++   R  F +   LF +W  +   Q+    + E+F +   +      +  + F+  G  +V+    + A+    ++ W +  + +    +  LS+ + +++  +F+ K  PL +  S +LP+++
Sbjct:  146 KGQKGNSFYFIYLGTVAIT----------------------KDEDGSSAFLDPHP-----KLLHKGSCFGEMDVLHAS-VRRSTIVCMEETEFLVVDREDFFANKLDQEVQ-KDAQYRFEFFRKMELFASWSDEKLWQLVAMAKIERFSYGQLISKDFGESPFIMFISKGSCEVLRLLDLGASPSYRRWIWQHLELIDGRPLKTHLSEYSPMERFKEFQIKSYPLQDFSSLKLPHLK 353          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 52.373 bits (124), Expect = 2.920e-6
Identity = 57/239 (23.85%), Postives = 111/239 (46.44%), Query Frame = 1
Query:  262 QGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELY--NRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQ--GEPTNGLTFVLNGHAKVV----VNANQHVSQYPWLNATIYNE---ELRLSDVNDLDKSVDFETKK-PLHNSLSKRLPYIE 942
            +G KG+ FY +  G V+I                       KDE  +   LD         +L  G  FGE+ +++   VR ++I+  E T  LVV+RE +  N+  +E+Q ++   R  F +   LF +W  +   Q+    + E+F +   LI++  GE +  + F+  G  +V+    + A+    ++ W +  + +    +  LS+ + +++  +F+ K  PL +  S +LP+++
Sbjct:  146 KGQKGNSFYFIYLGTVAIT----------------------KDEDGSSAFLDPHP-----KLLHKGSCFGEMDVLHAS-VRRSTIVCMEETEFLVVDREDFFANKLDQEVQ-KDAQYRFEFFRKMELFASWSDEKLWQLVAMAKIERFSYG-QLISKDFGE-SPFIMFISKGSCEVLRLLDLGASPSYRRWIWQHLELIDGRPLKTHLSEYSPMERFKEFQIKSYPLQDFSSLKLPHLK 353          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 52.373 bits (124), Expect = 3.113e-6
Identity = 57/239 (23.85%), Postives = 111/239 (46.44%), Query Frame = 1
Query:  262 QGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELY--NRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQ--GEPTNGLTFVLNGHAKVV----VNANQHVSQYPWLNATIYNE---ELRLSDVNDLDKSVDFETKK-PLHNSLSKRLPYIE 942
            +G KG+ FY +  G V+I                       KDE  +   LD         +L  G  FGE+ +++   VR ++I+  E T  LVV+RE +  N+  +E+Q ++   R  F +   LF +W  +   Q+    + E+F +   LI++  GE +  + F+  G  +V+    + A+    ++ W +  + +    +  LS+ + +++  +F+ K  PL +  S +LP+++
Sbjct:  146 KGQKGNSFYFIYLGTVAIT----------------------KDEDGSSAFLDPHP-----KLLHKGSCFGEMDVLHAS-VRRSTIVCMEETEFLVVDREDFFANKLDQEVQ-KDAQYRFEFFRKMELFASWSDEKLWQLVAMAKIERFSYG-QLISKDFGE-SPFIMFISKGSCEVLRLLDLGASPSYRRWIWQHLELIDGRPLKTHLSEYSPMERFKEFQIKSYPLQDFSSLKLPHLK 353          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 56.225 bits (134), Expect = 4.183e-8
Identity = 54/210 (25.71%), Postives = 91/210 (43.33%), Query Frame = 1
Query:  160 KKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQE---FNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVV 780
            +K  LF  L+E+    +  +    E+   + II QG++GD FYV+  G V +++N E                                   ++  ++ G +FGELALI     R A++IA     L  ++R  Y R +    T++   ++E LS VQ  A    W    +  VA +L +  F    +++ QG+P +    +L G A V+
Sbjct:   86 RKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHE-----------------------------------YVLTINEGGSFGELALI-YGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQW---ERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVL 256          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 55.8398 bits (133), Expect = 5.420e-8
Identity = 54/210 (25.71%), Postives = 91/210 (43.33%), Query Frame = 1
Query:  160 KKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQE---FNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVV 780
            +K  LF  L+E+    +  +    E+   + II QG++GD FYV+  G V +++N E                                   ++  ++ G +FGELALI     R A++IA     L  ++R  Y R +    T++   ++E LS VQ  A    W    +  VA +L +  F    +++ QG+P +    +L G A V+
Sbjct:  118 RKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHE-----------------------------------YVLTINEGGSFGELALI-YGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQW---ERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVL 288          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 55.8398 bits (133), Expect = 6.253e-8
Identity = 54/210 (25.71%), Postives = 91/210 (43.33%), Query Frame = 1
Query:  160 KKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQE---FNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVV 780
