Transmembrane protein 104

Overview
NameTransmembrane protein 104
Smed IDSMED30031280
Length (bp)1805
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 104 (SMED30031280) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 104 (SMED30031280) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 104 (SMED30031280) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 104 (SMED30031280) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031280

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30031280SMESG000052539.1 Contig3111GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30031280SMESG000052539.1 dd_Smed_v4_7100_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 104 vs. Ensembl Human
Match: TMEM104 (transmembrane protein 104 [Source:HGNC Symbol;Acc:HGNC:25984])

HSP 1 Score: 312.383 bits (799), Expect = 3.156e-99
Identity = 207/520 (39.81%), Postives = 298/520 (57.31%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILA---LSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFV--NIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVN 1713
            E +S  VG +Y+FNLIVGTGAL +PKAF  AGW++S ++L  L  +S++TTT+VIEAMA +N      ++            +NL ++      T + +  +  D+     + ++ +    S       + FEI D  E+G MA ++FN++G+ LFY  + VYLYGDLA+YAAAVP S+  V C+   N S  + A    +++D CW    + R++AYRI+L  F LLL PFTFF++ KTK++Q  T  MRW AF +M  L  I +  G     P LA+FS   NL G+C+YSFM  HSLPSLITP+ +K  L  L+FL + +IL FY LLS  + F F   ++  + TLNF       +  V  +A  +++L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +P + ++PP++V + T+++  LVG TG+YAGT IQYVIP  LV   RR   +    F     N             +SPFRH  W   +L+WA    + VT N
Sbjct:   10 ELYSSYVGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLVFLGFMSFVTTTFVIEAMAAANAQLHWKRM------------ENLKEEEDDDSSTASDSDVLIRDN-----YERAEKRPILSVQRRGSPNPFEITDRVEMGQMASMFFNKVGVNLFYFCIIVYLYGDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCW--GPLRRVDAYRIYLAIFTLLLGPFTFFDVQKTKYLQILTSLMRWIAFAVMIVLALIRIGHGQGEGHPPLADFSGVRNLFGVCVYSFMCQHSLPSLITPVSSKRHLTRLVFLDYVLILAFYGLLSFTAIFCFRGDSLMDMYTLNFA------RCDVVGLAAVRFFLGLFPVFTISTNFPIIAVTLRNNWKTLFHREGGTY--PWVVDRVVFPTITLVPPVLVAFCTHDLESLVGITGAYAGTGIQYVIPAFLVYHCRRDTQL---AFGCGVSNK-----------HRSPFRHTFWVGFVLLWAFSCFIFVTAN 488          
BLAST of Transmembrane protein 104 vs. Ensembl Human
Match: TMEM104 (transmembrane protein 104 [Source:HGNC Symbol;Acc:HGNC:25984])

HSP 1 Score: 312.383 bits (799), Expect = 3.156e-99
Identity = 207/520 (39.81%), Postives = 298/520 (57.31%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILA---LSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFV--NIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVN 1713
            E +S  VG +Y+FNLIVGTGAL +PKAF  AGW++S ++L  L  +S++TTT+VIEAMA +N      ++            +NL ++      T + +  +  D+     + ++ +    S       + FEI D  E+G MA ++FN++G+ LFY  + VYLYGDLA+YAAAVP S+  V C+   N S  + A    +++D CW    + R++AYRI+L  F LLL PFTFF++ KTK++Q  T  MRW AF +M  L  I +  G     P LA+FS   NL G+C+YSFM  HSLPSLITP+ +K  L  L+FL + +IL FY LLS  + F F   ++  + TLNF       +  V  +A  +++L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +P + ++PP++V + T+++  LVG TG+YAGT IQYVIP  LV   RR   +    F     N             +SPFRH  W   +L+WA    + VT N
Sbjct:   10 ELYSSYVGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLVFLGFMSFVTTTFVIEAMAAANAQLHWKRM------------ENLKEEEDDDSSTASDSDVLIRDN-----YERAEKRPILSVQRRGSPNPFEITDRVEMGQMASMFFNKVGVNLFYFCIIVYLYGDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCW--GPLRRVDAYRIYLAIFTLLLGPFTFFDVQKTKYLQILTSLMRWIAFAVMIVLALIRIGHGQGEGHPPLADFSGVRNLFGVCVYSFMCQHSLPSLITPVSSKRHLTRLVFLDYVLILAFYGLLSFTAIFCFRGDSLMDMYTLNFA------RCDVVGLAAVRFFLGLFPVFTISTNFPIIAVTLRNNWKTLFHREGGTY--PWVVDRVVFPTITLVPPVLVAFCTHDLESLVGITGAYAGTGIQYVIPAFLVYHCRRDTQL---AFGCGVSNK-----------HRSPFRHTFWVGFVLLWAFSCFIFVTAN 488          
BLAST of Transmembrane protein 104 vs. Ensembl Human
Match: TMEM104 (transmembrane protein 104 [Source:HGNC Symbol;Acc:HGNC:25984])

HSP 1 Score: 162.54 bits (410), Expect = 1.291e-44
Identity = 101/252 (40.08%), Postives = 150/252 (59.52%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILA---LSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRW 915
            E +S  VG +Y+FNLIVGTGAL +PKAF  AGW++S ++L  L  +S++TTT+VIEAMA +N      ++            +NL ++      T + +  +  D+     + ++ +    S       + FEI D  E+G MA ++FN++G+ LFY  + VYLYGDLA+YAAAVP S+  V C+   N S  + A    +++D CW    + R++AYRI+L  F LLL PFTFF++ KTK++Q  T  MRW
Sbjct:   10 ELYSSYVGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLVFLGFMSFVTTTFVIEAMAAANAQLHWKRM------------ENLKEEEDDDSSTASDSDVLIRDN-----YERAEKRPILSVQRRGSPNPFEITDRVEMGQMASMFFNKVGVNLFYFCIIVYLYGDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCW--GPLRRVDAYRIYLAIFTLLLGPFTFFDVQKTKYLQILTSLMRW 242          
BLAST of Transmembrane protein 104 vs. Ensembl Human
Match: TMEM104 (transmembrane protein 104 [Source:HGNC Symbol;Acc:HGNC:25984])

HSP 1 Score: 121.709 bits (304), Expect = 7.536e-30
Identity = 75/205 (36.59%), Postives = 115/205 (56.10%), Query Frame = 1
Query:  310 YITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILA---LSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRW 915
            ++TTT+VIEAMA +N      ++            +NL ++      T + +  +  D+     + ++ +    S       + FEI D  E+G MA ++FN++G+ LFY  + VYLYGDLA+YAAAVP S+  V C+   N S  + A    +++D CW    + R++AYRI+L  F LLL PFTFF++ KTK++Q  T  MRW
Sbjct:   70 FVTTTFVIEAMAAANAQLHWKRM------------ENLKEEEDDDSSTASDSDVLIRDN-----YERAEKRPILSVQRRGSPNPFEITDRVEMGQMASMFFNKVGVNLFYFCIIVYLYGDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCW--GPLRRVDAYRIYLAIFTLLLGPFTFFDVQKTKYLQILTSLMRW 255          
BLAST of Transmembrane protein 104 vs. Ensembl Human
Match: TMEM104 (transmembrane protein 104 [Source:HGNC Symbol;Acc:HGNC:25984])

HSP 1 Score: 71.633 bits (174), Expect = 2.239e-14
Identity = 36/77 (46.75%), Postives = 51/77 (66.23%), Query Frame = 1
Query:  562 FEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLCWPNSD 792
            FEI D  E+G MA ++FN++G+ LFY  + VYLYGDLA+YAAAVP S+  V C+   N S  +    E+D  + ++D
Sbjct:   56 FEITDRVEMGQMASMFFNKVGVNLFYFCIIVYLYGDLAIYAAAVPFSLMQVTCSATGNDSCGV----EADTKYNDTD 128          
BLAST of Transmembrane protein 104 vs. Ensembl Celegans
Match: C03A3.2 (Transmembrane protein 104 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q17598])

HSP 1 Score: 218.394 bits (555), Expect = 6.996e-64
Identity = 174/548 (31.75%), Postives = 275/548 (50.18%), Query Frame = 1
Query:  175 HSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNG-LQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLC---WPNSDISRLNAYRIFLTGFLLLLC-PFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVNIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNN---LRNLITCGTGRKFDNWFLE--------------------------HMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDI-TPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVN 1713
            +S+ VG +YVFNLIVGTGALALPKAFQ AGW+LS  +L+    +SY+  T+VIEA++++N  L K  +++Y    D   +AD                         P TF                    EI    E+  MA ++ +++ LV  Y ++ +YL+GDLA+Y+  VP S  ++ C   +N S++      SD C   WP   ++R+  YR F+  F++++C P     + KT+ IQ  T   RW AF +M +L T+ L+       P   NF    +L G  +Y+FM HHS+PSLITP++ K+ +F  I L + V+ +FY  LS+  AF F +++ + TLNF      N   +  I    Y+LALFP+ ++++S+PII +TL NN   +++++    G++ ++  LE                           +  P L +  P  +   T+++ +L   TGS+ G  +Q+ IP  LV  AR+           H  + L+   P +   PFQSP     W + I  WA  S+++V +N
Sbjct:   13 YSQTVGLLYVFNLIVGTGALALPKAFQTAGWLLSITLLTFSAFMSYVAATFVIEALSVANAVLSKKRRVEY----DDVVVADG------------------------PSTF--------------------EISKKVEVSEMASMFLSKVSLVFSYFAIIIYLFGDLAIYSTTVPKSAMNIVCA-TINASTV----KSSDPCHESWPEI-LTRMTVYRFFVIIFVVVVCLPMVIAGITKTRHIQIMTTLSRWAAFILMISLATMQLSSDGAAAHPPAYNFHGFGSLFGCAVYAFMCHHSIPSLITPMRTKDNVFGKIALVYGVVGVFYFTLSLTGAFAFEHVQDIYTLNF--FHDGNTSFIYSI--IDYFLALFPIITLTSSYPIIALTLINNFNVVKDILCPKVGQENES-LLEADSLVEDNDTDDEREARNARNEKSVFDVLVPALVLALPTFLSLLTDDMLLLASITGSFPGVAVQFAIPCLLVTAARK-----------HARSVLNFPVPRKNNSPFQSPI----WIVLISSWAGFSMIMVLLN 486          
BLAST of Transmembrane protein 104 vs. Ensembl Fly
Match: CG5262 (gene:FBgn0036988 transcript:FBtr0310615)