            +K  LF  L+E+    +  +    E+   + II QG++GD FYV+  G V +++N E                                   ++  ++ G +FGELALI     R A++IA     L  ++R  Y R +    T++   ++E LS VQ  A    W    +  VA +L +  F    +++ QG+P +    +L G A V+
Sbjct:  128 RKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHE-----------------------------------YVLTINEGGSFGELALI-YGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQW---ERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVL 298          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Xenopus
Match: bmp4 (bone morphogenetic protein 4 [Source:Xenbase;Acc:XB-GENE-483058])

HSP 1 Score: 53.9138 bits (128), Expect = 6.713e-7
Identity = 45/185 (24.32%), Postives = 79/185 (42.70%), Query Frame = 1
Query:  262 QGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNR-ELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVVVNANQHVSQYP 813
            +G +GD FY + +G ++                  VT+D      +   E           +L  G +FGE+AL+  D  RNA+++  E T  LVV+R E +   + +   +E   R    ++  LF++W  K    +A   + E+   +  ++     T  + FV  G  +V+     H+SQ P
Sbjct:   67 KGHRGDSFYFVFSGVIA------------------VTQDVDGSSALLDPE---------PILLHKGASFGEVALLK-DLRRNATVVCMEETEFLVVDRMEFFENKLDQELQKELKYRFQHFRSLDLFSSWSDKSLETLADHCKAEECHHSQVMVKDTHETKNIIFVTKGRCEVLRLV--HLSQCP 221          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. UniProt
Match: sp|P30625|KAPR_CAEEL (cAMP-dependent protein kinase regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=kin-2 PE=1 SV=3)

HSP 1 Score: 55.8398 bits (133), Expect = 6.895e-7
Identity = 54/210 (25.71%), Postives = 91/210 (43.33%), Query Frame = 1
Query:  160 KKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQE---FNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVV 780
            +K  LF  L+E+    +  +    E+   + II QG++GD FYV+  G V +++N E                                   ++  ++ G +FGELALI     R A++IA     L  ++R  Y R +    T++   ++E LS VQ  A    W    +  VA +L +  F    +++ QG+P +    +L G A V+
Sbjct:  118 RKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHE-----------------------------------YVLTINEGGSFGELALI-YGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQW---ERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVL 288          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|18309661 (tr|A0A267DMG6|A0A267DMG6_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022080g1 PE=4 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 1.352e-124
Identity = 251/628 (39.97%), Postives = 361/628 (57.48%), Query Frame = 1
Query:   79 EMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVVVNANQHVSQYPWLNATIYNEEL-------RLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCXXXXXXXXXXX-XXXXAIYKIKHRGSRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFN---FFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFXXXXXXXXXXXXINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQ----TIQHMNLTD---DNRNEVFITA 1908
            E +V CI+KP   R   E+  +  W   K  L   +K +V  +I+++C F E  RDD+IIRQGD+GDCFY+ L G+VS++INTEAVPD+P +A V+V +      G  KKELDR++YG +I    +G+ FGELALIN DCVRNASIIADE T L+VVNR LYNRS+K +Q  EF ER+ FV    +F NWL++YKRQ A SLRKE F F M +  QG+  NGL F+L+G AK+VV+  QH SQYP L+     E+L       +L + N  D+       + L +   +R  Y  AE RQ+QR++E+ ++  GE+IGDIE G++L+TYA SVI ++ TEV++LD+KNFERL   K+N       L +KA  K+  R +R   + +P    L   I +    E R    + QK +  ++ +  D +   F   RGPLID YGPG+VFYRN+ +++E+++  +K +  +M      G +    +  MF  ++    D+ ++           ++           Y       D   D++T S HL  LE R+  WF +V      KR  R ++    + RF +E+ ++KI PGKK++MRPKKQ    T+      D    +  E+FITA
Sbjct:    4 EQIVECISKPPVQRHDSELNELVGWFLTKCPL--KIKPDVAKDILRNCEFRESPRDDVIIRQGDQGDCFYICLTGKVSVYINTEAVPDDPTEAQVLVDDSSDAASG-EKKELDRTKYGKYIVSFGAGRGFGELALINKDCVRNASIIADETTRLIVVNRALYNRSLKAVQEAEFKERIDFVNKCPVFDNWLARYKRQAAMSLRKEMFNFEMTIAKQGDALNGLYFILSGQAKLVVDIIQHYSQYPQLHLHDSPEDLQQREIMGKLMEQNPADERSQSRRHQQLWDKPIRRRGYAAAEHRQSQRHVEISLIGPGEMIGDIEHGMDLSTYAQSVICVQPTEVFVLDSKNFERLVLNKRNQAQTLEILARKAETKLMSRVTRALDKQVPLIRNLCHRILESHRAEER----RRQKADKERDFDVRDSDMSHFIPSRGPLIDPYGPGTVFYRNK-MKRERKLAAQKAKEAKMG-----GRKPPAAAAAMFAVDEPGTDDEGADGAAAATDHRRLDD----------PYEAARRVLDEFEDFDTSSEHLVDLERRISVWFDNVDQT---KRGARVVQ----MTRFHKEE-DRKIHPGKKVYMRPKKQPRRVTLGSSEPEDWGYKSEEEIFITA 600          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|18250457 (tr|A0A267FVW0|A0A267FVW0_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022080g2 PE=4 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 1.403e-124