HSP 1 Score: 323.168 bits (827), Expect = 1.909e-103
Identity = 204/543 (37.57%), Postives = 306/543 (56.35%), Query Frame = 1
Query:  157 PKKVEG------HSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTED-DEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDL-------CWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVNIESLITLNFEPILTSNQKPVTKIAFF-------QYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNW-FLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVNHF 1719
            P+ V G      +S +VG I++FNLIVGTGAL LP  F  AGW+LS IV+ +L ++SY+T T++IEAMA +N ++    L+    + S   A+N ++D      +  +      D + +P+T            I +    Y+++   +ELG MA ++FN  G V+FYL + VYLYGDL++Y+AAV  S+RDV C     T +  L     D        CW    ISRLN YR+ L GF L+  PF +FN+ KTK++Q  T + RW AF +M  +    L        P   N    P+L G C+YSFM HHSLPSL+ PI++K+ +  ++ + + +I  FY+LL+M   F F  IE L TL+F P        V  + F+        Y+LALFP+F++S SFPI+ ITL+NNL++L       +++++  +  + +PLLAIIPP  + Y T +++ LV FTG+YAGT IQY+IP+ LV  ARR+                ++    +   F+SPF+  AW + + IW+ + + LV++N F
Sbjct:    2 PRLVNGREAAPTYSNLVGFIFIFNLIVGTGALTLPGVFARAGWMLSLIVIVLLAIISYMTVTFIIEAMACANAIRNWQTLQALRQSRSS--AENSENDDNADDVSLASGAEQVGDFERVPLT------------IQNREFHYYQLSHKFELGEMATLFFNEFGRVMFYLCLIVYLYGDLSIYSAAVARSLRDVVCDQTNGTDTNNLMYWPGDFENNTSLACWKEHTISRLNMYRVLLIGFTLIFGPFVYFNVQKTKYLQMLTAAFRWMAFTLMICISLKLLISRGAKGHPATFNVYGIPSLFGACVYSFMCHHSLPSLLAPIRHKSMVSKILSIDYIIICAFYILLAMTGIFAFERIEDLYTLDFLP------YDVAYVDFWSGLLICIDYFLALFPIFTLSTSFPIVAITLKNNLQSLFL--DMSQYESYSVILRLCFPLLAIIPPFCITYFTESLSSLVAFTGTYAGTGIQYIIPVFLVYFARRTCS--------------ELLGSGVVNRFKSPFKSSAWLVFVFIWSILCVCLVSINLF 508          
BLAST of Transmembrane protein 104 vs. Ensembl Fly
Match: CG5262 (gene:FBgn0036988 transcript:FBtr0078230)

HSP 1 Score: 323.168 bits (827), Expect = 1.909e-103
Identity = 204/543 (37.57%), Postives = 306/543 (56.35%), Query Frame = 1
Query:  157 PKKVEG------HSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTED-DEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDL-------CWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVNIESLITLNFEPILTSNQKPVTKIAFF-------QYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNW-FLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVNHF 1719
            P+ V G      +S +VG I++FNLIVGTGAL LP  F  AGW+LS IV+ +L ++SY+T T++IEAMA +N ++    L+    + S   A+N ++D      +  +      D + +P+T            I +    Y+++   +ELG MA ++FN  G V+FYL + VYLYGDL++Y+AAV  S+RDV C     T +  L     D        CW    ISRLN YR+ L GF L+  PF +FN+ KTK++Q  T + RW AF +M  +    L        P   N    P+L G C+YSFM HHSLPSL+ PI++K+ +  ++ + + +I  FY+LL+M   F F  IE L TL+F P        V  + F+        Y+LALFP+F++S SFPI+ ITL+NNL++L       +++++  +  + +PLLAIIPP  + Y T +++ LV FTG+YAGT IQY+IP+ LV  ARR+                ++    +   F+SPF+  AW + + IW+ + + LV++N F
Sbjct:    2 PRLVNGREAAPTYSNLVGFIFIFNLIVGTGALTLPGVFARAGWMLSLIVIVLLAIISYMTVTFIIEAMACANAIRNWQTLQALRQSRSS--AENSENDDNADDVSLASGAEQVGDFERVPLT------------IQNREFHYYQLSHKFELGEMATLFFNEFGRVMFYLCLIVYLYGDLSIYSAAVARSLRDVVCDQTNGTDTNNLMYWPGDFENNTSLACWKEHTISRLNMYRVLLIGFTLIFGPFVYFNVQKTKYLQMLTAAFRWMAFTLMICISLKLLISRGAKGHPATFNVYGIPSLFGACVYSFMCHHSLPSLLAPIRHKSMVSKILSIDYIIICAFYILLAMTGIFAFERIEDLYTLDFLP------YDVAYVDFWSGLLICIDYFLALFPIFTLSTSFPIVAITLKNNLQSLFL--DMSQYESYSVILRLCFPLLAIIPPFCITYFTESLSSLVAFTGTYAGTGIQYIIPVFLVYFARRTCS--------------ELLGSGVVNRFKSPFKSSAWLVFVFIWSILCVCLVSINLF 508          
BLAST of Transmembrane protein 104 vs. Ensembl Zebrafish
Match: tmem104 (transmembrane protein 104 [Source:ZFIN;Acc:ZDB-GENE-070822-4])

HSP 1 Score: 328.946 bits (842), Expect = 7.488e-106
Identity = 207/518 (39.96%), Postives = 306/518 (59.07%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEI-PITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVN--IESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVN 1713
            E +S  VG +Y+FNLIVGTGAL +PKAF  AGWV+S  +++ L  +S++TTT+VIEAMA +N   +  + +    NDS   +D  DD+            G +E  E  PI           S   +  I +F+I++  E+G MA ++FN++G+ +FY+ + VYLYGDLA+YAAAVP S+ +VAC    + S+  +  ++++ CW    + R +AYR+FL  F LLL PFTFFN  KTK++Q  T  MRW AF +M  L  I + +G+    P +A  S  PNL G+C+YSFM  HSLPSL+TPI NK ++  L+   + +IL FY LLS+ + F F +  +  + TLNF     ++   V  +   +Y+L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +PL+ ++PPI+V + T+++  LVG TG+YAGT IQY+IP  LV  +RR L+  + +                    +SPFRH  W   +++WA   ++ VT N
Sbjct:   10 EPYSPFVGLVYMFNLIVGTGALTMPKAFAAAGWVVSVSLITFLAFMSFMTTTFVIEAMAAANAQLRWKRREQEEVNDSDSSSDYSDDEVIIR--------GRSEPVETRPI----------LSVQRAANIDHFDIVERVEMGQMASMFFNKVGVNMFYICIIVYLYGDLAIYAAAVPVSLMEVACG-NHSCSAGSVKYNDTESCW--GPVRRKDAYRVFLAIFTLLLGPFTFFNAQKTKYLQILTSLMRWIAFTMMIILALIRIGKGHGEGKPSVAQISGVPNLFGVCVYSFMCQHSLPSLVTPISNKQRMSILVMADYILILCFYALLSLTAIFCFDSSLLRDMYTLNF-----TDNCDVLGVPVLRYFLGLFPVFTISTNFPIIAVTLRNNWKTLFHRDGGTY--PWVVDRVVFPLITLVPPIIVAFCTHDLESLVGITGAYAGTGIQYIIPAFLVYFSRRHLEPVLGR--------------DAVNKHRSPFRHTFWVCFVVLWATFCLMFVTAN 485          
BLAST of Transmembrane protein 104 vs. Ensembl Zebrafish
Match: tmem104 (transmembrane protein 104 [Source:ZFIN;Acc:ZDB-GENE-070822-4])

HSP 1 Score: 328.946 bits (842), Expect = 7.488e-106
Identity = 207/518 (39.96%), Postives = 306/518 (59.07%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEI-PITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVN--IESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVN 1713
            E +S  VG +Y+FNLIVGTGAL +PKAF  AGWV+S  +++ L  +S++TTT+VIEAMA +N   +  + +    NDS   +D  DD+            G +E  E  PI           S   +  I +F+I++  E+G MA ++FN++G+ +FY+ + VYLYGDLA+YAAAVP S+ +VAC    + S+  +  ++++ CW    + R +AYR+FL  F LLL PFTFFN  KTK++Q  T  MRW AF +M  L  I + +G+    P +A  S  PNL G+C+YSFM  HSLPSL+TPI NK ++  L+   + +IL FY LLS+ + F F +  +  + TLNF     ++   V  +   +Y+L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +PL+ ++PPI+V + T+++  LVG TG+YAGT IQY+IP  LV  +RR L+  + +                    +SPFRH  W   +++WA   ++ VT N
Sbjct:   10 EPYSPFVGLVYMFNLIVGTGALTMPKAFAAAGWVVSVSLITFLAFMSFMTTTFVIEAMAAANAQLRWKRREQEEVNDSDSSSDYSDDEVIIR--------GRSEPVETRPI----------LSVQRAANIDHFDIVERVEMGQMASMFFNKVGVNMFYICIIVYLYGDLAIYAAAVPVSLMEVACG-NHSCSAGSVKYNDTESCW--GPVRRKDAYRVFLAIFTLLLGPFTFFNAQKTKYLQILTSLMRWIAFTMMIILALIRIGKGHGEGKPSVAQISGVPNLFGVCVYSFMCQHSLPSLVTPISNKQRMSILVMADYILILCFYALLSLTAIFCFDSSLLRDMYTLNF-----TDNCDVLGVPVLRYFLGLFPVFTISTNFPIIAVTLRNNWKTLFHRDGGTY--PWVVDRVVFPLITLVPPIIVAFCTHDLESLVGITGAYAGTGIQYIIPAFLVYFSRRHLEPVLGR--------------DAVNKHRSPFRHTFWVCFVVLWATFCLMFVTAN 485          
BLAST of Transmembrane protein 104 vs. Ensembl Zebrafish
Match: tmem104 (transmembrane protein 104 [Source:ZFIN;Acc:ZDB-GENE-070822-4])

HSP 1 Score: 267.7 bits (683), Expect = 7.073e-84
Identity = 156/378 (41.27%), Postives = 232/378 (61.38%), Query Frame = 1
Query:  586 LGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVN--IESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVN 1713
            +G MA ++FN++G+ +FY+ + VYLYGDLA+YAAAVP S+ +VAC    + S+  +  ++++ CW    + R +AYR+FL  F LLL PFTFFN  KTK++Q  T  MRW AF +M  L  I + +G+    P +A  S  PNL G+C+YSFM  HSLPSL+TPI NK ++  L+   + +IL FY LLS+ + F F +  +  + TLNF     ++   V  +   +Y+L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +PL+ ++PPI+V + T+++  LVG TG+YAGT IQY+IP  LV  +RR L+  + +  +    H            +SPFRH  W   +++WA   ++ VT N
Sbjct:    1 MGQMASMFFNKVGVNMFYICIIVYLYGDLAIYAAAVPVSLMEVACG-NHSCSAGSVKYNDTESCW--GPVRRKDAYRVFLAIFTLLLGPFTFFNAQKTKYLQILTSLMRWIAFTMMIILALIRIGKGHGEGKPSVAQISGVPNLFGVCVYSFMCQHSLPSLVTPISNKQRMSILVMADYILILCFYALLSLTAIFCFDSSLLRDMYTLNF-----TDNCDVLGVPVLRYFLGLFPVFTISTNFPIIAVTLRNNWKTLFHRDGGTY--PWVVDRVVFPLITLVPPIIVAFCTHDLESLVGITGAYAGTGIQYIIPAFLVYFSRRHLEPVLGR--DAVNKH------------RSPFRHTFWVCFVVLWATFCLMFVTAN 354          
BLAST of Transmembrane protein 104 vs. Ensembl Zebrafish
Match: tmem104 (transmembrane protein 104 [Source:ZFIN;Acc:ZDB-GENE-070822-4])

HSP 1 Score: 134.035 bits (336), Expect = 1.564e-35
Identity = 88/224 (39.29%), Postives = 134/224 (59.82%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEI-PITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLCWPNSDISRLNAYRIFLTGFL 837
            E +S  VG +Y+FNLIVGTGAL +PKAF  AGWV+S  +++ L  +S++TTT+VIEAMA +N   +  + +    NDS   +D  DD+            G +E  E  PI           S   +  I +F+I++  E+G MA ++FN++G+ +FY+ + VYLYGDLA+YAAAVP S+ +VAC    + S+  +  ++++ CW    + R +AYR+FL   L
Sbjct:   10 EPYSPFVGLVYMFNLIVGTGALTMPKAFAAAGWVVSVSLITFLAFMSFMTTTFVIEAMAAANAQLRWKRREQEEVNDSDSSSDYSDDEVIIR--------GRSEPVETRPI----------LSVQRAANIDHFDIVERVEMGQMASMFFNKVGVNMFYICIIVYLYGDLAIYAAAVPVSLMEVACG-NHSCSAGSVKYNDTESCW--GPVRRKDAYRVFLGAEL 212          
BLAST of Transmembrane protein 104 vs. Ensembl Xenopus
Match: tmem104 (transmembrane protein 104 [Source:NCBI gene;Acc:548779])

HSP 1 Score: 311.227 bits (796), Expect = 8.546e-99
Identity = 209/519 (40.27%), Postives = 288/519 (55.49%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILA--LSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVN--IESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVN 1713
            E +S  VG +Y+FNLIVGTGAL +PKAF +AGW++S I++  L  +SY+TTT+V+EAMA +N   +  + +     DS   +D+    A+          G    +  PI           S         FEI++  E+G MA ++FN+ G+ LFY+ + VYLYGDLA+YA AVP S+  V C F  N S    A   +++D CW    I R++AYRI+L  F LLL PFTFFN+ KTK++Q  T  MRW AF IM  L  + + +G     P LA  S   NL G+C+YSFM  HSLPSL+TP+  K  L  L+ L ++++L FY LL   + F F +  +  + TLNF     S   P        Y+L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +PL+ ++PP++V + TN++ +LV  TGSYAG  IQYVIP  LV C+R+              N L   P  L     SPFR   W   +L WA    + VT N
Sbjct:   10 ELYSPFVGLVYMFNLIVGTGALTMPKAFANAGWLVSLILIIFLAFMSYMTTTFVVEAMAAANAQLRWKRWEKEEDPDSSESSDSEVPSAS----------GYNRSEIQPI----------LSVQRRGLSDPFEIVERVEMGQMASLFFNKAGVNLFYICIIVYLYGDLAIYATAVPLSLVQVTC-FSANGSCSAQAGERNDTDPCW--GPIRRIDAYRIYLAVFTLLLGPFTFFNVQKTKYLQILTSLMRWVAFIIMIVLALVRIGKGEGAGHPPLAQVSGIRNLFGVCVYSFMCQHSLPSLVTPVSKKKHLTGLVLLDYALVLAFYSLLCFTAIFCFSSGALMDMYTLNF-----SGCSPFVP-QVIGYFLGLFPVFTISTNFPIIAVTLRNNWKTLFHRDGGTY--PWLVDRIVFPLITLVPPVIVAFCTNHLEVLVSITGSYAGNGIQYVIPAFLVFCSRKD-------------NALVYGP-GLTNKHSSPFRQVGWVWFVLCWALTCFIYVTAN 483          
BLAST of Transmembrane protein 104 vs. Ensembl Mouse
Match: Tmem104 (transmembrane protein 104 [Source:MGI Symbol;Acc:MGI:2444222])

HSP 1 Score: 295.819 bits (756), Expect = 6.559e-93
Identity = 202/518 (39.00%), Postives = 289/518 (55.79%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSII---LALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFV--NIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVT 1707
            E +S  VG +Y+FNLIVGTGAL +PKAF  AGW++S ++L  +  +S++TTT+ +EAMA +N   +  +++     D     D     A+ +      NY   E   I             S       + FEI D  E+G MA ++FN++G+ LFY  +  YLYGDLA+YAAAVP S+  V C+   N S  +      +++DLCW    + R++ YRI+L  F +LL PFTFF++ KTK++Q  T  MRW AF IM  L  + + +G     P LANF    NL G+C+YSFM  HSLPSLITPI +K  +  L+FL +++IL FY LLS  + F F   ++  + TLNF       +  V  +A  +++L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +P + ++PPI+V + T+++  LV  TG+YAGT IQYVIP  LV   R+   +    F     N             +SPFRH  W   +L+WA      VT
Sbjct:   10 ELYSPYVGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLVFVGFMSFVTTTFAMEAMAAANAQLRWKRMETHKEED-----DEDSSTASDSDLLSQDNYERAEKRPI------------LSVQRRSSANLFEITDRVEMGQMASMFFNKVGVNLFYFCIITYLYGDLAIYAAAVPVSLMQVTCSVSGNDSCGVDTDARYNDTDLCW--GPLRRVDVYRIYLAIFTVLLGPFTFFDVQKTKYLQILTSMMRWIAFAIMIVLALVRIGKGQGEGHPPLANFLGVQNLFGVCVYSFMCQHSLPSLITPISSKRHITRLLFLDYALILAFYGLLSFTAIFCFRGDSLMDMYTLNFA------RCDVVGLAAVRFFLGLFPVFTISTNFPIIAVTLRNNWKTLFHREGGTY--PWVVDRVVFPTITLVPPILVAFCTHDLESLVAITGAYAGTGIQYVIPAFLVYLCRKDTQL---TFGYGTVNK-----------HRSPFRHTFWVAFVLLWAFSCFFFVT 486          
BLAST of Transmembrane protein 104 vs. Ensembl Mouse
Match: Tmem104 (transmembrane protein 104 [Source:MGI Symbol;Acc:MGI:2444222])

HSP 1 Score: 292.352 bits (747), Expect = 1.270e-91
Identity = 200/517 (38.68%), Postives = 288/517 (55.71%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSII--LALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFV--NIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVT 1707
            E +S  VG +Y+FNLIVGTGAL +PKAF  AGW++S ++L  +  +S++TTT+ +EAMA +N   +  +++     D     D     A+ +      NY   E   I             S       + FEI D  E+G MA ++FN++G+ LFY  +  YLYGDLA+YAAAVP S+  V C    ++  +      +++DLCW    + R++ YRI+L  F +LL PFTFF++ KTK++Q  T  MRW AF IM  L  + + +G     P LANF    NL G+C+YSFM  HSLPSLITPI +K  +  L+FL +++IL FY LLS  + F F   ++  + TLNF       +  V  +A  +++L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +P + ++PPI+V + T+++  LV  TG+YAGT IQYVIP  LV   R+   +    F     N             +SPFRH  W   +L+WA      VT
Sbjct:   10 ELYSPYVGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLVFVGFMSFVTTTFAMEAMAAANAQLRWKRMETHKEED-----DEDSSTASDSDLLSQDNYERAEKRPI------------LSVQRRSSANLFEITDRVEMGQMASMFFNKVGVNLFYFCIITYLYGDLAIYAAAVPVSLMQVTCVSGNDSCGVDTDARYNDTDLCW--GPLRRVDVYRIYLAIFTVLLGPFTFFDVQKTKYLQILTSMMRWIAFAIMIVLALVRIGKGQGEGHPPLANFLGVQNLFGVCVYSFMCQHSLPSLITPISSKRHITRLLFLDYALILAFYGLLSFTAIFCFRGDSLMDMYTLNFA------RCDVVGLAAVRFFLGLFPVFTISTNFPIIAVTLRNNWKTLFHREGGTY--PWVVDRVVFPTITLVPPILVAFCTHDLESLVAITGAYAGTGIQYVIPAFLVYLCRKDTQL---TFGYGTVNK-----------HRSPFRHTFWVAFVLLWAFSCFFFVT 485          
BLAST of Transmembrane protein 104 vs. UniProt/SwissProt
Match: sp|Q9VPF8|TM104_DROME (Transmembrane protein 104 homolog OS=Drosophila melanogaster OX=7227 GN=CG5262 PE=2 SV=2)