Identity = 251/628 (39.97%), Postives = 360/628 (57.32%), Query Frame = 1
Query:   79 EMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVVVNANQHVSQYPWLNATIYNEEL-------RLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCXXXXXXXXXXX-XXXXAIYKIKHRGSRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFN---FFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFXXXXXXXXXXXXINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQ----TIQHMNLTD---DNRNEVFITA 1908
            E +V CI+KP   R   E+  +  W   K  L   +K +V  +I+++C F E  RDD+IIRQGD+GDCFY+ L G+VS++INTEAVPD+P +A V+V +      G  KKELDR++YG +I    +G+ FGELALIN DCVRNASIIADE T L+VVNR LYNRS+K +Q  EF ER+ FV    +F NWL++YKRQ A SLRKE F F M +  QG+  NGL F+L+G AK+VV+  QH SQYP L+     E+L       +L + N  D+       + L     +R  Y  AE RQ+QR++E+ ++  GE+IGDIE G++L+TYA SVI ++ TEV++LD+KNFERL   K+N       L +KA  K+  R +R   + +P    L   I +    E R    + QK +  ++ +  D +   F   RGPLID YGPG+VFYRN+ +++E+++  +K +  +M      G +    +  MF  ++    D+ ++           ++           Y       D   D++T S HL  LE R+  WF +V      KR  R ++    + RF +E+ ++KI PGKK++MRPKKQ    T+      D    +  E+FITA
Sbjct:    4 EQIVECISKPPVQRHDSELNELVGWFLTKCPL--KIKPDVAKDILRNCEFRESPRDDVIIRQGDQGDCFYICLTGKVSVYINTEAVPDDPTEAQVLVDDSSDAASG-EKKELDRTKYGKYIVSFGAGRGFGELALINKDCVRNASIIADETTRLIVVNRALYNRSLKAVQEAEFKERIDFVNKCPVFDNWLARYKRQAAMSLRKEMFNFEMTIAKQGDALNGLYFILSGQAKLVVDIIQHYSQYPQLHLHDSPEDLQQREIMGKLMEQNPADERSQSRRHQQLWEKPIRRRGYAAAEHRQSQRHVEISLIGPGEMIGDIEHGMDLSTYAQSVICVQPTEVFVLDSKNFERLVLNKRNQAQTLEILARKAETKLMSRVTRALDKQVPLIRNLCHRIVESHRAEER----RRQKADKERDFDVRDSDMSHFIPSRGPLIDPYGPGTVFYRNK-MKRERKLAAQKAKEAKMG-----GRKPPAAAAAMFAVDEPGTDDEGADGAAAATDHRRLDD----------PYEAARRVLDEFEDFDTSSEHLVDLERRISVWFDNVDQT---KRGARVVQ----MTRFHKEE-DRKIHPGKKVYMRPKKQPRRVTLGSSEPEDWGYKSEEEIFITA 600          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|18184652 (tr|A0A1I8IH13|A0A1I8IH13_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 7.452e-120
Identity = 251/628 (39.97%), Postives = 361/628 (57.48%), Query Frame = 1
Query:   79 EMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVVVNANQHVSQYPWLNATIYNEEL-------RLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCXXXXXXXXXXX-XXXXAIYKIKHRGSRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFN---FFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFXXXXXXXXXXXXINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQ----TIQHMNLTD---DNRNEVFITA 1908
            E +V CI+KP   R   E+  +  W   K  L   +K +V  +I+++C F E  RDD+IIRQGD+GDCFY+ L G+VS++INTEAVPD+P +A V+V +      G  KKELDR++YG +I    +G+ FGELALIN DCVRNASIIADE T L+VVNR LYNRS+K +Q  EF ER+ FV    +F NWL++YKRQ A SLRKE F F M +  QG+  NGL F+L+G AK+VV+  QH SQYP L+     E+L       +L + N  D+       + L +   +R  Y  AE RQ+QR++E+ ++  GE+IGDIE G++L+TYA SVI ++ TEV++LD+KNFERL   K+N       L +KA  K+  R +R   + +P    L   I +    E R    + QK +  ++ +  D +   F   RGPLID YGPG+VFYRN+ +++E+++  +K +  +M      G +    +  MF  ++    D+ ++           ++           Y       D   D++T S HL  LE R+  WF +V      KR  R ++    + RF +E+ ++KI PGKK++MRPKKQ    T+      D    +  E+FITA
Sbjct:    4 EQIVECISKPPVQRHDSELNELVGWFLTKCPL--KIKPDVAKDILRNCEFRESPRDDVIIRQGDQGDCFYICLTGKVSVYINTEAVPDDPTEAQVLVDDSSDAASG-EKKELDRTKYGKYIVSFGAGRGFGELALINKDCVRNASIIADETTRLIVVNRALYNRSLKAVQEAEFKERIDFVNKCPVFDNWLARYKRQAAMSLRKEMFNFEMTIAKQGDALNGLYFILSGQAKLVVDIIQHYSQYPQLHLHDSPEDLQQREIMGKLMEQNPADERSQSRRHQQLWDKPIRRRGYAAAEHRQSQRHVEISLIGPGEMIGDIEHGMDLSTYAQSVICVQPTEVFVLDSKNFERLVLNKRNQAQTLEILARKAETKLMSRVTRALDKQVPLIRNLCHRILESHRAEER----RRQKADKERDFDVRDSDMSHFIPSRGPLIDPYGPGTVFYRNK-MKRERKLAAQKAKEAKMG-----GRKPPAAAAAMFAVDEPGTDDEGADGAAAATDHRRLDD----------PYEAARRVLDEFEDFDTSSEHLVDLERRISVWFDNVD---QTKRGARVVQ----MTRFHKEE-DRKIHPGKKVYMRPKKQPRRVTLGSSEPEDWGYKSEEEIFITA 600          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|18245609 (tr|A0A1I8INU3|A0A1I8INU3_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 9.466e-119
Identity = 251/628 (39.97%), Postives = 363/628 (57.80%), Query Frame = 1