HSP 1 Score: 323.168 bits (827), Expect = 1.914e-102
Identity = 204/543 (37.57%), Postives = 306/543 (56.35%), Query Frame = 1
Query:  157 PKKVEG------HSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTED-DEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDL-------CWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVNIESLITLNFEPILTSNQKPVTKIAFF-------QYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNW-FLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVNHF 1719
            P+ V G      +S +VG I++FNLIVGTGAL LP  F  AGW+LS IV+ +L ++SY+T T++IEAMA +N ++    L+    + S   A+N ++D      +  +      D + +P+T            I +    Y+++   +ELG MA ++FN  G V+FYL + VYLYGDL++Y+AAV  S+RDV C     T +  L     D        CW    ISRLN YR+ L GF L+  PF +FN+ KTK++Q  T + RW AF +M  +    L        P   N    P+L G C+YSFM HHSLPSL+ PI++K+ +  ++ + + +I  FY+LL+M   F F  IE L TL+F P        V  + F+        Y+LALFP+F++S SFPI+ ITL+NNL++L       +++++  +  + +PLLAIIPP  + Y T +++ LV FTG+YAGT IQY+IP+ LV  ARR+                ++    +   F+SPF+  AW + + IW+ + + LV++N F
Sbjct:    2 PRLVNGREAAPTYSNLVGFIFIFNLIVGTGALTLPGVFARAGWMLSLIVIVLLAIISYMTVTFIIEAMACANAIRNWQTLQALRQSRSS--AENSENDDNADDVSLASGAEQVGDFERVPLT------------IQNREFHYYQLSHKFELGEMATLFFNEFGRVMFYLCLIVYLYGDLSIYSAAVARSLRDVVCDQTNGTDTNNLMYWPGDFENNTSLACWKEHTISRLNMYRVLLIGFTLIFGPFVYFNVQKTKYLQMLTAAFRWMAFTLMICISLKLLISRGAKGHPATFNVYGIPSLFGACVYSFMCHHSLPSLLAPIRHKSMVSKILSIDYIIICAFYILLAMTGIFAFERIEDLYTLDFLP------YDVAYVDFWSGLLICIDYFLALFPIFTLSTSFPIVAITLKNNLQSLFL--DMSQYESYSVILRLCFPLLAIIPPFCITYFTESLSSLVAFTGTYAGTGIQYIIPVFLVYFARRTCS--------------ELLGSGVVNRFKSPFKSSAWLVFVFIWSILCVCLVSINLF 508          
BLAST of Transmembrane protein 104 vs. UniProt/SwissProt
Match: sp|Q5F3I6|TM104_CHICK (Transmembrane protein 104 OS=Gallus gallus OX=9031 GN=TMEM104 PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 2.048e-99
Identity = 200/520 (38.46%), Postives = 292/520 (56.15%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSII--LALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVN--IESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGN-HLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVN 1713
            E +S  VG +Y+FNLIVGTGAL +PKAF  AGW++S ++L  L  +SY+TTT+V+EAMA +N   +  +++           ++     + +      +Y   E   I             S       + FEI +  E+G MA ++FN++G+ LFY  + +YLYGDLA+YAAAVP S+  V C    ++ ++      +++D CW    I R++AYR++L  F LLL PFTFFN+ KTK++Q  T  MRW AF +M  L  I +++G     P +A  S   NL G+C+YSFM  HSLPSLITPI  K  +  L+ L + +IL FY LLS  + + F N  +  + TLNF          +  +AF +Y+L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +P + ++PP++VV+ T+++  LVG TG+YAG  IQY+IP  L  C+R+   +    F     N HL            SPFRH  W + +LIW     + VT N
Sbjct:   10 ELYSPYVGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLMFLGFMSYMTTTFVVEAMAAANAQLRWKRME---KRKEDDEDEDSSSGVSDSDVLLRDSYERAETRPI------------LSVQRRGSPNIFEITERVEMGQMASMFFNKVGVNLFYFCIIIYLYGDLAIYAAAVPVSLMQVTCAIGNHSCNVGDGTKYNDTDKCW--GPIRRIDAYRLYLAAFTLLLGPFTFFNVQKTKYLQIMTSLMRWIAFILMIILALIRISRGQAEGHPSMAQLSGIRNLFGVCVYSFMCQHSLPSLITPISKKRHVNKLVLLDYILILAFYSLLSFTAIYCFRNDTLMDMYTLNF------TNCEIINVAFIRYFLGLFPVFTISTNFPIIAVTLRNNWKTLFHREGGTY--PWLVDRIVFPAITLVPPVLVVFCTHDLESLVGITGAYAGNGIQYLIPAFLAYCSRKDTQLV---FGSGTVNKHL------------SPFRHTFWIVFVLIWGFSCFVFVTAN 489          
BLAST of Transmembrane protein 104 vs. UniProt/SwissProt
Match: sp|Q5RCV1|TM104_PONAB (Transmembrane protein 104 OS=Pongo abelii OX=9601 GN=TMEM104 PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.088e-98
Identity = 205/520 (39.42%), Postives = 299/520 (57.50%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILA---LSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFV--NIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVN 1713
            E +S  VG +Y+FNLIVGTGAL +PKAF  AGW++S ++L  L  +S++TTT+VIEAMA +N   +  ++            +NL ++      T + +  +  D+     + ++ +    S       + FEI D  E+G MA ++FN++G+ LFY  + VYLYGDLA+YAAAVP S+  V C+   N S  + A    +++D CW    + R++AYRI+L  F LLL PFTFF++ KTK++Q  T  MRW AF +M  L  + +        P LA+FS   NL G+C+YSFM  HSLPSLITP+ +K  L  L+FL + +IL FY LLS  + F F   ++  + TLNF       +  +  +A  +++L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +P + ++PP++V + T+++  LVG TG+YAGT IQYVIP  LV   RR   +    F    GN             +SPFRH  W   +L+WA    + VT N
Sbjct:   10 ELYSSYVGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLVFLGFMSFVTTTFVIEAMAAANAQLRWKRM------------ENLKEEEDDDSSTASDSDVLIRDN-----YERAEKRPILSVQRRGSPNPFEITDRVEMGQMASMFFNKVGVNLFYFCIIVYLYGDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCW--GPLRRVDAYRIYLAIFTLLLGPFTFFDVQKTKYLQILTSLMRWIAFAVMIVLALVRIGHRQGEGHPPLADFSGVRNLFGVCVYSFMCQHSLPSLITPVSSKRHLTRLVFLDYVLILAFYGLLSFTAIFCFRGDSLMDMYTLNFA------RCDIVGLAAVRFFLGLFPVFTISTNFPIIAVTLRNNWKTLFHREGGTY--PWVVDRVVFPTITLVPPVLVAFCTHDLESLVGITGAYAGTGIQYVIPAFLVYHCRRDTQL---AFGCGVGNK-----------HRSPFRHTFWVGFVLLWAFSCFIFVTAN 488          
BLAST of Transmembrane protein 104 vs. UniProt/SwissProt
Match: sp|Q8NE00|TM104_HUMAN (Transmembrane protein 104 OS=Homo sapiens OX=9606 GN=TMEM104 PE=1 SV=2)

HSP 1 Score: 312.383 bits (799), Expect = 1.516e-98
Identity = 207/520 (39.81%), Postives = 298/520 (57.31%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILA---LSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFV--NIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVN 1713
            E +S  VG +Y+FNLIVGTGAL +PKAF  AGW++S ++L  L  +S++TTT+VIEAMA +N      ++            +NL ++      T + +  +  D+     + ++ +    S       + FEI D  E+G MA ++FN++G+ LFY  + VYLYGDLA+YAAAVP S+  V C+   N S  + A    +++D CW    + R++AYRI+L  F LLL PFTFF++ KTK++Q  T  MRW AF +M  L  I +  G     P LA+FS   NL G+C+YSFM  HSLPSLITP+ +K  L  L+FL + +IL FY LLS  + F F   ++  + TLNF       +  V  +A  +++L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +P + ++PP++V + T+++  LVG TG+YAGT IQYVIP  LV   RR   +    F     N             +SPFRH  W   +L+WA    + VT N
Sbjct:   10 ELYSSYVGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLVFLGFMSFVTTTFVIEAMAAANAQLHWKRM------------ENLKEEEDDDSSTASDSDVLIRDN-----YERAEKRPILSVQRRGSPNPFEITDRVEMGQMASMFFNKVGVNLFYFCIIVYLYGDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCW--GPLRRVDAYRIYLAIFTLLLGPFTFFDVQKTKYLQILTSLMRWIAFAVMIVLALIRIGHGQGEGHPPLADFSGVRNLFGVCVYSFMCQHSLPSLITPVSSKRHLTRLVFLDYVLILAFYGLLSFTAIFCFRGDSLMDMYTLNFA------RCDVVGLAAVRFFLGLFPVFTISTNFPIIAVTLRNNWKTLFHREGGTY--PWVVDRVVFPTITLVPPVLVAFCTHDLESLVGITGAYAGTGIQYVIPAFLVYHCRRDTQL---AFGCGVSNK-----------HRSPFRHTFWVGFVLLWAFSCFIFVTAN 488          
BLAST of Transmembrane protein 104 vs. UniProt/SwissProt
Match: sp|Q3TB48|TM104_MOUSE (Transmembrane protein 104 OS=Mus musculus OX=10090 GN=Tmem104 PE=1 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 4.588e-92
Identity = 202/518 (39.00%), Postives = 289/518 (55.79%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSII---LALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFV--NIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVT 1707
            E +S  VG +Y+FNLIVGTGAL +PKAF  AGW++S ++L  +  +S++TTT+ +EAMA +N   +  +++     D     D     A+ +      NY   E   I             S       + FEI D  E+G MA ++FN++G+ LFY  +  YLYGDLA+YAAAVP S+  V C+   N S  +      +++DLCW    + R++ YRI+L  F +LL PFTFF++ KTK++Q  T  MRW AF IM  L  + + +G     P LANF    NL G+C+YSFM  HSLPSLITPI +K  +  L+FL +++IL FY LLS  + F F   ++  + TLNF       +  V  +A  +++L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +P + ++PPI+V + T+++  LV  TG+YAGT IQYVIP  LV   R+   +    F     N             +SPFRH  W   +L+WA      VT
Sbjct:   10 ELYSPYVGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLVFVGFMSFVTTTFAMEAMAAANAQLRWKRMETHKEED-----DEDSSTASDSDLLSQDNYERAEKRPI------------LSVQRRSSANLFEITDRVEMGQMASMFFNKVGVNLFYFCIITYLYGDLAIYAAAVPVSLMQVTCSVSGNDSCGVDTDARYNDTDLCW--GPLRRVDVYRIYLAIFTVLLGPFTFFDVQKTKYLQILTSMMRWIAFAIMIVLALVRIGKGQGEGHPPLANFLGVQNLFGVCVYSFMCQHSLPSLITPISSKRHITRLLFLDYALILAFYGLLSFTAIFCFRGDSLMDMYTLNFA------RCDVVGLAAVRFFLGLFPVFTISTNFPIIAVTLRNNWKTLFHREGGTY--PWVVDRVVFPTITLVPPILVAFCTHDLESLVAITGAYAGTGIQYVIPAFLVYLCRKDTQL---TFGYGTVNK-----------HRSPFRHTFWVAFVLLWAFSCFFFVT 486          
BLAST of Transmembrane protein 104 vs. TrEMBL
Match: A0A2C9K2S8 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106079008 PE=4 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 2.827e-131
Identity = 242/517 (46.81%), Postives = 328/517 (63.44%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLCWPNS-DISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVNIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVNH 1716
             G+SR+VG +YVFNLIVGTGAL +P AF++AGW+LS I++ +L  +SY+T T++IEAMAISN   +   +  + +     +  +L+ D T+ L      Y  +E                           FEI +  E+G MA +YFN++GL+LF+L + +YLYGDLA+YAAAVP ++RDVACTF+LN +S    L++SD CWP+S +ISR++AYRIF+  F+LLL PFTFFN+ KTK++Q  T   RW AF +M  L +I+LAQG    TP +A  +  PNL G+C+YSFM HHSLPSL+TPIKNK  +  ++   ++VIL+FYL+L+  + F   +IE L TLNF+P    +   +T I   QY+LALFPVF+IS SFPII ITLRNNL  +IT   G    + ++  +  PLLAIIPP++V   TN +  LVGFTGSYAG  IQYVIP  LV  AR+  DI         G +L           QSPF HK+W I  +IWA + +  VT N+
Sbjct:   20 NGYSRLVGFVYVFNLIVGTGALTMPAAFREAGWLLSLIIVIVLAFMSYLTLTFMIEAMAISNAKIRFYDIVSSTSGKRNSLDTSLNTDETQPLIP-KPKYSYSEVKP-----------------------SFEITERVEMGTMASMYFNKVGLLLFHLCIIIYLYGDLAIYAAAVPKTLRDVACTFELNYTS--QNLTDSDPCWPSSPNISRMDAYRIFVACFILLLGPFTFFNVQKTKYLQIMTSLARWIAFLMMIILASIWLAQGKGQSTPAVARIAGVPNLFGVCVYSFMCHHSLPSLVTPIKNKRHIMPVLAGDYAVILVFYLILNFTAIFALEDIEDLYTLNFKP---RSSTSLTDIVPIQYFLALFPVFTISTSFPIITITLRNNLIAMITSYFGAV--HGYVSKIICPLLAIIPPLIVSMTTNQLQYLVGFTGSYAGAGIQYVIPAFLVYLARK--DIL-----AIGGGYLH----------QSPFSHKSWVIITVIWALICVAFVTTNY 488          
BLAST of Transmembrane protein 104 vs. TrEMBL
Match: A0A293M0J7 (Uncharacterized protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 397.127 bits (1019), Expect = 2.933e-128
Identity = 236/544 (43.38%), Postives = 322/544 (59.19%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGL---QKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNT-NYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDL----CWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVNIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLI-------TCGTGRKFDN--------WFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCAR----RSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVNHF 1719
            + +S +VG +Y+FNLIVGTGAL +P AF+DAGW LS  ++ +L L+SY+TTT+VIEAMA +N L   + L   K     +   IA+   +     L T +     +  D+ +P+       +  ES   S  + YF I + +ELG MA +YF++LG+ +FY+ + +YLYGDLA+YAAAV  S+RDV CT     S+     S SD+    CWP +DISR NAYRI++  FL LL PFTFFN+ KTK++Q  T  MRW AF  M  L TI L+ G     P +A+ +  PNL G+C+Y+FM HHSLPSL+TP+++K  LF L+   + +IL FY LLS    FTF  +  + TLNF+P        V  I F QY+L+LFPVF++S SFPII ITLRNNL++L           +    +N          LE   +PLLAI+PPI+V + T N+  LVG TGSYAG  IQY++P+ LV CAR     +L + ++  H                   SPFRH AW + +L+WA   +  VTVNHF
Sbjct:   20 DSYSPLVGLVYIFNLIVGTGALTMPAAFKDAGWALSLAIVILLALMSYLTTTFVIEAMASTNALVHGKTLKHYKRVVGEEEGHIAEGRKESVANELRTDDIIARSVDVDERVPL----LISNAAESMEESSHVDYFAIKERFELGKMASLYFSKLGMNMFYICIAIYLYGDLAIYAAAVSKSLRDVTCTAGTTISNTSNG-STSDVGDFHCWPGADISRSNAYRIYVLAFLCLLGPFTFFNMQKTKYLQLFTTLMRWIAFATMIILCTIALSGGKGRGQPPVADPAGLPNLFGVCVYAFMCHHSLPSLVTPMQSKRHLFALVGADYLLILGFYTLLSFTGIFTFPRLHDMYTLNFQPADNPMGSIVPAIPFLQYFLSLFPVFTLSTSFPIIAITLRNNLKSLFLREERPSALASSSGNNNTPSSPVLYKILERFVFPLLAILPPIIVAFATENVEFLVGITGSYAGAVIQYIVPVALVYCARNQVFEALGLGVQNQH------------------ASPFRHGAWLVFVLLWAVTCVTFVTVNHF 540          
BLAST of Transmembrane protein 104 vs. TrEMBL
Match: A0A1Z5KX13 (Uncharacterized protein (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 396.741 bits (1018), Expect = 2.971e-128
Identity = 234/552 (42.39%), Postives = 314/552 (56.88%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGL----------------QKLSKLKYTFTND---SPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSE--SDL-CWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVNIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLI---------TCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCAR----RSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVNHF 1719
            + +S +VG +Y+FNLIVGTGAL +P AF+DAGW LS  ++ +L L+SY+TTT+VIEAMA +N L                +   K K    N+      IA ++D D    L   N    M E   +                      YF I + +ELG MA +YFN+LG+ LFY+ + +YLYGDLA+YAAAV  S+RDV CT  +  ++     SE   DL CWP ++I+R NAYRI++  FL LL PFTFFN+ KTK++Q  T  MRW AF  M  L TI L+ G     P +   +  PNL G+C+Y+FM HHSLPSL+TP+++K  LF L+   + +IL FY LL+    FTF  +  + TLNF+P        V  I F QY+L+LFPVF++S SFPII ITLRNNL+ L          T        +  LE   +PLLAI+PPI++ + T N+  LVG TGSYAG FIQY++P+ LV CAR     +L + ++  H                   SPFRH AW + +L+WA   +  VTVNHF
Sbjct:   18 DSYSPLVGLVYIFNLIVGTGALTMPAAFKDAGWALSLAIVILLALMSYLTTTFVIEAMASTNALVHGKTLKHYKRVVGEEEAHEKRKEHIANELRTDDIIARSVDVDERVPLLISNAAESMEESSHV---------------------DYFAIKERFELGKMASLYFNKLGMNLFYICIAIYLYGDLAIYAAAVSKSMRDVTCTASMTIANSTNGSSEDVGDLHCWPGAEITRTNAYRIYVLAFLCLLGPFTFFNMQKTKYLQLFTSLMRWIAFSTMIVLCTIALSGGKGQGRPPVTEPAGLPNLFGVCVYAFMCHHSLPSLVTPMRSKRHLFVLVGADYLLILGFYTLLAFTGIFTFPRLYDMYTLNFQPTSDPMGTIVPAIPFLQYFLSLFPVFTLSTSFPIIAITLRNNLKALFLREERPSSATPSASPGVLHKVLERFVFPLLAILPPILIAFATENVEFLVGITGSYAGAFIQYIVPVALVYCARNQVFEALGLGVRNQH------------------ASPFRHGAWLVFVLLWAVTCVTFVTVNHF 530          
BLAST of Transmembrane protein 104 vs. TrEMBL
Match: A0A1E1X4U2 (Putative amino acid transporter OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 1.362e-123
Identity = 245/559 (43.83%), Postives = 325/559 (58.14%), Query Frame = 1
Query:  178 SRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGL---QKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNT-NYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKL----------NTSSIILALSESDL-CWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVNIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNL--------------------------ITCGTGRKFDNWFL-EHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARR----SLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVNH 1716
            S +VG +Y+FNLIVGTGAL +P AF+DAGW+LS I++ +L  +SY+TTT+VIEAMA +N L   + L   K     +   I     +D    L T +  +  + E++ +P+  S + E   ESS  +    YF I + +ELG MA ++F++LG+ LFY+ + VYLYGDLA+Y AAV  SIRDVAC   L          N SS+ L    SD+ CW +S ISR +AYRIFL GFL L+ PFTFFN+ KTK++Q  T  MRW AF  M  L  + L QG     P +A  +  P+L G+C+YSFM HHSLPSL+TP + K  LF L+   F +IL FY LLS    FTF  +  + TLNF+P   +    +  I   QY+L+LFPVF++S +FPII ITLRNNLR+L                          I  GT  +  N  L E  F+PLLA++PPI V   T ++  LVGFTGSYAG FIQY+IP+ LV  AR+    +L + +K  H                   SPFRH AW + +L+WA   + LVTVNH
Sbjct:   13 SPLVGLVYIFNLIVGTGALTMPAAFKDAGWLLSLIIVIVLAFMSYLTTTFVIEAMASANALVHWKTLQHYKRVVDEEESTITRAKQEDMVNELKTDDIISKCVDEEERVPLLLSSAAERMAESSHVN----YFAITERFELGKMASLFFSKLGVNLFYICIAVYLYGDLAIYGAAVAKSIRDVACQVPLTPIYNSTVPANGSSVTL---PSDMPCWQSSTISRGSAYRIFLLGFLCLVGPFTFFNVQKTKYLQIFTTLMRWIAFLSMIVLCALALGQGKGQGHPAMAVPTGLPSLFGVCVYSFMCHHSLPSLVTPWREKRHLFPLLAGDFLIILGFYTLLSFTGIFTFPELHDMYTLNFQPNSGTGSSIIPHIPVMQYFLSLFPVFTLSTNFPIIAITLRNNLRSLFLREEPASSTQQGSRTRSLTSSGVSSIQNGTPSQSCNQVLIERFFFPLLALLPPIAVALATESVEFLVGFTGSYAGAFIQYIIPVALVHRARKQVLEALGLGVKNQHA------------------SPFRHGAWLVFVLVWAVACVTLVTVNH 546          
BLAST of Transmembrane protein 104 vs. TrEMBL
Match: A0A210QQB1 (Transmembrane protein 104 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT00791 PE=4 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 5.777e-123
Identity = 226/525 (43.05%), Postives = 305/525 (58.10%), Query Frame = 1
Query:  172 GHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTN------DSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKL----NTSSIILALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVNIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVNH 1716
            G+SR++G IY+FNLIVGTGAL +P AF  AGW+LS I++  L ++S +T ++V EAM  +N     +KL+Y          +   + D  D D ++ L       G  +    P                       ++ +  ELG MA ++FN+ GL+ FYL M +YLYGDLA+YAAAVP S+RDV CT+KL       +  L L++SD CW   DI R  AYRI LT F +   PF FFN+ KTK++Q  T  MRW +FG M  L  I L++G     P+ A+FS  PNL G+C+YSFM HHSLPSL+TPI NK  LF LI L F +IL FY L+S    F F  +  L TLNF P    + +P+T +A  QY+LALFPVF++S +FPII ITLRNNL+ +   G    F  W ++ + +PL AIIPP ++ + T+ +  LVG TGSYAG  IQYVIP  LV  AR+                ++     L  P+ SPF+H+AW      WA V +++V+VNH
Sbjct:   11 GYSRLIGLIYIFNLIVGTGALTMPSAFASAGWLLSLIIVIALAIVSNMTVSFVTEAMGWAN-----AKLRYDAGQAHMPPVNVSRVVDGEDADESRPLL----QNGTCDHSTNPC----------------------DMTERTELGQMAKMFFNKWGLLAFYLCMVLYLYGDLAIYAAAVPVSLRDVICTYKLPNVTEACNHSLKLTDSDNCWEGRDIDRGQAYRICLTIFFVTGGPFVFFNIQKTKYLQLFTTVMRWLSFGTMVVLAVIRLSKGQGQGHPEAADFSGIPNLFGVCVYSFMCHHSLPSLVTPINNKKGLFRLIGLDFLLILGFYALISFTGIFAFNKLNDLYTLNFLPDPCDSSEPITNVAVIQYFLALFPVFTLSTNFPIISITLRNNLKTMFYKGDSNPFP-WVVDRIVFPLGAIIPPFIIAFCTSQVEFLVGVTGSYAGAGIQYVIPAALVYFARKD---------------MNRRAPNLQNPYTSPFKHRAWVWFAYTWATVCMVIVSVNH 488          
BLAST of Transmembrane protein 104 vs. Ensembl Cavefish
Match: tmem104 (transmembrane protein 104 [Source:NCBI gene;Acc:103032642])