Query:   79 EMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVVVNANQHVSQYPWLNATIYNEEL-------RLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCX-XXXXXXXXXXXXXXAIYKIKHRGSRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFN---FFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFXXXXXXXXXXXXINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQ----TIQHMNLTD---DNRNEVFITA 1908
            E +V CI+KP   R   E+  +  W   K  L   +K +V  +I+++C F E  RDD+IIRQGD+GDCFY+ L G+VS++INTEAVPD+P +A V+V +      G  KKELDR++YG +I    +G+ FGELALIN DCVRNASIIADE T L+VVNR LYNRS+K +Q  EF ER+ FV    +F NWL++YKRQ A SLRKE F F M +  QG+  NGL F+L+G AK+VV+  QH SQYP L+     E+L       +L + N  D+       + L +   +R  Y  AE RQ+QR++E+ ++  GE+IGDIE G++L+TYA SVI ++ TEV++LD+KNFERL    +   +TL +L +KA  K+  R +R   + +P    L   I +    E R    + QK +  ++ +  D +   F   RGPLID YGPG+VFYRN+ +++E+++  +K +  +M      G +    +  MF  ++    D+ ++           ++           Y       D   D++T S HL  LE R+  WF +V      KR  R ++    + RF +E+ ++KI PGKK++MRPKKQ    T+      D    +  E+FITA
Sbjct:  478 ERIVECISKPPVQRHDSELNELVGWFLTKCPL--KIKPDVAKDILRNCEFRESPRDDVIIRQGDQGDCFYICLTGKVSVYINTEAVPDDPTEAQVLVDDSSDAASG-EKKELDRTKYGKYIVSFGAGRGFGELALINKDCVRNASIIADETTRLIVVNRALYNRSLKAVQEAEFKERIDFVNKCPVFDNWLARYKRQAAMSLRKEMFNFEMTIAKQGDALNGLYFILSGQAKLVVDIIQHYSQYPQLHLHDSPEDLQQREIMGKLMEQNPADERSQSRRHQQLWDKPIRRRGYAAAEHRQSQRHVEISLIGPGEMIGDIEHGMDLSTYAQSVICVQPTEVFVLDSKNFERLVLNKRNQAQTLEILARKAETKLMSRVTRALDKQVPLIRNLCHRILESHRAEER----RRQKADKERDFDVRDSDMSHFIPSRGPLIDPYGPGTVFYRNK-MKRERKLAAQKAKEAKMG-----GRKPPAAAAAMFAVDEPGTDDEGADGAAAATDHRRLDD----------PYEAARRVLDEFEDFDTSSEHLVDLERRISVWFDNVD---QTKRGARVVQ----MTRFHKEE-DRKIHPGKKVYMRPKKQPRRVTLGSSEPEDWGYKSEEEIFITA 1074          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|20714190 (tr|A0A504Z0U3|A0A504Z0U3_FASGI Putative camp-dependent protein kinase regulatory chain OS=Fasciola gigantica OX=46835 GN=FGIG_01953 PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 4.347e-97
Identity = 222/642 (34.58%), Postives = 337/642 (52.49%), Query Frame = 1
Query:   67 TAMYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVT-------------EDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVVVNANQHVSQYPWLNA---------TIYNEELRLSDVNDLDKSVDFET--------KKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCXXXXXXXXXXXXXXXAIYKIKHRGSRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEAL--KNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRR-GNQRGGVSIGMFGNEKFXXXXXXXXXXXXINTISHFNNYNNNQNVDCIDYLKG----FN-------------AHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRP 1842
            TA+   V    +KP + RT D++  I PW  +K+  F SLK +V+ ++I++C F ER  DDIIIRQ + GDCFY++ +G+V+I++NTEAVPD+  D N   T             E K +     +K  +R+++GN + IL  G +FGELALIN DC+RNASIIAD  T L+V+NR  +NRS++E+    F ER  FV N  LF  WL   K+QV  SL K    F   +I QGEP +GL F+  G  ++ V+      Q+P L            +  E ++++       +V  ET        +KP+      RL Y+ +E+RQ  +N+ + I   G I G++E GL LTT A+S++ +EA+E Y L A NFERL + ++N   L +L+ +A   I  R SR   R +P +    E I D + ++  ES+ + + +E L  KN      NF   RGP+ID YGPG+VFYRN+Q R+E     ++RQ+ +  L GR    +R   +     N+ F  +  +S      +  S  +     + V C     G    +N              +  ++DWETG  +L+ LE++LR W++ +    N           + LKR+K     + ++PGK I++ P
Sbjct:    5 TALLNSVFGYFSKPVEQRTNDDVEHIFPWFVEKSQFFSSLKPDVVKDLIRNCEFIERESDDIIIRQFETGDCFYIVFSGQVAIYVNTEAVPDDVADENEATTSPSIGTTENVDNAEAKHQTPVPIRKATNRTKFGNHVGILKDGASFGELALINRDCIRNASIIADTRTQLIVINRATFNRSLREVHLASFRERSEFVNNCPLFAGWLRSLKKQVVMSLTKLSVPFGHCVIRQGEPLDGLFFLTKGQVEINVDILMQNRQFPNLMPKLSVSDFERILSKEGIKVAADPTAPLAVLKETEMLRERVGQKPI-----SRLGYLISERRQVLKNMHLSITGVGAIFGELEYGLGLTTNATSIVCVEASEFYALSATNFERLLHSRRNTNALRMLRTRAEQSIMQRLSRTPDRRVPLFQYFFEQIYDRKMKD--ESEQRERVMERLTEKNKSPTTINFIPRRGPVIDEYGPGTVFYRNKQRREEA----KRRQLLQRQLTGRSPSTRRRKQNRSTESNDLFFQAIPQSARTTLPSNPSRPHTSGTARTVGCGSAKYGERGEYNNTSESIAADAAALGYRGLSDWETGGDYLKHLEEKLRRWYIELEVENNWNFP--VANMISPLKRYKSATSLRNLLPGKIIYIHP 633          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005682.1 (pep scaffold:Pmarinus_7.0:GL476331:764222:769958:1 gene:ENSPMAG00000005146.1 transcript:ENSPMAT00000005682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.536e-8