HSP 1 Score: 330.102 bits (845), Expect = 2.686e-106
Identity = 207/518 (39.96%), Postives = 307/518 (59.27%), Query Frame = 1
Query:  169 EGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEI-PITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVN--IESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVN 1713
            E +S  VG +Y+FNLIVGTGAL +PKAF  AGWV+S  ++S L  +SY+TTT+VIEAMA +N   +  + +    +++   ++  DD+ T          G +E  E  PI           S   S    +F+I++  E+G MA ++FN++G+ +FY+ + VYLYGDLA+YAAAVP S+ +VAC    + S+  +  +++D CW    I R ++YR+FL  F LLL PF FFN  KTK++Q  T  MRW AF +M  L  I + +G+    PK A  +  PNL G+C+YSFM  HSLPSL+TPI +K ++  L+   + +IL FY LLS  + F F +  +  + TLNF     ++   V  +A  +Y+L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +PL+ ++PPI+V + T+++  LVG TG+YAGT IQY+IP  LV  +RR L+    +  E+                +SPFRH  W + +++WA   ++ VT N
Sbjct:   10 EPYSPFVGLVYMFNLIVGTGALTMPKAFAAAGWVVSLALISFLAFMSYMTTTFVIEAMAAANAQLRWKRREQEEVSNTDSSSEYSDDEVTIR--------GRSESVETRPI----------LSVQRSASADHFDIVERVEMGQMASMFFNKVGVNMFYICIIVYLYGDLAIYAAAVPMSLMEVACG-NHSCSAGSMKYNDTDPCW--GSIKRKDSYRVFLAIFTLLLGPFVFFNAQKTKYLQILTSLMRWIAFTMMIILALIRIGKGHGEGHPKAAQLTGVPNLFGVCVYSFMCQHSLPSLVTPISDKRRVGALVLADYVLILGFYSLLSFTAIFCFDSSLLRDMYTLNF-----TDNCDVLGVAVLRYFLGLFPVFTISTNFPIIAVTLRNNWKTLFHRDGGTY--PWVVDRIVFPLITLVPPIIVAFLTHDLESLVGITGAYAGTGIQYIIPAFLVYFSRRHLEPVYGRDVENK--------------HRSPFRHTFWVVFVVVWATFCLMFVTAN 485          
BLAST of Transmembrane protein 104 vs. Ensembl Cavefish
Match: tmem104 (transmembrane protein 104 [Source:NCBI gene;Acc:103032642])

HSP 1 Score: 264.233 bits (674), Expect = 8.072e-81
Identity = 159/387 (41.09%), Postives = 238/387 (61.50%), Query Frame = 1
Query:  559 YFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVN--IESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVN 1713
            +F+I++  E+G MA ++FN++G+ +FY+ + VYLYGDLA+YAAAVP S+ +VAC    + S+  +  +++D CW    I R ++YR+FL  F LLL PF FFN  KTK++Q  T  MRW AF +M  L  I + +G+    PK A  +  PNL G+C+YSFM  HSLPSL+TPI +K ++  L+   + +IL FY LLS  + F F +  +  + TLNF     ++   V  +A  +Y+L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +PL+ ++PPI+V + T+++  LVG TG+YAGT IQY+IP  LV  +RR L+    +  E+                +SPFRH  W + +++WA   ++ VT N
Sbjct:  136 HFDIVERVEMGQMASMFFNKVGVNMFYICIIVYLYGDLAIYAAAVPMSLMEVACG-NHSCSAGSMKYNDTDPCW--GSIKRKDSYRVFLAIFTLLLGPFVFFNAQKTKYLQILTSLMRWIAFTMMIILALIRIGKGHGEGHPKAAQLTGVPNLFGVCVYSFMCQHSLPSLVTPISDKRRVGALVLADYVLILGFYSLLSFTAIFCFDSSLLRDMYTLNF-----TDNCDVLGVAVLRYFLGLFPVFTISTNFPIIAVTLRNNWKTLFHRDGGTY--PWVVDRIVFPLITLVPPIIVAFLTHDLESLVGITGAYAGTGIQYIIPAFLVYFSRRHLEPVYGRDVENK--------------HRSPFRHTFWVVFVVVWATFCLMFVTAN 498          
BLAST of Transmembrane protein 104 vs. Ensembl Nematostella
Match: EDO35495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLC7])

HSP 1 Score: 318.546 bits (815), Expect = 2.300e-102
Identity = 205/526 (38.97%), Postives = 302/526 (57.41%), Query Frame = 1
Query:  175 HSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSI--LCLLSYITTTYVIEAMAISNGL---QKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVA--CTFKLNTSSIILALSESDL---CWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVT--PKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVNIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVNH 1716
            +S  V  +YVFNLI+G GAL +PKAF  AGW++S +++ +  +  LS+IT+T+++EAMA +N L   Q+  K +Y           +   +    L +Y  +  M E++                         ++I    E+G MA +++N+ GL LFYL + VYLYGDLA+YAAAVP S+  ++      LN SS  L    SD    CW    +S  N YRI+L  F L L PF+FFN+ KTK++QY T  +RW AF +M  L T+ +A+  +  T  P  A+ S  P+L G+C+YSFM  HSLPSLITP++NK++L  L    F++IL+FY +LS  + F F +++ L TLNF  ++ SN       A+ +Y+LALFPVF++S +FPII +TLR+NL+NL     GR +  W ++ + +PL+AI+PPI+V + T N+  LVG TGSYAG  +QY+IP  LV C R+ L   +  +   +               +S  RH+ W   +  W  + + LVTV H
Sbjct:   11 YSSPVAFVYVFNLIIGAGALTMPKAFAGAGWIVSTVLICVFDVFFLSFITSTFMVEAMAAANALLVVQRREKKEYDGLVSQSVTQSSNVAEVEPLLNSYKVD--MKENN------------------------LYDIKVRVEMGQMAKLFYNKWGLKLFYLCLVVYLYGDLAIYAAAVPKSLTQISWYGAKSLNRSSGCLTNGTSDELAPCW--GTLSTGNVYRIYLLIFSLALGPFSFFNVQKTKYLQYLTTLLRWKAFIMMIVLATMLIAEQKQTTTHAPVAADLSGVPSLFGVCVYSFMCQHSLPSLITPVRNKSRLTLLFVSDFTIILIFYAVLSFTAMFAFGDLKDLYTLNF--VIYSN-------AYVRYFLALFPVFTLSTNFPIISVTLRDNLKNLFY-REGRPYP-WVIDRLVFPLVAILPPILVAFITQNLEFLVGVTGSYAGAGVQYLIPASLVYCGRKKLRTLLGCYDNKH---------------RSLLRHRTWLFFVYAWTFICVALVTVYH 482          
BLAST of Transmembrane protein 104 vs. Ensembl Nematostella
Match: EDO34542 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP40])

HSP 1 Score: 193.356 bits (490), Expect = 2.229e-55
Identity = 148/505 (29.31%), Postives = 242/505 (47.92%), Query Frame = 1
Query:  187 VGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSM--SPNLLGICIYSFMIHHSLPSLITPIKNKNKLF--FLIFXXXXXXXXXXXXXXXXXXXTFVNIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMK-KFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAA 1686
            V  +++FN++ G G LALP +   AG +   I L+I+  +++++ T++IE ++ +N   +   +                +     L   + + G+T                            FEI++  ELG M  ++   +G  LFY  +C+YL+GDLA+YA +V T++  V  +                      +IS    Y  FL GF++++ PF FFN  KTK +Q +T+ +R  A  +M  L+   +A G      ++  F M  +  LLG  ++SFM HH++ SLI  I++K+K    FL   T  ++    L+ + + +     I +L TL F         PV  +A F   L+ +PVF++S++FP+I ITLRNNL  L     G  F+ W L+   + L+A+IPP+ +    ++++ LV  TGS+AG  I  + P  LVL +RR L   +   +HE               P  SPF+H AW   +L +AA
Sbjct:    5 VAAVFLFNVLTGVGILALPSSIAKAGIISGSICLTIVAFMAFVSATFLIEVLSTANAWVRFHPIHIGKGQTKACAFKEFGEK----LVAKSKSLGLTNP--------------------------FEIVESVELGQMTELFLGTVGSTLFYAVLCLYLFGDLAIYAVSVATTLTRVLGS--------------------QPEIS----YYSFLLGFIMVIGPFCFFNFQKTKVLQLSTMVLRNTAMVLMIVLVINDIASGKRVPINQVVLFDMEETKELLGTAVFSFMCHHTISSLIMLIRDKHKALAVFLFDYTIELLYCSVLVGTAILSRPPSEINALYTLTFR------DYPVEILAKF---LSFYPVFTLSSNFPLICITLRNNLLTLFNISAG--FNPWSLDQPIFTLVALIPPMTLAAAVHDVSKLVVLTGSFAGLAIMLLTPAFLVLYSRRKLKRLVGPNWHE-------------MHPHLSPFQHNAWIYLVLAFAA 431          
BLAST of Transmembrane protein 104 vs. Ensembl Nematostella
Match: EDO27621 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8R4])

HSP 1 Score: 98.9821 bits (245), Expect = 1.012e-22
Identity = 69/274 (25.18%), Postives = 121/274 (44.16%), Query Frame = 1
Query:  187 VGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMS 1008
            V  +++FN++ G G LALP +   AG +   I L+I+  +++++ T++IE ++ +N   +   +                +     L   + + G+T                            FEI++  ELG M  ++   +G  LFY  +C+YL+GDLA+YA +V T++  V  +                      +IS    Y  FL GF++++ PF FFN  KTK +Q +T+ +R  A  +M  L+   +A G      ++  F M 
Sbjct:    1 VAAVFLFNVLTGVGILALPSSIAKAGIISGSICLTIVAFMAFVSATFLIEVLSTANAWVRFHPIHIGKGQTKACAFKEFGEK----LVAKSKSLGLTNP--------------------------FEIVESVELGQMTELFLGTVGSTLFYAVLCLYLFGDLAIYAVSVATTLTRVLGS--------------------QPEIS----YYSFLLGFIMVIGPFCFFNFQKTKVLQLSTMVLRNTAMVLMIVLVINDIASGKRVPINQVVLFDME 220          

HSP 2 Score: 51.6026 bits (122), Expect = 3.791e-7
Identity = 32/95 (33.68%), Postives = 49/95 (51.58%), Query Frame = 1
Query: 1405 YPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMK-KFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAA 1686
            + L+A+IPP+ +    ++++ LV  TGS+AG  I  + P  LVL +RR L   +   +HE               P  SPF+H AW   +L +AA
Sbjct:  233 FTLVALIPPMTLAAAVHDVSKLVVLTGSFAGLAIMLLTPAFLVLYSRRKLKRLVGPNWHE-------------MHPHLSPFQHNAWIYLVLAFAA 314          
BLAST of Transmembrane protein 104 vs. Ensembl Medaka
Match: tmem104 (transmembrane protein 104 [Source:NCBI gene;Acc:101159355])

HSP 1 Score: 351.288 bits (900), Expect = 1.321e-114
Identity = 212/520 (40.77%), Postives = 307/520 (59.04%), Query Frame = 1
Query:  160 KKVEGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVN--IESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVN 1713
             + E +S  VG +Y+FNLIVGTGAL +PKAF  AGW +S  ++  L  +SY+TTT+VIEAMA +N   +  + +   T+ +   +++ DD           +   +E +  PI           S   S    +F+I++  E+G MA ++FN++G+ +FY+ + VYLYGDLA+YAAAVP S+ +VAC  + + S+  +  +++D CW    ++R +AYR+FL+ F LLL PFTFFN  KTK++Q  T  MRW AF +M  L  I + +G     P LAN    PNL G+C+YSFM  HSLPS++TPI  K ++  L+   +S+IL FY+LLS  + F F +  +  + TLNF     ++   V  I   +Y+L LFPVF+IS +FPII +TLRNN + L     G     W ++ + +PL+ ++PPIVV + T+N+  LVG TGSYAGT IQYVIP  LV  ARR L+  M +              +     QSPF H  W   +L+WAA  ++ VT N
Sbjct:    7 DRGEPYSPFVGLVYMFNLIVGTGALTMPKAFATAGWAVSLALICFLAFMSYMTTTFVIEAMAAANAQLRWKRREQEETDYNDSTSEDSDD---------GLDLSRSEPETKPI----------LSVQRSGHADHFDIVERVEMGQMASMFFNKVGVNMFYICIIVYLYGDLAIYAAAVPISLMEVACGNR-SCSAGGVKFNDTDACW--GPVTRADAYRVFLSVFTLLLGPFTFFNAQKTKYLQILTSLMRWIAFTMMIVLALIRIGKGTGEGRPPLANLRGVPNLFGVCVYSFMCQHSLPSVVTPISEKKRVGALVLADYSLILGFYVLLSFTAIFCFDSSLLHDMYTLNF-----TDNCDVLDIPVLRYFLGLFPVFTISTNFPIIAVTLRNNWKTLFHRDGGTY--PWVVDRVVFPLITLVPPIVVAFCTHNLESLVGITGSYAGTGIQYVIPAFLVFTARRHLEPVMGR--------------ECVNKHQSPFHHAFWVWFVLLWAAFCLMFVTAN 483          
BLAST of Transmembrane protein 104 vs. Ensembl Medaka
Match: tmem104 (transmembrane protein 104 [Source:NCBI gene;Acc:101159355])

HSP 1 Score: 183.341 bits (464), Expect = 2.578e-51
Identity = 93/215 (43.26%), Postives = 136/215 (63.26%), Query Frame = 1
Query:  454 YNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKL 1098
            YN +     DD + ++ S+       S   S    +F+I++  E+G MA ++FN++G+ +FY+ + VYLYGDLA+YAAAVP S+ +VAC  + + S+  +  +++D CW    ++R +AYR+FL+ F LLL PFTFFN  KTK++Q  T  MRW AF +M  L  I + +G     P LAN    PNL G+C+YSFM  HSLPS++TPI  K +L
Sbjct:   30 YNDSTSEDSDDGLDLSRSEPETKPILSVQRSGHADHFDIVERVEMGQMASMFFNKVGVNMFYICIIVYLYGDLAIYAAAVPISLMEVACGNR-SCSAGGVKFNDTDACW--GPVTRADAYRVFLSVFTLLLGPFTFFNAQKTKYLQILTSLMRWIAFTMMIVLALIRIGKGTGEGRPPLANLRGVPNLFGVCVYSFMCQHSLPSVVTPISEKKRL 241          
BLAST of Transmembrane protein 104 vs. Planmine SMEST
Match: SMESG000052539.1 (SMESG000052539.1)