Identity = 60/267 (22.47%), Postives = 113/267 (42.32%), Query Frame = 1
Query:   79 EMVVSCITKPSKDRTPDEIISISPWLRKKAAL--FDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRE-LYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKV--VVNANQHVSQYPWLNATIYNEELRLSDVN 864
            E  V    KP  +R+  E+I +   LR  ++   + +  + +L  +++   F  RR       +G  G  FY + +G V++        DN   +  +  E                       +L  G  FGE+AL+  D  RNA+I+  E T LLVV++E  +   + +   +EF  R ++ ++  LF+ W  +    +A   + E+F     +      T  + FV+ G   V  +V+ +   S + WL   +  +E +++  +
Sbjct:    3 EKAVRAALKPPSERSDTEVIFLRGLLRGLSSFRRYTAHLQLMLAGVVRYEKFGRRRVIVK---KGHYGRRFYFVFSGLVAV------TKDNDGSSAFIDPEP---------------------ILLRKGAGFGEIALLK-DLSRNATIVCMEETELLVVDKEDFFAYKLDQELRKEFQHRYNYFRSLELFSTWSDESLETMADHCKIEEFNHGQVVTGDTSETKNIIFVIKGCCDVLRLVDLSGCPSYHDWLQQQVKIQEKKIAGTH 238          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Nematostella
Match: EDO49032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHT2])

HSP 1 Score: 87.4261 bits (215), Expect = 4.830e-20
Identity = 51/168 (30.36%), Postives = 100/168 (59.52%), Query Frame = 1
Query:   73 MYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSI 576
            ++++  S ++KPS+ R   ++  I  W R+++ LF  L+++ L +IIK+ + +  R+D+II+RQG+KG+CFY++L G VS++   +       D       ++       +  L    +G  ++ L +G++FGE+ +++    RN ++IADE T L+ ++ +LY RS+
Sbjct:    9 IWDLAESILSKPSEQRDDADLEHIICWFRQRSPLFKLLEDDALLDIIKNVTLTRYRKDNIIMRQGEKGNCFYIILKGSVSVYAKQDG------DGEAATHHEQSVRSHKERLLL----FGAELSSLRAGRSFGEMVMVDERKERNTTVIADEATMLISIDEKLYERSL 166          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Nematostella
Match: EDO48439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJW7])

HSP 1 Score: 53.1434 bits (126), Expect = 2.654e-7
Identity = 60/233 (25.75%), Postives = 103/233 (44.21%), Query Frame = 1
Query:  163 KAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKR-QVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVVV--NANQHVSQYPWLNATIYNEELRL 852
            K  LF  L E   ++I  + S  +    +III+QGD+GD FY++ +G V +F+N           NV                         ++ +  G +FGELALI     R A+I A     L  ++R  Y R +   Q ++      F++  ++  + L K++R  VA +L   +F    +++ QGE  +    ++ G A V+   +AN+   +   L  + Y  E+ L
Sbjct:  127 KNILFSHLDENERSDIFDAMSLVKHGAGEIIIKQGDEGDNFYIVDSGEVDVFVN-----------NV-----------------------GLVSTIGEGGSFGELALI-YGTPRAATIKAKTDVKLWAIDRVTYRRILMGSQIRKRRMYEQFLEKVSILES-LDKWERLTVADALEPTQFQDGDDVVVQGEHGDEFFIIVEGTAVVLQRRSANEDFIEVSRLGPSDYFGEIAL 323          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000078515.1 (SMESG000078515.1)

HSP 1 Score: 1303.12 bits (3371), Expect = 0.000e+0
Identity = 704/709 (99.29%), Postives = 708/709 (99.86%), Query Frame = 1
Query:   64 MTAMYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVVVNANQHVSQYPWLNATIYNEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCXXXXXXXXXXXXXXXAIYKIKHRGSRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFXXXXXXXXXXXXINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTIQHMNLTDDNRNEVFITAXXXXXXXXXXXXXFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEVQRTVLSHQYTMAEYQQXXXXXXXXEIEMRVFQTAMSI 2190
            MTAMYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTF+LNGHAKVVVNANQHVSQYPWLNATI NEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRG+RLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFENSDD+SEDGEEINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTI+HMNLTDDNRNEVFITAPKLKTTPTNLKKTFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEVQRTVLSHQYTMAEYQQLKLLLKKKEIEMRVFQTAMSI
Sbjct:    1 MTAMYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFILNGHAKVVVNANQHVSQYPWLNATINNEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRGNRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFENSDDDSEDGEEINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTIKHMNLTDDNRNEVFITAPKLKTTPTNLKKTFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEVQRTVLSHQYTMAEYQQLKLLLKKKEIEMRVFQTAMSI 709          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000078515.1 (SMESG000078515.1)

HSP 1 Score: 1296.95 bits (3355), Expect = 0.000e+0
Identity = 703/709 (99.15%), Postives = 707/709 (99.72%), Query Frame = 1
Query:   64 MTAMYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVVVNANQHVSQYPWLNATIYNEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCXXXXXXXXXXXXXXXAIYKIKHRGSRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFXXXXXXXXXXXXINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTIQHMNLTDDNRNEVFITAXXXXXXXXXXXXXFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEVQRTVLSHQYTMAEYQQXXXXXXXXEIEMRVFQTAMSI 2190
            MTAMYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTF+LNGHAKVVVNANQHVSQYPWLNATI NEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRG+RLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFENSDD+SEDGEEINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTI+HMNLTDDNRNEVFITAPKLKTTPTNLKKTFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEV RTVLSHQYTMAEYQQLKLLLKKKEIEMRVFQTAMSI
Sbjct:    1 MTAMYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFILNGHAKVVVNANQHVSQYPWLNATINNEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRGNRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFENSDDDSEDGEEINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTIKHMNLTDDNRNEVFITAPKLKTTPTNLKKTFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEV-RTVLSHQYTMAEYQQLKLLLKKKEIEMRVFQTAMSI 708          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000078515.1 (SMESG000078515.1)

HSP 1 Score: 1296.57 bits (3354), Expect = 0.000e+0
Identity = 701/706 (99.29%), Postives = 705/706 (99.86%), Query Frame = 1
Query:   73 MYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVVVNANQHVSQYPWLNATIYNEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCXXXXXXXXXXXXXXXAIYKIKHRGSRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFXXXXXXXXXXXXINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTIQHMNLTDDNRNEVFITAXXXXXXXXXXXXXFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEVQRTVLSHQYTMAEYQQXXXXXXXXEIEMRVFQTAMSI 2190
            MYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTF+LNGHAKVVVNANQHVSQYPWLNATI NEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRG+RLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFENSDD+SEDGEEINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTI+HMNLTDDNRNEVFITAPKLKTTPTNLKKTFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEVQRTVLSHQYTMAEYQQLKLLLKKKEIEMRVFQTAMSI
Sbjct:    1 MYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFILNGHAKVVVNANQHVSQYPWLNATINNEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRGNRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFENSDDDSEDGEEINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTIKHMNLTDDNRNEVFITAPKLKTTPTNLKKTFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEVQRTVLSHQYTMAEYQQLKLLLKKKEIEMRVFQTAMSI 706          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000078515.1 (SMESG000078515.1)

HSP 1 Score: 1290.4 bits (3338), Expect = 0.000e+0
Identity = 700/706 (99.15%), Postives = 704/706 (99.72%), Query Frame = 1
Query:   73 MYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVVVNANQHVSQYPWLNATIYNEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCXXXXXXXXXXXXXXXAIYKIKHRGSRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFXXXXXXXXXXXXINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTIQHMNLTDDNRNEVFITAXXXXXXXXXXXXXFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEVQRTVLSHQYTMAEYQQXXXXXXXXEIEMRVFQTAMSI 2190
            MYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTF+LNGHAKVVVNANQHVSQYPWLNATI NEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRG+RLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFENSDD+SEDGEEINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTI+HMNLTDDNRNEVFITAPKLKTTPTNLKKTFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEV RTVLSHQYTMAEYQQLKLLLKKKEIEMRVFQTAMSI
Sbjct:    1 MYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFILNGHAKVVVNANQHVSQYPWLNATINNEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRGNRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFENSDDDSEDGEEINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTIKHMNLTDDNRNEVFITAPKLKTTPTNLKKTFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEV-RTVLSHQYTMAEYQQLKLLLKKKEIEMRVFQTAMSI 705          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000078515.1 (SMESG000078515.1)

HSP 1 Score: 1289.63 bits (3336), Expect = 0.000e+0
Identity = 698/703 (99.29%), Postives = 702/703 (99.86%), Query Frame = 1
Query:   82 MVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSEXXXXXXXXXQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVVVNANQHVSQYPWLNATIYNEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCXXXXXXXXXXXXXXXAIYKIKHRGSRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFXXXXXXXXXXXXINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTIQHMNLTDDNRNEVFITAXXXXXXXXXXXXXFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEVQRTVLSHQYTMAEYQQXXXXXXXXEIEMRVFQTAMSI 2190
            MVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTF+LNGHAKVVVNANQHVSQYPWLNATI NEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRG+RLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFENSDD+SEDGEEINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTI+HMNLTDDNRNEVFITAPKLKTTPTNLKKTFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEVQRTVLSHQYTMAEYQQLKLLLKKKEIEMRVFQTAMSI
Sbjct:    1 MVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFILNGHAKVVVNANQHVSQYPWLNATINNEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRGNRLEFRPIPFYIRLNEMIADEEDRETRESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEKQIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFENSDDDSEDGEEINTISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFLSVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTIKHMNLTDDNRNEVFITAPKLKTTPTNLKKTFEDAVESNSEIQNKKLMKSLSVVHKEFFSFDNHFNIRRKSKSEVQRTVLSHQYTMAEYQQLKLLLKKKEIEMRVFQTAMSI 703          
The following BLAST results are available for this feature:
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CNBD22.579e-622.36cyclic nucleotide binding domain containing 2 [Sou... [more]
CNBD22.920e-623.85cyclic nucleotide binding domain containing 2 [Sou... [more]
CNBD23.113e-623.85cyclic nucleotide binding domain containing 2 [Sou... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kin-24.183e-825.71cAMP-dependent protein kinase regulatory subunit ... [more]
kin-25.420e-825.71cAMP-dependent protein kinase regulatory subunit ... [more]
kin-26.253e-825.71cAMP-dependent protein kinase regulatory subunit ... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bmp46.713e-724.32bone morphogenetic protein 4 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P30625|KAPR_CAEEL6.895e-725.71cAMP-dependent protein kinase regulatory subunit O... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|183096611.352e-12439.97tr|A0A267DMG6|A0A267DMG6_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182504571.403e-12439.97tr|A0A267FVW0|A0A267FVW0_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|181846527.452e-12039.97tr|A0A1I8IH13|A0A1I8IH13_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182456099.466e-11939.97tr|A0A1I8INU3|A0A1I8INU3_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|207141904.347e-9734.58tr|A0A504Z0U3|A0A504Z0U3_FASGI Putative camp-depen... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005682.11.536e-822.47pep scaffold:Pmarinus_7.0:GL476331:764222:769958:1... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO490324.830e-2030.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484392.654e-725.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078515.10.000e+099.29SMESG000078515.1[more]
SMESG000078515.10.000e+099.15SMESG000078515.1[more]
SMESG000078515.10.000e+099.29SMESG000078515.1[more]
SMESG000078515.10.000e+099.15SMESG000078515.1[more]
SMESG000078515.10.000e+099.29SMESG000078515.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031282 ID=SMED30031282|Name=cAMP-dependent protein kinase regulatory subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=2296bp
TTTATTTTATATATTTTTGTTATTTATATAAAGTGCAGTAAATATTTTCA
GTAATTCACCACAATGACTGCAATGTACGAAATGGTCGTTTCATGCATCA
CGAAACCATCAAAAGACAGAACGCCAGATGAAATAATCAGCATCTCCCCG
TGGCTGAGAAAAAAAGCCGCCTTGTTTGATAGTTTGAAAGAGGAGGTGCT
TAACGAAATTATCAAAAGTTGTTCTTTTTCTGAAAGGAGACGGGATGATA
TTATTATTAGACAAGGGGATAAAGGTGACTGCTTTTATGTGATGCTAGCT
GGTCGGGTGTCCATTTTCATTAATACAGAGGCAGTTCCTGACAATCCTGA
AGATGCAAATGTCGTTGTGACAGAAGATAAGTTCAAGGATGAAGGAATGG
CAAAAAAGGAACTTGATCGAAGTCGTTATGGAAATTTTATTGCAATTCTA
GATTCCGGGAAAGCATTTGGGGAGTTAGCTCTGATAAACACAGATTGCGT
AAGAAACGCATCCATCATTGCAGATGAATTGACTCATTTACTCGTCGTAA
ATCGGGAACTGTACAATCGCTCAATCAAGGAGATTCAGACCCAGGAATTC
AATGAGCGTTTAAGTTTTGTCCAAAACTCGGCTCTCTTTACCAACTGGTT
ATCAAAATATAAAAGACAAGTGGCATTTTCATTAAGAAAGGAAAAATTCG
GATTCAATATGAATTTAATTACTCAAGGTGAACCGACAAATGGATTGACA
TTTGTATTAAATGGGCATGCTAAAGTTGTAGTGAATGCAAATCAACATGT
TTCACAATATCCGTGGCTTAATGCGACCATTTATAATGAAGAATTGAGGT
TGTCAGATGTAAATGATTTGGACAAAAGTGTTGATTTTGAAACTAAAAAG
CCTTTACATAATTCATTATCAAAACGTCTACCATATATTGAAGCCGAACA
AAGACAAGCACAAAGAAATATTGAAGTCTGTATCGTGAAGGGAGGCGAAA
TTATTGGTGACATTGAACAGGGATTAGAATTGACAACATATGCATCTTCA
GTTATCACAATTGAAGCCACCGAGGTATATATTTTGGACGCCAAAAACTT
TGAAAGACTTTGTAATCCAAAAAAAAATCCAAAAACCTTAAATTTATTAA
AGAAGAAAGCAATTTATAAAATCAAACACAGAGGAAGCCGATTGGAATTT
CGTCCAATTCCATTTTATATAAGACTCAACGAAATGATTGCTGACGAAGA
AGACAGAGAAACAAGGGAATCTGATTTAAAAAATCAAAAGATAGAGGCGT
TGAAAAATAATGAAAAGGGAGATTTTAATTTTTTTCAACATCGAGGACCC
CTGATTGATTTGTACGGACCTGGTTCAGTCTTTTACCGAAACCGACAGCT
CCGTAAAGAGAAACAAATAATTGAGAGAAAACGACAAATTACCGAAATGG
CGTTAAAAGGTAGAAGAGGTAATCAACGTGGAGGGGTGTCGATTGGGATG
TTTGGTAATGAAAAGTTTGAAAATTCTGATGATGAGTCTGAAGATGGAGA
AGAAATAAATACAATTTCACATTTTAATAACTACAACAATAACCAAAACG
TTGACTGCATAGACTATCTAAAAGGCTTCAATGCCCATGATTCAATGAAT
GATTGGGAAACTGGCTCAGTTCATTTACAAAGTCTAGAAGACCGGCTTCG
AAACTGGTTTTTATCAGTCAGTTCTTTGACGAATGACAAAAGAGCTGGCA
GAGCAATTGAACATTACACAATTCTTAAGCGATTCAAACAAGAAGATTTG
GAGAAGAAAATCATTCCTGGAAAAAAGATATTTATGCGTCCAAAGAAACA
AACGATACAACATATGAACTTGACCGATGACAACAGAAATGAAGTCTTCA
TCACTGCCCCTAAGCTCAAAACAACCCCAACCAATTTAAAAAAAACATTC
GAAGATGCTGTGGAATCGAATTCTGAAATACAAAATAAAAAATTAATGAA
ATCTTTGTCTGTCGTGCACAAGGAATTCTTCTCCTTTGACAATCATTTCA
ATATTCGAAGAAAATCCAAATCAGAAGTGCAGCGAACAGTATTGTCCCAT
CAGTATACAATGGCTGAATACCAGCAGCTGAAGCTGTTATTGAAGAAAAA
GGAAATTGAAATGCGAGTATTTCAAACAGCCATGTCGATTTAATGAAGAA
AAATTATATAATTATATTTTTGTAGTGTCTTTTGGTGTTTTTTATATTAG
AAGTTTCTCGTTATTTTTGTACTGACATAATAAACCTCTGTTCACC
back to top

protein sequence of SMED30031282-orf-1

>SMED30031282-orf-1 ID=SMED30031282-orf-1|Name=SMED30031282-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=710bp
MTAMYEMVVSCITKPSKDRTPDEIISISPWLRKKAALFDSLKEEVLNEII
KSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANV
VVTEDKFKDEGMAKKELDRSRYGNFIAILDSGKAFGELALINTDCVRNAS
IIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYK
RQVAFSLRKEKFGFNMNLITQGEPTNGLTFVLNGHAKVVVNANQHVSQYP
WLNATIYNEELRLSDVNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQ
RNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLC
NPKKNPKTLNLLKKKAIYKIKHRGSRLEFRPIPFYIRLNEMIADEEDRET
RESDLKNQKIEALKNNEKGDFNFFQHRGPLIDLYGPGSVFYRNRQLRKEK
QIIERKRQITEMALKGRRGNQRGGVSIGMFGNEKFENSDDESEDGEEINT
ISHFNNYNNNQNVDCIDYLKGFNAHDSMNDWETGSVHLQSLEDRLRNWFL
SVSSLTNDKRAGRAIEHYTILKRFKQEDLEKKIIPGKKIFMRPKKQTIQH
MNLTDDNRNEVFITAPKLKTTPTNLKKTFEDAVESNSEIQNKKLMKSLSV
VHKEFFSFDNHFNIRRKSKSEVQRTVLSHQYTMAEYQQLKLLLKKKEIEM
RVFQTAMSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000595cNMP-bd_dom
IPR014710RmlC-like_jellyroll
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 443..463
NoneNo IPR availablePRINTSPR00103CAMPKINASEcoord: 73..87
score: 35.56
coord: 58..72
score: 42.0
coord: 133..142
score: 57.0
NoneNo IPR availablePANTHERPTHR11635:SF152CAMP-DEPENDENT PROTEIN KINASE TYPE I REGULATORY SUBUNITcoord: 9..543
NoneNo IPR availablePANTHERPTHR11635CAMP-DEPENDENT PROTEIN KINASE REGULATORY CHAINcoord: 9..543
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 37..186
e-value: 0.0018
score: 27.5
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 37..171
score: 22.087
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 37..169
e-value: 8.88761E-15
score: 68.8918
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 7..177
e-value: 3.4E-28
score: 100.0
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 64..80
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 176..351
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 22..173