HSP 1 Score: 977.622 bits (2526), Expect = 0.000e+0
Identity = 522/528 (98.86%), Postives = 523/528 (99.05%), Query Frame = 1
Query:  151 MKPKKVEGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFXXXXXXXXXXXXXXXXXXYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFXXXXXXXXXXXXXXXXXXXTFVNIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVNHFYRNPN 1734
            MKPKKVEGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFSQSNESNQESSISSECISYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESD CWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANF+MSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFLTFSVILLFYLLLSMLSAFTFVNIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVNHF   P 
Sbjct:    1 MKPKKVEGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILCLLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLYTYNTNYGMTEDDEIPITFSQSNESNQESSISSECISYFEILDVYELGHMAIIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSIILALSESDRCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTTLSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFAMSPNLLGICIYSFMIHHSLPSLITPIKNKNKLFFLIFLTFSVILLFYLLLSMLSAFTFVNIESLITLNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNLITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGTFIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRHKAWAIGILIWAAVSILLVTVNHFLSKPK 528          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 104 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMEM1043.156e-9939.81transmembrane protein 104 [Source:HGNC Symbol;Acc:... [more]
TMEM1043.156e-9939.81transmembrane protein 104 [Source:HGNC Symbol;Acc:... [more]
TMEM1041.291e-4440.08transmembrane protein 104 [Source:HGNC Symbol;Acc:... [more]
TMEM1047.536e-3036.59transmembrane protein 104 [Source:HGNC Symbol;Acc:... [more]
TMEM1042.239e-1446.75transmembrane protein 104 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Transmembrane protein 104 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C03A3.26.996e-6431.75Transmembrane protein 104 homolog [Source:UniProt... [more]
back to top
BLAST of Transmembrane protein 104 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG52621.909e-10337.57gene:FBgn0036988 transcript:FBtr0310615[more]
CG52621.909e-10337.57gene:FBgn0036988 transcript:FBtr0078230[more]
back to top
BLAST of Transmembrane protein 104 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tmem1047.488e-10639.96transmembrane protein 104 [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem1047.488e-10639.96transmembrane protein 104 [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem1047.073e-8441.27transmembrane protein 104 [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem1041.564e-3539.29transmembrane protein 104 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Transmembrane protein 104 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem1048.546e-9940.27transmembrane protein 104 [Source:NCBI gene;Acc:54... [more]
back to top
BLAST of Transmembrane protein 104 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tmem1046.559e-9339.00transmembrane protein 104 [Source:MGI Symbol;Acc:M... [more]
Tmem1041.270e-9138.68transmembrane protein 104 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Transmembrane protein 104 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VPF8|TM104_DROME1.914e-10237.57Transmembrane protein 104 homolog OS=Drosophila me... [more]
sp|Q5F3I6|TM104_CHICK2.048e-9938.46Transmembrane protein 104 OS=Gallus gallus OX=9031... [more]
sp|Q5RCV1|TM104_PONAB1.088e-9839.42Transmembrane protein 104 OS=Pongo abelii OX=9601 ... [more]
sp|Q8NE00|TM104_HUMAN1.516e-9839.81Transmembrane protein 104 OS=Homo sapiens OX=9606 ... [more]
sp|Q3TB48|TM104_MOUSE4.588e-9239.00Transmembrane protein 104 OS=Mus musculus OX=10090... [more]
back to top
BLAST of Transmembrane protein 104 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9K2S82.827e-13146.81Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A293M0J72.933e-12843.38Uncharacterized protein (Fragment) OS=Ornithodoros... [more]
A0A1Z5KX132.971e-12842.39Uncharacterized protein (Fragment) OS=Ornithodoros... [more]
A0A1E1X4U21.362e-12343.83Putative amino acid transporter OS=Amblyomma aureo... [more]
A0A210QQB15.777e-12343.05Transmembrane protein 104 OS=Mizuhopecten yessoens... [more]
back to top
BLAST of Transmembrane protein 104 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem1042.686e-10639.96transmembrane protein 104 [Source:NCBI gene;Acc:10... [more]
tmem1048.072e-8141.09transmembrane protein 104 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 104 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 104 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 104 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO354952.300e-10238.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345422.229e-5529.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO276211.012e-2225.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protein 104 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem1041.321e-11440.77transmembrane protein 104 [Source:NCBI gene;Acc:10... [more]
tmem1042.578e-5143.26transmembrane protein 104 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 104 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000052539.10.000e+098.86SMESG000052539.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031280 ID=SMED30031280|Name=Transmembrane protein 104|organism=Schmidtea mediterranea sexual|type=transcript|length=1805bp
TTTTATAATTTAGTAAATTCGATTATTTAATTATTTTTTAATTTATCAAA
GATTTTTCAAGTTTCTAAGATTTTTATTTTATCTCTGAAAGAAAATACTG
CCGTGTCTCAACATTAATTGTAACCTTAAGAATCTTTGTTTAATTTAATT
ATGAAACCTAAAAAAGTCGAAGGCCACTCTCGAATAGTCGGATGTATTTA
CGTTTTCAATTTAATTGTTGGAACTGGTGCGCTAGCATTACCGAAAGCCT
TTCAAGATGCAGGTTGGGTGTTAAGCGGAATAGTCTTAAGTATTTTATGT
TTACTGAGTTATATTACCACAACCTATGTAATTGAAGCGATGGCCATTTC
AAATGGACTTCAAAAATTGTCCAAATTAAAATACACATTTACTAATGATT
CGCCGTTCATTGCTGATAATCTCGATGACGATGCAACTAAGACCCTTTAC
ACTTATAATACCAATTACGGCATGACAGAAGACGATGAAATCCCTATTAC
ATTTTCACAATCGAATGAATCTAATCAAGAATCCTCCATTTCATCTGAAT
GCATATCGTATTTTGAAATTCTGGATGTCTATGAATTGGGGCATATGGCT
ATTATTTATTTCAACAGACTAGGACTTGTATTATTTTATTTGAGCATGTG
TGTTTATTTGTATGGTGATTTGGCTGTATATGCTGCAGCTGTTCCGACTT
CTATAAGAGATGTTGCATGTACGTTCAAATTGAATACAAGCAGTATTATC
CTCGCGCTTTCAGAATCTGATCTCTGTTGGCCAAATTCCGATATCTCCCG
ATTAAATGCTTATCGAATATTTTTGACGGGATTTCTTCTTCTTCTATGTC
CATTCACATTTTTCAATTTGAACAAAACGAAATTTATCCAATATACAACA
TTATCAATGAGATGGTTTGCGTTTGGAATCATGTTCACTTTAATGACCAT
TTACTTGGCTCAAGGCAACGAACCGGTGACACCGAAACTTGCTAATTTTT
CAATGTCGCCGAATCTTCTTGGAATCTGTATCTATTCCTTCATGATCCAT
CATTCATTGCCGTCTTTAATAACGCCTATTAAAAATAAAAATAAACTCTT
TTTCTTGATTTTTCTCACCTTTTCCGTTATTTTGTTGTTTTATTTACTCT
TATCCATGCTGTCGGCATTCACATTCGTAAATATCGAATCGTTAATAACT
CTCAATTTTGAACCAATTCTCACCTCGAACCAAAAACCTGTAACTAAAAT
CGCTTTCTTTCAATACTATTTGGCGTTGTTTCCGGTATTTTCTATCAGCG
CCAGTTTTCCGATTATAGGAATAACTCTGAGGAACAATTTGCGGAACCTT
ATCACTTGTGGAACCGGTCGGAAATTCGATAATTGGTTTCTGGAACATAT
GTTCTATCCTTTGTTAGCTATCATCCCGCCGATTGTTGTAGTTTACGGAA
CGAATAATATTACCATTCTGGTAGGATTTACTGGTTCATATGCAGGGACG
TTTATACAATATGTCATTCCGATTTGTCTTGTTTTATGCGCTAGGAGAAG
TCTTGATATCTTTATGAAGAAATTTCACGAACATAATGGAAACCATCTGG
ATATTACACCAGAGCAATTGTTTCAACCATTTCAGTCTCCTTTTCGACAC
AAAGCTTGGGCTATTGGTATTCTTATTTGGGCAGCAGTTTCTATTTTACT
CGTTACAGTAAATCATTTTTATCGAAACCCAAATGATTACATTAAATGAT
TTTATATTTTTTTAATTGAATATGATTATTTTTATTTTTCCGCAGAGAAA
TTGTC
back to top

protein sequence of SMED30031280-orf-1

>SMED30031280-orf-1 ID=SMED30031280-orf-1|Name=SMED30031280-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=533bp
MKPKKVEGHSRIVGCIYVFNLIVGTGALALPKAFQDAGWVLSGIVLSILC
LLSYITTTYVIEAMAISNGLQKLSKLKYTFTNDSPFIADNLDDDATKTLY
TYNTNYGMTEDDEIPITFSQSNESNQESSISSECISYFEILDVYELGHMA
IIYFNRLGLVLFYLSMCVYLYGDLAVYAAAVPTSIRDVACTFKLNTSSII
LALSESDLCWPNSDISRLNAYRIFLTGFLLLLCPFTFFNLNKTKFIQYTT
LSMRWFAFGIMFTLMTIYLAQGNEPVTPKLANFSMSPNLLGICIYSFMIH
HSLPSLITPIKNKNKLFFLIFLTFSVILLFYLLLSMLSAFTFVNIESLIT
LNFEPILTSNQKPVTKIAFFQYYLALFPVFSISASFPIIGITLRNNLRNL
ITCGTGRKFDNWFLEHMFYPLLAIIPPIVVVYGTNNITILVGFTGSYAGT
FIQYVIPICLVLCARRSLDIFMKKFHEHNGNHLDITPEQLFQPFQSPFRH
KAWAIGILIWAAVSILLVTVNHFYRNPNDYIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR013057AA_transpt_TM
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane