Scavenger receptor class B member 1

Overview
NameScavenger receptor class B member 1
Smed IDSMED30031265
Length (bp)1743
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Scavenger receptor class B member 1 (SMED30031265) t-SNE clustered cells

Violin plots show distribution of expression levels for Scavenger receptor class B member 1 (SMED30031265) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Scavenger receptor class B member 1 (SMED30031265) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Scavenger receptor class B member 1 (SMED30031265) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031265

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30031265SMESG000058914.1 dd_Smed_v4_2951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30031265SMESG000058914.1 dd_Smed_v4_2951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031265SMESG000058914.1 dd_Smed_v4_2951_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Scavenger receptor class B member 1 vs. Ensembl Human
Match: SCARB2 (scavenger receptor class B member 2 [Source:HGNC Symbol;Acc:HGNC:1665])

HSP 1 Score: 285.419 bits (729), Expect = 1.373e-89
Identity = 158/410 (38.54%), Postives = 242/410 (59.02%), Query Frame = 1
Query:  157 VRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGY-ESDTFTTANIPY--IVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITA-LGLENLPSVLLPVMWLNESVLITDDLARKIKNRL 1365
            V   + K + LRNGT  F  W+ P +P Y QF+FF+V NP+ IL G+ P V ++GPYTYRE R K NI F  NGT +S +  + Y FE   SVG  + D   T NIP   ++  +++   +EI + M++   + +     F+  +V  + WGY D  L     +++ F     P  GLFY KN TND  Y   TG  +  N+ KI  WNG + L  W  D  NM+NGTDG  F P + K   LY+F SD CR+++ T+   + ++G+P+F Y  P+ + AN +   DN GFC+ +G CLG+GVLN++ C  G+ PI+MS PHF  AD ++  +I G++P++E ++T + + P TG+ L   K+ QINI ++ +   +   ++ +++ PVM+LNESV I  + A ++K+ +
Sbjct:   33 VDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKL-----FVTHTVDELLWGYKDEILS----LIHVFRPDISPYFGLFYEKNGTNDGDYVFLTGEDSYLNFTKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTS---DNAGFCIPEGNCLGSGVLNVSICKNGA-PIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMI 429          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Human
Match: SCARB2 (scavenger receptor class B member 2 [Source:HGNC Symbol;Acc:HGNC:1665])

HSP 1 Score: 285.419 bits (729), Expect = 2.161e-89
Identity = 158/410 (38.54%), Postives = 242/410 (59.02%), Query Frame = 1
Query:  157 VRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGY-ESDTFTTANIPY--IVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITA-LGLENLPSVLLPVMWLNESVLITDDLARKIKNRL 1365
            V   + K + LRNGT  F  W+ P +P Y QF+FF+V NP+ IL G+ P V ++GPYTYRE R K NI F  NGT +S +  + Y FE   SVG  + D   T NIP   ++  +++   +EI + M++   + +     F+  +V  + WGY D  L     +++ F     P  GLFY KN TND  Y   TG  +  N+ KI  WNG + L  W  D  NM+NGTDG  F P + K   LY+F SD CR+++ T+   + ++G+P+F Y  P+ + AN +   DN GFC+ +G CLG+GVLN++ C  G+ PI+MS PHF  AD ++  +I G++P++E ++T + + P TG+ L   K+ QINI ++ +   +   ++ +++ PVM+LNESV I  + A ++K+ +
Sbjct:   33 VDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKL-----FVTHTVDELLWGYKDEILS----LIHVFRPDISPYFGLFYEKNGTNDGDYVFLTGEDSYLNFTKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTS---DNAGFCIPEGNCLGSGVLNVSICKNGA-PIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMI 429          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Human
Match: SCARB2 (scavenger receptor class B member 2 [Source:HGNC Symbol;Acc:HGNC:1665])

HSP 1 Score: 285.419 bits (729), Expect = 3.213e-89
Identity = 158/410 (38.54%), Postives = 242/410 (59.02%), Query Frame = 1
Query:  157 VRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGY-ESDTFTTANIPY--IVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITA-LGLENLPSVLLPVMWLNESVLITDDLARKIKNRL 1365
            V   + K + LRNGT  F  W+ P +P Y QF+FF+V NP+ IL G+ P V ++GPYTYRE R K NI F  NGT +S +  + Y FE   SVG  + D   T NIP   ++  +++   +EI + M++   + +     F+  +V  + WGY D  L     +++ F     P  GLFY KN TND  Y   TG  +  N+ KI  WNG + L  W  D  NM+NGTDG  F P + K   LY+F SD CR+++ T+   + ++G+P+F Y  P+ + AN +   DN GFC+ +G CLG+GVLN++ C  G+ PI+MS PHF  AD ++  +I G++P++E ++T + + P TG+ L   K+ QINI ++ +   +   ++ +++ PVM+LNESV I  + A ++K+ +
Sbjct:   33 VDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKL-----FVTHTVDELLWGYKDEILS----LIHVFRPDISPYFGLFYEKNGTNDGDYVFLTGEDSYLNFTKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTS---DNAGFCIPEGNCLGSGVLNVSICKNGA-PIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMI 429          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Human
Match: SCARB2 (scavenger receptor class B member 2 [Source:HGNC Symbol;Acc:HGNC:1665])

HSP 1 Score: 276.174 bits (705), Expect = 3.144e-86
Identity = 153/394 (38.83%), Postives = 232/394 (58.88%), Query Frame = 1
Query:  157 VRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGY-ESDTFTTANIPY--IVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITA-LGLENLPSVLLPVMWLNE 1317
            V   + K + LRNGT  F  W+ P +P Y QF+FF+V NP+ IL G+ P V ++GPYTYRE R K NI F  NGT +S +  + Y FE   SVG  + D   T NIP   ++  +++   +EI + M++   + +     F+  +V  + WGY D  L     +++ F     P  GLFY KN TND  Y   TG  +  N+ KI  WNG + L  W  D  NM+NGTDG  F P + K   LY+F SD CR+++ T+   + ++G+P+F Y  P+ + AN +   DN GFC+ +G CLG+GVLN++ C  G+ PI+MS PHF  AD ++  +I G++P++E ++T + + P TG+ L   K+ QINI ++ +   +   ++ +++ PVM+LNE
Sbjct:   33 VDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKL-----FVTHTVDELLWGYKDEILS----LIHVFRPDISPYFGLFYEKNGTNDGDYVFLTGEDSYLNFTKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTS---DNAGFCIPEGNCLGSGVLNVSICKNGA-PIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNE 413          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Human
Match: SCARB2 (scavenger receptor class B member 2 [Source:HGNC Symbol;Acc:HGNC:1665])

HSP 1 Score: 276.944 bits (707), Expect = 4.462e-86
Identity = 156/410 (38.05%), Postives = 240/410 (58.54%), Query Frame = 1
Query:  157 VRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGY-ESDTFTTANIPY--IVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITA-LGLENLPSVLLPVMWLNESVLITDDLARKIKNRL 1365
            V   + K + LRNGT  F  W+ P +P Y QF+FF+V NP+ IL G+ P V ++GPYTYR    K NI F  NGT +S +  + Y FE   SVG  + D   T NIP   ++  +++   +EI + M++   + +     F+  +V  + WGY D  L     +++ F     P  GLFY KN TND  Y   TG  +  N+ KI  WNG + L  W  D  NM+NGTDG  F P + K   LY+F SD CR+++ T+   + ++G+P+F Y  P+ + AN +   DN GFC+ +G CLG+GVLN++ C  G+ PI+MS PHF  AD ++  +I G++P++E ++T + + P TG+ L   K+ QINI ++ +   +   ++ +++ PVM+LNESV I  + A ++K+ +
Sbjct:   33 VDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRN---KANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKL-----FVTHTVDELLWGYKDEILS----LIHVFRPDISPYFGLFYEKNGTNDGDYVFLTGEDSYLNFTKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTS---DNAGFCIPEGNCLGSGVLNVSICKNGA-PIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMI 426          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Celegans
Match: scav-3 (SCAVenger receptor (CD36 family) related [Source:UniProtKB/TrEMBL;Acc:Q9XTT3])

HSP 1 Score: 187.193 bits (474), Expect = 4.160e-52
Identity = 126/417 (30.22%), Postives = 209/417 (50.12%), Query Frame = 1
Query:  190 RNGTLI----FQQWQNPTVPAYMQFWFFDVLNPDAILD-GDKPSVRQIGPYTYREYRIK-YNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEIN------KLMVENSIKDIKNYSPFIKTSVKNITW-GYTDPFLE---ANKLILNDFGFRAEPN-----IGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKL--SMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFC----LDGY----------CLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLN-PSKEYK-TILKLEPTTGLPLHIQKKLQINIALESITALGLENLPSVLLPVMWLNESV 1323
             NGT +     + W  P     +  W F+V N D IL   +KP++ +IGP+ + E + K Y+   D +  V Y  ++LY F  + S            IP IV   ++ D  ++       K  +E+ +K +   +P+I   V +  + GY DP ++    NK++     F  E N     +G FYG+N T D +Y+VD G  +      + +WN  +++    W+  YA M+NGTDG +F P L +  RL IF   ICR+I   Y     + G+PS+ YA P  L+      P N+ FC    +  Y          CL AG+++L++C  G+P + +S PHF ++  +   S+ GL+ P+     T++ +EPT G+P   ++ +QIN+ +   +    EN  +V++PV+W+NE+ 
Sbjct:   52 ENGTEVPNAMTKSWLKPLYAMQLNIWMFNVTNVDGILKRHEKPNLHEIGPFVFDEVQEKVYHRFADNDTRVFYKNQKLYHFNKNASCP-TCHLDMKVTIPNIVF-QKLIDAADVTIFGVRIKFAIESVLKMVSE-APYITVKVSDALFDGYEDPIIDIVCKNKIL----QFLCETNSLQRRVGFFYGQNGTTDGIYEVDAGVPSPSKIGHLYTWNNMTEMPEGTWDTKYARMINGTDGQLFSPMLKREDRLTIFVPQICRSIQMEYTKDVAVNGVPSWRYAPPLDLY--DPALPQNRAFCNKNGMPRYFDNTTVQIENCLPAGLIDLSRCQAGNPRVYLSNPHFYNSPMELWHSVTGLSVPTASNDLTVVDIEPTAGVPTQAKRIMQINVGMVKGSLSVTENTTNVVVPVLWMNETA 459          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Celegans
Match: scav-2 (SCAVenger receptor (CD36 family) related [Source:UniProtKB/TrEMBL;Acc:G5EBM7])

HSP 1 Score: 171.014 bits (432), Expect = 4.257e-46
Identity = 123/445 (27.64%), Postives = 216/445 (48.54%), Query Frame = 1
Query:  187 LRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKD---------IKNYSPFIKTSVKNITWGYTDPFLE-ANKLILNDFGFRA----EPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKL--SMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFC------------LDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKEYK--TILKLEPTTGLPLHIQKKLQINIAL---ESIT-ALGLENLPSVLLPVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCG 1419
            L NG++++++W  P        + +   NPD  ++G  P V   GPY + + +++  +V   NGTV Y +   Y F        E ++  T      +LG RI     I +  VE +  +         +   +       + +  GY DPFL+   ++   +F   A       IGLF+  N T  KVY++D G  N D+  KI S++ S  L  + W+ D +  + GTDGS+F PFL+K  +LY++ +++CR+I   +      +G+ ++ +  P  +F     +P N+GFC                C+  G+L ++KC    PPI +S P+F  A  +   S+ GLN + E +   ++ +EP  G  L+ ++  Q+NI +   +++T  + L+ + S L+PV+ L+E+  I DD   +I+++L    SI       +M+ G
Sbjct:   73 LVNGSIMWEKWAMPEYKIRFNMYVYSTKNPDEFMNGAIPEVTGSGPYVF-DKKMENRVVSAENGTVKYRRFFTYNFN-------EQESCQTC-----ILGNRIWVPNMIYQKFVEAASTEGMKAAATTLLSQTAFLEVEVEELLFEGYKDPFLDKVCEIPFMNFVCEAILDVPERIGLFFKANGTGSKVYEIDDGTRNPDDLGKILSYDESPILDETWWSTDESLKIKGTDGSLFHPFLSKHEKLYVYVAELCRSIWLEFKEEVEYRGLKAYRFVVPPEVF--DVTHPGNQGFCNPSEKQFYESQNDSSNCMPKGLLEISKCQQSQPPITISLPNFLFAPSEVRGSVKGLNETDEIRDSIVVDIEPRVGAVLYARRVSQVNIEMWKGKNLTFPVNLKKMKSALIPVLILHETSEIDDDSLEQIRSQLYETESIAYTSCDVMMIIG 502          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Celegans
Match: scav-1 (SCAVenger receptor (CD36 family) related [Source:RefSeq peptide;Acc:NP_508919])

HSP 1 Score: 115.161 bits (287), Expect = 8.025e-27
Identity = 129/504 (25.60%), Postives = 217/504 (43.06%), Query Frame = 1
Query:  124 GLFIYF-IIPVIVRHQV--RKMLPLR-NGTL--IFQQWQNPTVPAYMQFWFFDVLNPDAILD-GDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLS-------------------VGYES-DTFT--------TANIPYIVLGTRIKDYKEINKL--MVENSIK---DIKNYSPFIKTSVKNITW-GYTDPFLEA---NKLILNDFGFRAEPN------IGLFYGKNNTNDKVYKVDTGNIN---------------------LDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-----------DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKEY-KTILKLEPTTGLPLHIQKKLQINIALESITAL-GLENLPSVLLPVMWLNESVLITDDLARKIKNRLLVPVS 1380
            GL I   + P IV +Q+   K+L L  +GTL      W N    + MQ+W +D  N   I++    P VR+ GPY + E      + F  NG  + + Q + + F P+ S                   VG +  DT           A I + ++  +    +  + L  ++E  +     + N SPF   +V  + + GY  PF+E      L +  F F   P       I L    N T+D +  V TG  +                     + N L    W  ++K    + + A ++ GT+G  F  F+ K+  L  F SD+CRTIH  +     +KG   + +  P   F +++++ +N G+C+              CL +G+L++++C  G  PI+MS+PHF  A     + +    P+ +  +T+L +EP TG  L  QK+LQIN+ +     +     +     P+ W+NES  +  +   ++ ++L  PVS
Sbjct:   26 GLVIVLNVFPNIVNNQINDSKVLGLNADGTLNSFTDSWVNSKYISTMQYWVYDYTNTIGIMNRAIYPDVREKGPYAFDEILTMDKLNFSENGEFMEFRQIQTFVFNPNKSCAGCDPYKDKVLIPDMGFQVGIDQIDTVIEGILKNPLAATICHAIMKGKPNANQTCSNLGALIEGELGTLISLFNVSPFTTVTVDQLLFSGYKTPFVEKFLDEALGMLHFLFGTAPKPLDDPPIQL-NPLNGTSDIINTVLTGKTDPLKAGYMTEFRSISNNSLFNSIGNTLPPMWWPYANKTYCKDPNSALVLTGTNGDYFKNFVKKTDILPAFVSDVCRTIHFVFDREVTVKGFKGYRFVMPPTQF-DYSLD-ENCGYCIPLKYGSYEYPAQSACLPSGLLDISQCTGG--PIIMSKPHFYQASKVVSKFVPRFKPTYDNDETMLDIEPNTGTVLQAQKRLQINMLVNQFKHIRSYSVMRPGAYPLAWVNESFYMDQNTIDQLNSQLFTPVS 524          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Celegans
Match: scav-1 (SCAVenger receptor (CD36 family) related [Source:RefSeq peptide;Acc:NP_508919])

HSP 1 Score: 115.161 bits (287), Expect = 8.025e-27
Identity = 129/504 (25.60%), Postives = 217/504 (43.06%), Query Frame = 1
Query:  124 GLFIYF-IIPVIVRHQV--RKMLPLR-NGTL--IFQQWQNPTVPAYMQFWFFDVLNPDAILD-GDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLS-------------------VGYES-DTFT--------TANIPYIVLGTRIKDYKEINKL--MVENSIK---DIKNYSPFIKTSVKNITW-GYTDPFLEA---NKLILNDFGFRAEPN------IGLFYGKNNTNDKVYKVDTGNIN---------------------LDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-----------DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKEY-KTILKLEPTTGLPLHIQKKLQINIALESITAL-GLENLPSVLLPVMWLNESVLITDDLARKIKNRLLVPVS 1380
            GL I   + P IV +Q+   K+L L  +GTL      W N    + MQ+W +D  N   I++    P VR+ GPY + E      + F  NG  + + Q + + F P+ S                   VG +  DT           A I + ++  +    +  + L  ++E  +     + N SPF   +V  + + GY  PF+E      L +  F F   P       I L    N T+D +  V TG  +                     + N L    W  ++K    + + A ++ GT+G  F  F+ K+  L  F SD+CRTIH  +     +KG   + +  P   F +++++ +N G+C+              CL +G+L++++C  G  PI+MS+PHF  A     + +    P+ +  +T+L +EP TG  L  QK+LQIN+ +     +     +     P+ W+NES  +  +   ++ ++L  PVS
Sbjct:   26 GLVIVLNVFPNIVNNQINDSKVLGLNADGTLNSFTDSWVNSKYISTMQYWVYDYTNTIGIMNRAIYPDVREKGPYAFDEILTMDKLNFSENGEFMEFRQIQTFVFNPNKSCAGCDPYKDKVLIPDMGFQVGIDQIDTVIEGILKNPLAATICHAIMKGKPNANQTCSNLGALIEGELGTLISLFNVSPFTTVTVDQLLFSGYKTPFVEKFLDEALGMLHFLFGTAPKPLDDPPIQL-NPLNGTSDIINTVLTGKTDPLKAGYMTEFRSISNNSLFNSIGNTLPPMWWPYANKTYCKDPNSALVLTGTNGDYFKNFVKKTDILPAFVSDVCRTIHFVFDREVTVKGFKGYRFVMPPTQF-DYSLD-ENCGYCIPLKYGSYEYPAQSACLPSGLLDISQCTGG--PIIMSKPHFYQASKVVSKFVPRFKPTYDNDETMLDIEPNTGTVLQAQKRLQINMLVNQFKHIRSYSVMRPGAYPLAWVNESFYMDQNTIDQLNSQLFTPVS 524          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Celegans
Match: scav-5 (SCAVenger receptor (CD36 family) related [Source:RefSeq peptide;Acc:NP_509651])

HSP 1 Score: 104.375 bits (259), Expect = 1.902e-23
Identity = 118/476 (24.79%), Postives = 201/476 (42.23%), Query Frame = 1
Query:  109 FMFCFGLFIYFIIPVIVRHQVRKMLPL---RNGTLIFQQ--WQNPTVPAYMQFWFFDVLNPDAI-LDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQ--KRLYFFEPSLSVGYE-SDTFTTAN-----IPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITW-GYTDPFLEANKL-----ILNDFGFRAEPN-------IGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKL--SMWNNDYANMVNGTD-GSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGF-------------------------CLD----GYCLGAGVLNLTKCVPG---SPP--IVMSQPHFSSADPKYHQSIIGLN--PSKEYKTILKLEPTTGLPLHIQKKLQINI-ALESITALGLENLPSVLLPVMWLNESVLITD 1335
            F F  GL ++     I   ++R    L    +G+L +    + NP +   M+F  F+V NPD +   G KP + ++G Y + E   K    F ++ T  + Q  K+ ++ E     GY  +D     N         V G +  ++    K++V   +  +  Y PFI  +VK++   GY DP L          ++N +G+ ++ N            G NN+ D+ Y ++TG  + +    +ESW G  +L  S W    A  + G D GS+    L K+  L  F S +CR+   TY    ++ GI +  +A P   F   T    N GF                         C       + L  G+  L  C PG    PP  +++S PHF  + P+    + G+N  P K    +   E T+G  L +  + Q+N+  + +  ++    +P+V++P+ + +   L+ D
Sbjct:   17 FFFLSGLSMWIAFWPIFNSELRSNYKLGANDDGSLHYAAFLYANPPMKNVMKFNLFNVTNPDEVKYLGAKPELIEVGGYAFLESEQKKYYEFSSDKTKMFYQNYKQYHYSEVDNDAGYNYNDKIMFPNSIAEGAVSTVFGPQ-SEFSPTAKILVSIGLVMLGEY-PFISKTVKDVLMDGYEDPLLSVAHSGIFISLVNFYGYGSQLNYIPEMKTFAYLSGYNNSYDENYWINTGYNDFNKLGFVESWAGLEQLPASFWPTLEARQIKGPDSGSLSKIHLTKTDELPFFLSFMCRSFKRTYWQDGLVDGIKTMAFAVPYEEF--DTTLEKNAGFRYKNQENVDYFPDWCDKNTTTSLSQCQKTANGTFLLPPGIFPLV-CYPGHNAQPPFTVLVSPPHFLYSPPEVQHHLSGMNPDPEKHKPMVFHQEKTSGTALQVDVRFQVNLPVVNNKGSIMSSQMPNVIIPLFYEDSHALVKD 487          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Fly
Match: emp (gene:FBgn0010435 transcript:FBtr0343508)

HSP 1 Score: 221.476 bits (563), Expect = 5.752e-65
Identity = 134/446 (30.04%), Postives = 227/446 (50.90%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAIL-DGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKG-IPSFNYAAPSYLFANHTVNPDNKGFCLDG--YCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNP--SKEYKTILKLEPTTGLPLHIQKKLQINIALESITALG-LENLPSVLLPVMWLNESV-----LITD--DLARKIKNRLLVPVSIG--QLGALALMV 1413
            G+ +     V++   V +M+ LR G   F  W  P V   +  + ++V N D  L +G K  V ++GPY Y E   K NIV + NGT+SY  +++Y F   LSVG E D     NIP +   ++ K      +L +  SI DI    PF++ SV  + WGY DP L+  K ++           GL YGKN T+     V+TG  ++  Y  I+++NG + L  W  D  N + GTDGS+F P ++    L+++  D+CR +   +    +    +P + +  P ++FA+   +PDN  FC  G   C   G+ N++ C   S PI++S PHF  AD      + G++P   ++++    ++P  G  L ++ ++QIN+A+  +  +  + N P ++ P++W  E +      +TD    A ++  ++ V + +G   LG + L++
Sbjct:   22 GIVVACEFTVLIDAVVDRMVALRPGAKTFGWWAKPPVEPRISLYIYNVTNADDFLSNGSKAIVDEVGPYVYSETWEKVNIVENDNGTLSYNLRKIYSFREDLSVGPEDDVVIVPNIPMLSATSQSKHAARFLRLAMA-SIMDILKIKPFVQVSVGQLLWGYEDPLLKLAKDVVPKEQKLPYEEFGLLYGKNGTSSDRVTVNTGVDDIRRYGIIDNFNGRTHLPHWTTDACNTLAGTDGSIFPPHIDHDRILHVYDKDLCRLLPLVFEKEVMTSNEVPGYRFTPPEWVFADVDSHPDNMCFCPAGKPSCSPNGLFNVSLCQYDS-PIMLSFPHFYLADESLRTQVEGISPPMKEKHQFFFDVQPKMGTTLRVRARIQINLAVSQVFDIKQVANFPDIIFPILWFEEGIDNLPDEVTDLMRFAEQVPPKIRVALIVGLCALGVILLLL 465          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Fly
Match: emp (gene:FBgn0010435 transcript:FBtr0072402)

HSP 1 Score: 221.476 bits (563), Expect = 7.556e-65
Identity = 134/446 (30.04%), Postives = 227/446 (50.90%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAIL-DGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKG-IPSFNYAAPSYLFANHTVNPDNKGFCLDG--YCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNP--SKEYKTILKLEPTTGLPLHIQKKLQINIALESITALG-LENLPSVLLPVMWLNESV-----LITD--DLARKIKNRLLVPVSIG--QLGALALMV 1413
            G+ +     V++   V +M+ LR G   F  W  P V   +  + ++V N D  L +G K  V ++GPY Y E   K NIV + NGT+SY  +++Y F   LSVG E D     NIP +   ++ K      +L +  SI DI    PF++ SV  + WGY DP L+  K ++           GL YGKN T+     V+TG  ++  Y  I+++NG + L  W  D  N + GTDGS+F P ++    L+++  D+CR +   +    +    +P + +  P ++FA+   +PDN  FC  G   C   G+ N++ C   S PI++S PHF  AD      + G++P   ++++    ++P  G  L ++ ++QIN+A+  +  +  + N P ++ P++W  E +      +TD    A ++  ++ V + +G   LG + L++
Sbjct:   34 GIVVACEFTVLIDAVVDRMVALRPGAKTFGWWAKPPVEPRISLYIYNVTNADDFLSNGSKAIVDEVGPYVYSETWEKVNIVENDNGTLSYNLRKIYSFREDLSVGPEDDVVIVPNIPMLSATSQSKHAARFLRLAMA-SIMDILKIKPFVQVSVGQLLWGYEDPLLKLAKDVVPKEQKLPYEEFGLLYGKNGTSSDRVTVNTGVDDIRRYGIIDNFNGRTHLPHWTTDACNTLAGTDGSIFPPHIDHDRILHVYDKDLCRLLPLVFEKEVMTSNEVPGYRFTPPEWVFADVDSHPDNMCFCPAGKPSCSPNGLFNVSLCQYDS-PIMLSFPHFYLADESLRTQVEGISPPMKEKHQFFFDVQPKMGTTLRVRARIQINLAVSQVFDIKQVANFPDIIFPILWFEEGIDNLPDEVTDLMRFAEQVPPKIRVALIVGLCALGVILLLL 477          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Fly
Match: emp (gene:FBgn0010435 transcript:FBtr0072400)

HSP 1 Score: 221.476 bits (563), Expect = 7.556e-65
Identity = 134/446 (30.04%), Postives = 227/446 (50.90%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAIL-DGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKG-IPSFNYAAPSYLFANHTVNPDNKGFCLDG--YCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNP--SKEYKTILKLEPTTGLPLHIQKKLQINIALESITALG-LENLPSVLLPVMWLNESV-----LITD--DLARKIKNRLLVPVSIG--QLGALALMV 1413
            G+ +     V++   V +M+ LR G   F  W  P V   +  + ++V N D  L +G K  V ++GPY Y E   K NIV + NGT+SY  +++Y F   LSVG E D     NIP +   ++ K      +L +  SI DI    PF++ SV  + WGY DP L+  K ++           GL YGKN T+     V+TG  ++  Y  I+++NG + L  W  D  N + GTDGS+F P ++    L+++  D+CR +   +    +    +P + +  P ++FA+   +PDN  FC  G   C   G+ N++ C   S PI++S PHF  AD      + G++P   ++++    ++P  G  L ++ ++QIN+A+  +  +  + N P ++ P++W  E +      +TD    A ++  ++ V + +G   LG + L++
Sbjct:   34 GIVVACEFTVLIDAVVDRMVALRPGAKTFGWWAKPPVEPRISLYIYNVTNADDFLSNGSKAIVDEVGPYVYSETWEKVNIVENDNGTLSYNLRKIYSFREDLSVGPEDDVVIVPNIPMLSATSQSKHAARFLRLAMA-SIMDILKIKPFVQVSVGQLLWGYEDPLLKLAKDVVPKEQKLPYEEFGLLYGKNGTSSDRVTVNTGVDDIRRYGIIDNFNGRTHLPHWTTDACNTLAGTDGSIFPPHIDHDRILHVYDKDLCRLLPLVFEKEVMTSNEVPGYRFTPPEWVFADVDSHPDNMCFCPAGKPSCSPNGLFNVSLCQYDS-PIMLSFPHFYLADESLRTQVEGISPPMKEKHQFFFDVQPKMGTTLRVRARIQINLAVSQVFDIKQVANFPDIIFPILWFEEGIDNLPDEVTDLMRFAEQVPPKIRVALIVGLCALGVILLLL 477          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Fly
Match: emp (gene:FBgn0010435 transcript:FBtr0343507)

HSP 1 Score: 221.476 bits (563), Expect = 7.556e-65
Identity = 134/446 (30.04%), Postives = 227/446 (50.90%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAIL-DGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKG-IPSFNYAAPSYLFANHTVNPDNKGFCLDG--YCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNP--SKEYKTILKLEPTTGLPLHIQKKLQINIALESITALG-LENLPSVLLPVMWLNESV-----LITD--DLARKIKNRLLVPVSIG--QLGALALMV 1413
            G+ +     V++   V +M+ LR G   F  W  P V   +  + ++V N D  L +G K  V ++GPY Y E   K NIV + NGT+SY  +++Y F   LSVG E D     NIP +   ++ K      +L +  SI DI    PF++ SV  + WGY DP L+  K ++           GL YGKN T+     V+TG  ++  Y  I+++NG + L  W  D  N + GTDGS+F P ++    L+++  D+CR +   +    +    +P + +  P ++FA+   +PDN  FC  G   C   G+ N++ C   S PI++S PHF  AD      + G++P   ++++    ++P  G  L ++ ++QIN+A+  +  +  + N P ++ P++W  E +      +TD    A ++  ++ V + +G   LG + L++
Sbjct:   34 GIVVACEFTVLIDAVVDRMVALRPGAKTFGWWAKPPVEPRISLYIYNVTNADDFLSNGSKAIVDEVGPYVYSETWEKVNIVENDNGTLSYNLRKIYSFREDLSVGPEDDVVIVPNIPMLSATSQSKHAARFLRLAMA-SIMDILKIKPFVQVSVGQLLWGYEDPLLKLAKDVVPKEQKLPYEEFGLLYGKNGTSSDRVTVNTGVDDIRRYGIIDNFNGRTHLPHWTTDACNTLAGTDGSIFPPHIDHDRILHVYDKDLCRLLPLVFEKEVMTSNEVPGYRFTPPEWVFADVDSHPDNMCFCPAGKPSCSPNGLFNVSLCQYDS-PIMLSFPHFYLADESLRTQVEGISPPMKEKHQFFFDVQPKMGTTLRVRARIQINLAVSQVFDIKQVANFPDIIFPILWFEEGIDNLPDEVTDLMRFAEQVPPKIRVALIVGLCALGVILLLL 477          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Fly
Match: emp (gene:FBgn0010435 transcript:FBtr0072401)

HSP 1 Score: 221.861 bits (564), Expect = 1.213e-64
Identity = 134/446 (30.04%), Postives = 227/446 (50.90%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAIL-DGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKG-IPSFNYAAPSYLFANHTVNPDNKGFCLDG--YCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNP--SKEYKTILKLEPTTGLPLHIQKKLQINIALESITALG-LENLPSVLLPVMWLNESV-----LITD--DLARKIKNRLLVPVSIG--QLGALALMV 1413
            G+ +     V++   V +M+ LR G   F  W  P V   +  + ++V N D  L +G K  V ++GPY Y E   K NIV + NGT+SY  +++Y F   LSVG E D     NIP +   ++ K      +L +  SI DI    PF++ SV  + WGY DP L+  K ++           GL YGKN T+     V+TG  ++  Y  I+++NG + L  W  D  N + GTDGS+F P ++    L+++  D+CR +   +    +    +P + +  P ++FA+   +PDN  FC  G   C   G+ N++ C   S PI++S PHF  AD      + G++P   ++++    ++P  G  L ++ ++QIN+A+  +  +  + N P ++ P++W  E +      +TD    A ++  ++ V + +G   LG + L++
Sbjct:   65 GIVVACEFTVLIDAVVDRMVALRPGAKTFGWWAKPPVEPRISLYIYNVTNADDFLSNGSKAIVDEVGPYVYSETWEKVNIVENDNGTLSYNLRKIYSFREDLSVGPEDDVVIVPNIPMLSATSQSKHAARFLRLAMA-SIMDILKIKPFVQVSVGQLLWGYEDPLLKLAKDVVPKEQKLPYEEFGLLYGKNGTSSDRVTVNTGVDDIRRYGIIDNFNGRTHLPHWTTDACNTLAGTDGSIFPPHIDHDRILHVYDKDLCRLLPLVFEKEVMTSNEVPGYRFTPPEWVFADVDSHPDNMCFCPAGKPSCSPNGLFNVSLCQYDS-PIMLSFPHFYLADESLRTQVEGISPPMKEKHQFFFDVQPKMGTTLRVRARIQINLAVSQVFDIKQVANFPDIIFPILWFEEGIDNLPDEVTDLMRFAEQVPPKIRVALIVGLCALGVILLLL 508          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Zebrafish
Match: CABZ01076275.1 (scavenger receptor class B, member 2b [Source:NCBI gene;Acc:564077])

HSP 1 Score: 297.36 bits (760), Expect = 1.101e-93
Identity = 170/447 (38.03%), Postives = 255/447 (57.05%), Query Frame = 1
Query:  115 FCFGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGD-KPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGYES-DTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLD-GYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITALGL-ENLPSVLLPVMWLNESVLITDDLARKIKNRLLV-------PVSIGQLGALALMVC 1416
            F  GLF       ++ ++++K + L  G+ +F  W+NP  P YM+F+FF+V NP+A L G+ K  + ++GPYTYREYR K+N+ F  NGT V+    +++ F P  SVG  S D  TT NIP + +  RIK    +    +   +K I     F+  +V  + WG+ DP L      L       +   GL   KN ++D  +   TG  N  +Y +I +W G   +S W  + +NM+NGTDGS F PFL K  RL +F +D+CR+IH  +     +KGIP++ +  P  + A+ T NP+N+GFCL    CL  GVL+++ C  G+ P+V+S PHF   D KY Q++ GL+P  E ++T L L PT G+P+   K+ QINI LE +T   +  NL S + P+++LNESV+I +  A +I+  LLV       P+ +  LG + L+V 
Sbjct:   26 FASGLF-----QTLIHNKLKKEITLTEGSKVFATWKNPPPPVYMEFFFFNVTNPEAFLKGEAKARLSEMGPYTYREYRPKHNVSFVDNGTKVAAYTPKVFVFVPEKSVGDPSVDMVTTVNIPAVAVMNRIKGAGFLVSSAMSLYMKSI-GAEMFMTHTVDELLWGFKDPLLTK----LRSIKPETDEFFGLMLHKNGSDDGEFVYHTGEHNYLDYGRIFTWKGEKLMSFWKTNQSNMINGTDGSAFHPFLTKEERLDVFTADLCRSIHMRFEKEVEVKGIPAYRFTPPRAVLASGTNNPENEGFCLTPKKCLDDGVLDVSVCRQGA-PVVVSFPHFHLGDEKYVQAVEGLSPVHEQHQTFLDLNPTMGVPVRAMKRAQINIHLERVTGFPMTRNLESTIFPIIFLNESVVIDNASAERIQKLLLVVTLVSHFPLILVALGVILLIVA 461          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Zebrafish
Match: CABZ01076275.1 (scavenger receptor class B, member 2b [Source:NCBI gene;Acc:564077])

HSP 1 Score: 297.745 bits (761), Expect = 1.374e-93
Identity = 170/447 (38.03%), Postives = 255/447 (57.05%), Query Frame = 1
Query:  115 FCFGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGD-KPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGYES-DTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLD-GYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITALGL-ENLPSVLLPVMWLNESVLITDDLARKIKNRLLV-------PVSIGQLGALALMVC 1416
            F  GLF       ++ ++++K + L  G+ +F  W+NP  P YM+F+FF+V NP+A L G+ K  + ++GPYTYREYR K+N+ F  NGT V+    +++ F P  SVG  S D  TT NIP + +  RIK    +    +   +K I     F+  +V  + WG+ DP L      L       +   GL   KN ++D  +   TG  N  +Y +I +W G   +S W  + +NM+NGTDGS F PFL K  RL +F +D+CR+IH  +     +KGIP++ +  P  + A+ T NP+N+GFCL    CL  GVL+++ C  G+ P+V+S PHF   D KY Q++ GL+P  E ++T L L PT G+P+   K+ QINI LE +T   +  NL S + P+++LNESV+I +  A +I+  LLV       P+ +  LG + L+V 
Sbjct:   26 FASGLF-----QTLIHNKLKKEITLTEGSKVFATWKNPPPPVYMEFFFFNVTNPEAFLKGEAKARLSEMGPYTYREYRPKHNVSFVDNGTKVAAYTPKVFVFVPEKSVGDPSVDMVTTVNIPAVAVMNRIKGAGFLVSSAMSLYMKSI-GAEMFMTHTVDELLWGFKDPLLTK----LRSIKPETDEFFGLMLHKNGSDDGEFVYHTGEHNYLDYGRIFTWKGEKLMSFWKTNQSNMINGTDGSAFHPFLTKEERLDVFTADLCRSIHMRFEKEVEVKGIPAYRFTPPRAVLASGTNNPENEGFCLTPKKCLDDGVLDVSVCRQGA-PVVVSFPHFHLGDEKYVQAVEGLSPVHEQHQTFLDLNPTMGVPVRAMKRAQINIHLERVTGFPMTRNLESTIFPIIFLNESVVIDNASAERIQKLLLVVTLVSHFPLILVALGVILLIVA 461          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Zebrafish
Match: scarb2a (scavenger receptor class B, member 2a [Source:ZFIN;Acc:ZDB-GENE-020419-29])

HSP 1 Score: 288.886 bits (738), Expect = 2.752e-90
Identity = 163/437 (37.30%), Postives = 251/437 (57.44%), Query Frame = 1
Query:  142 IIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDG-DKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQK-RLYFFEPSLSVGY-ESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNP-SKEYKTILKLEPTTGLPLHIQKKLQINIALESITAL-GLENLPSVLLPVMWLNESVLITDDLARKIKNRLLV-------PVSIGQLGALALMV 1413
            +   +++ +++K + L   + +   W NP  P YMQ++FF+V NPD  L G +K  V Q+GPYTYREYR + N+ +  NGT  +    + + F  ++S G  E D  TT NIP I +   +  Y    +  V   +  +     F+  +V  I WG+ DP L      L+      + + GL Y KN T++  +   TG  N  NY KI++WNG S+++ W+++ +NM+NGTDGS+F  FL++   LYIF +D+CR+IH  YV    +KGIP+F +A PS + A    NP N GFC+  G CLG GVL ++ C  G+ PIV+S PHF  AD +Y  +I G+NP  +E++T L + PTTG+P+   K+ Q+NI L+ +      + L   + P+M++NE+  I D+ A +++  LL+       PV I  LG + L+V
Sbjct:   30 VFQTMIQERIKKEITLAENSRVLDGWINPPPPVYMQYFFFNVTNPDEFLAGKEKAKVTQMGPYTYREYRPRENVTYLENGTKIFATNPKSFVFLRNMSAGDPEVDRVTTVNIPMIAVMNELNSYSFFVRTAVSMYMGSM-GMGLFMNRTVHEILWGFKDPLLTK----LHAMRPEVDEHFGLMYNKNGTHEGEFVFHTGEKNYMNYGKIDTWNGISQMNWWSSNQSNMINGTDGSVFHTFLSRKELLYIFAADLCRSIHLGYVRDMEVKGIPAFRFAPPSDVLAPPDENPANAGFCVPAGDCLGKGVLKVSVCRQGA-PIVVSFPHFYQADERYINAIEGMNPNEEEHETYLDINPTTGVPIRACKRAQLNIILKRVRGFPNTKFLNETIFPIMYVNETATIDDESAAQMRMLLLIVTVVSNFPVIILALGVILLVV 460          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Zebrafish
Match: scarb2a (scavenger receptor class B, member 2a [Source:ZFIN;Acc:ZDB-GENE-020419-29])

HSP 1 Score: 288.886 bits (738), Expect = 3.154e-90
Identity = 163/437 (37.30%), Postives = 251/437 (57.44%), Query Frame = 1
Query:  142 IIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDG-DKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQK-RLYFFEPSLSVGY-ESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNP-SKEYKTILKLEPTTGLPLHIQKKLQINIALESITAL-GLENLPSVLLPVMWLNESVLITDDLARKIKNRLLV-------PVSIGQLGALALMV 1413
            +   +++ +++K + L   + +   W NP  P YMQ++FF+V NPD  L G +K  V Q+GPYTYREYR + N+ +  NGT  +    + + F  ++S G  E D  TT NIP I +   +  Y    +  V   +  +     F+  +V  I WG+ DP L      L+      + + GL Y KN T++  +   TG  N  NY KI++WNG S+++ W+++ +NM+NGTDGS+F  FL++   LYIF +D+CR+IH  YV    +KGIP+F +A PS + A    NP N GFC+  G CLG GVL ++ C  G+ PIV+S PHF  AD +Y  +I G+NP  +E++T L + PTTG+P+   K+ Q+NI L+ +      + L   + P+M++NE+  I D+ A +++  LL+       PV I  LG + L+V
Sbjct:   30 VFQTMIQERIKKEITLAENSRVLDGWINPPPPVYMQYFFFNVTNPDEFLAGKEKAKVTQMGPYTYREYRPRENVTYLENGTKIFATNPKSFVFLRNMSAGDPEVDRVTTVNIPMIAVMNELNSYSFFVRTAVSMYMGSM-GMGLFMNRTVHEILWGFKDPLLTK----LHAMRPEVDEHFGLMYNKNGTHEGEFVFHTGEKNYMNYGKIDTWNGISQMNWWSSNQSNMINGTDGSVFHTFLSRKELLYIFAADLCRSIHLGYVRDMEVKGIPAFRFAPPSDVLAPPDENPANAGFCVPAGDCLGKGVLKVSVCRQGA-PIVVSFPHFYQADERYINAIEGMNPNEEEHETYLDINPTTGVPIRACKRAQLNIILKRVRGFPNTKFLNETIFPIMYVNETATIDDESAAQMRMLLLIVTVVSNFPVIILALGVILLVV 460          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Zebrafish
Match: cd36 (CD36 molecule (thrombospondin receptor) [Source:ZFIN;Acc:ZDB-GENE-040718-55])

HSP 1 Score: 264.618 bits (675), Expect = 1.064e-81
Identity = 161/442 (36.43%), Postives = 236/442 (53.39%), Query Frame = 1
Query:  142 IIPV---IVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAIL-DGDKPSVRQIGPYTYR-EYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIP----YIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGY----CLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPS-KEYKTILKLEPTTGLPLHIQKKLQINIALESITALGLEN--LPSVLLPVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCG 1419
            +IPV   I+++ V K   L NGTL F  W +  +  Y QFW F+V NPD +L +G KP + Q GPYTYR  Y  K NI F+ N TVS++      FEPS+SVG E D FT+ N+     Y ++G ++ D+      ++ +S       S F   +VK + WGY DP L  N L+            G FY  N T D  Y V TG  +++    IE W G + ++ WN+ Y + +NG+DGS F PFL+K   LY F  DICR+I A Y  +  +KGI  + Y  P    A+   NPDN  +C D      C  AG+L++T C     P+ +S PHF  A  +  Q ++G+NP+  E+   L +EP TG  L   K+LQ+N+       + L N      ++P++WLNE+ ++ D+ A+  KN L+  + + +   + L+V G
Sbjct:   27 LIPVGDMIIKNTVHKETVLENGTLAFDTWTSVDIAMYRQFWIFNVENPDKVLSEGSKPVLVQKGPYTYRVRYIPKTNITFNDNNTVSFVLPAGATFEPSMSVGSEEDVFTSLNLAVAGVYRLIGPKLADW------LIRSS-----GSSLFQNRTVKELLWGYKDPML--NSLV------------GAFYPYNGTVDGPYTVFTGKDDINKVAIIERWQGETSVNYWNDSYCDKINGSDGSSFHPFLDKKEPLYFFSPDICRSISAEYEATVNLKGIDVYRYLLPVDALASPVSNPDNMCYCTDHEITRNCTLAGLLDITSC--KGTPVFISLPHFLYASIELQQGVVGMNPNLDEHSIFLDVEPITGFTLRFSKRLQVNMMYGPSDDIALLNKIKEHTIIPILWLNETAVLDDETAKMFKNELISRMDMLEGLQIGLLVTG 441          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Xenopus
Match: scarb2 (scavenger receptor class B member 2 [Source:NCBI gene;Acc:549311])

HSP 1 Score: 304.294 bits (778), Expect = 1.766e-96
Identity = 167/410 (40.73%), Postives = 241/410 (58.78%), Query Frame = 1
Query:  154 IVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGY-ESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKEYK-TILKLEPTTGLPLHIQKKLQINIALESITALGL-ENLPSVLLPVMWLNESVLITDDLARKIKNRLL 1368
            IV  QV++ + L+N + +F+ W NP  P YMQF+FF+V NP  +L G+KP V +IGPYTYREYR + NI F  NGT VS +  + Y FEP  S+G  + D   T NIP + +    KD   + +L +  ++K  K    F+  +V  + WGY D  L     IL+ F        GLFY  N T+D  Y   +G  +   + +I  W G   L+ W  +  NM+NGTDG+ F P LNK   +Y+F SD+CR+I+A Y  S+ IK I  F ++ P+ +FAN +VNP NKGFC+ +G CL +G+LN++ C  G+ PIV+S PHF  AD     SI G+ P KE+  T L L P TG  +   K++Q+N+ +  I    + +++ ++  PVM LNESVLI D  A ++++ L 
Sbjct:   32 IVEGQVKQAIVLKNESEVFEDWANPPPPVYMQFYFFNVTNPLEVLSGEKPFVDEIGPYTYREYRPRENITFSVNGTEVSAVTPKTYVFEPEKSIGDPKVDLIRTVNIPLVTILEMTKD-SSLLRLFIIAALKTYKE-GMFVTRTVDELLWGYKDAVLS----ILHPFKKNISDTFGLFYKMNTTDDGEYIFLSGEKDYLEFTQIAEWKGQKALNWWTTETCNMINGTDGTSFHPLLNKDDTIYMFSSDLCRSIYAVYESSENIKDISVFRFSPPASVFANVSVNPQNKGFCVPEGNCLPSGLLNVSICKEGA-PIVLSSPHFYQADENVINSIRGMKPVKEHHMTFLDLNPLTGTLIQAAKRMQVNVYVRKINVYPITQDIQTLFFPVMHLNESVLIDDKSAGRLRSILF 434          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Xenopus
Match: scarb2 (scavenger receptor class B member 2 [Source:NCBI gene;Acc:549311])

HSP 1 Score: 288.115 bits (736), Expect = 2.821e-90
Identity = 165/423 (39.01%), Postives = 238/423 (56.26%), Query Frame = 1
Query:  112 MFCFGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGY-ESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKEYK-TILKLEPTTGLPLHIQKKLQINIALESITALGLENLPSVLLPVMWLNESVLITDDLARKIKNRLL 1368
            MF F     F++  +V   + + + L+N + +F+ W NP  P YMQF+FF+V NP  +L G+KP V +IGPYTYREYR + NI F  NGT VS +  + Y FEP  S+G  + D   T NIP + +    KD   + +L +  ++K  K    F+  +V  + WGY D  L     IL+ F        GLFY  N T+D  Y   +G  +   + +I  W G   L+ W  +  NM+NGTDG+ F P LNK   +Y+F SD+CR+I+A Y  S+ IK I  F ++ P+ +FAN +VNP NKGFC+ +G CL +G+LN++ C  G+ PIV+S PHF  AD     SI G+ P KE+  T L L P +          QI+    S+     +++ ++  PVM LNESVLI D  A ++++ L 
Sbjct:    1 MFFFKYIEIFMLHCLVFTNLFQAIVLKNESEVFEDWANPPPPVYMQFYFFNVTNPLEVLSGEKPFVDEIGPYTYREYRPRENITFSVNGTEVSAVTPKTYVFEPEKSIGDPKVDLIRTVNIPLVTILEMTKD-SSLLRLFIIAALKTYKE-GMFVTRTVDELLWGYKDAVLS----ILHPFKKNISDTFGLFYKMNTTDDGEYIFLSGEKDYLEFTQIAEWKGQKALNWWTTETCNMINGTDGTSFHPLLNKDDTIYMFSSDLCRSIYAVYESSENIKDISVFRFSPPASVFANVSVNPQNKGFCVPEGNCLPSGLLNVSICKEGA-PIVLSSPHFYQADENVINSIRGMKPVKEHHMTFLDLNPVS-----CSLSPQISCQPASLAVFITQDIQTLFFPVMHLNESVLIDDKSAGRLRSILF 411          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Xenopus
Match: scarb2 (scavenger receptor class B member 2 [Source:NCBI gene;Acc:549311])

HSP 1 Score: 284.648 bits (727), Expect = 3.311e-89
Identity = 165/423 (39.01%), Postives = 240/423 (56.74%), Query Frame = 1
Query:  112 MFCFGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGY-ESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKEYK-TILKLEPTTGLPLHIQKKLQINIALESITALGLENLPSVLLPVMWLNESVLITDDLARKIKNRLL 1368
            MF F     F++  +V   + + + L+N + +F+ W NP  P YMQF+FF+V NP  +L G+KP V +IGPYTYREYR + NI F  NGT VS +  + Y FEP  S+G  + D   T NIP + +    KD   + +L +  ++K  K    F+  +V  + WGY D  L     IL+ F        GLFY  N T+D  Y   +G  +   + +I  W G   L+ W  +  NM+NGTDG+ F P LNK   +Y+F SD+CR+I+A Y  S+ IK I  F ++ P+ +FAN +VNP NKGFC+ +G CL +G+LN++ C  G+ PIV+S PHF  AD     SI G+ P KE+  T L L P TG  +   K++Q+N+ +  I     +N    + P  +L +SVLI D  A ++++ L 
Sbjct:    1 MFFFKYIEIFMLHCLVFTNLFQAIVLKNESEVFEDWANPPPPVYMQFYFFNVTNPLEVLSGEKPFVDEIGPYTYREYRPRENITFSVNGTEVSAVTPKTYVFEPEKSIGDPKVDLIRTVNIPLVTILEMTKD-SSLLRLFIIAALKTYKE-GMFVTRTVDELLWGYKDAVLS----ILHPFKKNISDTFGLFYKMNTTDDGEYIFLSGEKDYLEFTQIAEWKGQKALNWWTTETCNMINGTDGTSFHPLLNKDDTIYMFSSDLCRSIYAVYESSENIKDISVFRFSPPASVFANVSVNPQNKGFCVPEGNCLPSGLLNVSICKEGA-PIVLSSPHFYQADENVINSIRGMKPVKEHHMTFLDLNPLTGTLIQAAKRMQVNVYVRKINVYP-QNGEYGMNP-FFLLQSVLIDDKSAGRLRSILF 414          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Xenopus
Match: znf652 (zinc finger protein 652 [Source:Xenbase;Acc:XB-GENE-1020912])

HSP 1 Score: 256.144 bits (653), Expect = 2.904e-78
Identity = 153/441 (34.69%), Postives = 230/441 (52.15%), Query Frame = 1
Query:  121 FGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYR-EYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFC----LDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINIALESITALG-LENLPSVLL-PVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCG 1419
             G  ++ +  +I+  ++     +  GT+ ++ W     P Y  FW + V NPD I++G KP ++Q GPYTYR  Y  K NI    N TVSY Q     F+   S G E DT+T  N+    +      +  +  L+  N+I    N S F   SVK + WGY DPFLE  K+ ++      +   GLFY  N T D +Y V  G  ++     I+ +  +  L  WN+D+ +M+NGTD + F P + K  RLY F S+ICR+I+  +    ++KGI  + +       A+ T NPDN  FC    L   C  AGVL+L  C  G  PI +S PHF  A      S+ GL P+K E++T + +EP TG  +H  K+LQ+N+ ++    +  +  L S L+ PV WLNE+ LI DD A   K+++  P+ + ++  + L+  G
Sbjct:   22 LGGILFPVGDMIINKEISTEAVIEEGTIAYENWIEAGSPVYRHFWIYHVTNPDEIINGGKPILQQKGPYTYRVRYLPKENITQLENNTVSYWQPNGAIFQREGSYGPEEDTYTVLNL---AVAAAPAMFPALQGLL--NAIIKSSNSSLFQVRSVKELLWGYRDPFLE--KIPIDSI----DKTTGLFYPNNGTADGIYHVYNGKGDISKVAIIDRYKEAKALPYWNDDFCDMINGTDAASFPPSVKKDKRLYFFSSEICRSIYGIFEKEYMVKGIKLYRFVVTEDAMASPTKNPDNHCFCKDFQLSRNCTAAGVLDLRSC-QGGKPIFLSLPHFLYASDYLLDSVSGLKPNKEEHETYIDVEPITGFTMHFAKRLQVNVMIQPTDKIEVMSKLQSELVFPVAWLNETALIGDDSANMFKSKVTTPMKVVEILRIVLLCVG 450          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Xenopus
Match: f12 (coagulation factor 12 (Hageman factor) [Source:Xenbase;Acc:XB-GENE-1004811])

HSP 1 Score: 250.366 bits (638), Expect = 3.073e-76
Identity = 131/357 (36.69%), Postives = 212/357 (59.38%), Query Frame = 1
Query:  208 FQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRI--KDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLE-ANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKEYKTI-LKLEPTTGLPLHIQKKLQINIALESITAL 1266
            ++ W++  VP YM  + F+V+N   +L G+KP +++ GPY YREY+ K NI F+ NGTVS+++ R + F+P  S G E D     NI  +VLG+ +  +D     K ++  +     N   FI  +VK+I WGY DPFL+  N  +     F+ +   G F   NN+N  V+ V+TG  ++     +++WNG  K+  WN++  NM+NGT G M+ PF   S  L  +  D CR++   Y   +  +GIP+F Y AP+YLFAN +  P N+GFC    C+ +GV N++ C   + P+ +S PHF +ADP + +S+ GL+P++E  ++ L + P TG+P++   K+Q+N+  +S++ +
Sbjct:   15 YEMWRDLPVPFYMSIYIFEVVNHKEVLLGEKPQLQERGPYVYREYKKKQNITFNENGTVSFVEFRTFHFDPEKSNGKEEDHVIVPNI--LVLGSSVMLQDLGIAIKWIISGAFSAF-NEEAFINKTVKDILWGYEDPFLDFLNTFLPGKLPFKGK--FGFFSDFNNSNTGVFTVNTGMEDISRVQMVDNWNGLKKVDFWNSEQTNMINGTAGQMWPPFRKPSEPLEFYSPDACRSMKLVYEKEEKFRGIPTFRYTAPNYLFANGSDYPPNEGFCP---CVASGVQNVSACRFNA-PLFLSFPHFYNADPGFLESVEGLHPTEELHSLFLDMHPLTGIPMNCSIKMQLNMLTKSVSGI 362          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Mouse
Match: Scarb2 (scavenger receptor class B, member 2 [Source:MGI Symbol;Acc:MGI:1196458])

HSP 1 Score: 285.034 bits (728), Expect = 2.352e-89
Identity = 159/410 (38.78%), Postives = 243/410 (59.27%), Query Frame = 1
Query:  157 VRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGYES-DTFTTANIPYIVLGTRIKDYKEINKL--MVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINI---ALESITALGLENLPSVLLPVMWLNESVLITDDLARKIKN 1359
            V   + K + L+NGT +F  W+ P +P Y+QF+FF+V NP+ IL G+ P + ++GPYTYRE R K NI F  NGT +S +  + Y FE + SVG  + D   T NIP +     + D  ++  L  ++E  +K  +    F+  +V  + WGY D  L     +++ F     PN GLFY +N TND  Y   TG  N  N+ KI  WNG + L  W  D  NM+NGTDG  F P ++K   LY+F SD+CR++H T+   + ++G+P+F Y  P+ + AN +   +N GFC+ +G C+ +GVLN++ C  G+ PI+MS PHF  AD K+  +I G++P+K E+++ + + P TG+ L   K+ QIN     L+     G  ++ +++ PVM+LNESVLI  + A ++K+
Sbjct:   33 VDQTIEKNMVLQNGTKVFNSWEKPPLPVYIQFYFFNVTNPEEILQGEIPLLEEVGPYTYRELRNKANIQFGENGTTISAVTNKAYVFERNQSVGDPNVDLIRTINIPLLT----VVDLAQLTLLRELIEAMLKAYQQ-KLFVIHTVHELLWGYKDEILS----LVHIFKPDVSPNFGLFYERNGTNDGEYVFLTGEDNYLNFSKIVEWNGKTSLDWWTTDTCNMINGTDGDSFHPLISKDEVLYLFPSDLCRSVHITFSSFENVEGLPAFRYKVPAEILANTS---ENAGFCIPEGNCMDSGVLNISICKNGA-PIIMSFPHFYQADEKFVSAIKGMHPNKEEHESFVDINPLTGIILRGAKRFQINTYVRKLDDFVETG--DIRTMVFPVMYLNESVLIDKETANQLKS 427          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Mouse
Match: Scarb1 (scavenger receptor class B, member 1 [Source:MGI Symbol;Acc:MGI:893578])

HSP 1 Score: 278.485 bits (711), Expect = 1.728e-86
Identity = 146/397 (36.78%), Postives = 236/397 (59.45%), Query Frame = 1
Query:  139 FIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEIN-KLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPS-KEYKTILKLEPTTGLPLHIQKKLQINIALESITALGLE-NLPSVLLPVMWLNES 1320
             ++P +++ QV K + +   +L F  W+   VP Y+  +FF+V+NP+ +L+G KP VR+ GPY YRE+R K NI F+ N TVS+++ R   F+P  S G ESD     NI  ++ G+ + + K ++ KLM+  ++  +   + F+  +V  I WGY DPF+      L D     +   GLF G NN+N  V+ V TG  N      ++ WNG SK+  W+++  NM+NGT G M+ PF+   S L  F  + CR++  TY  S V +GIP++ + AP  LFAN +V P N+GFC    C  +G+ N++ C  G+ P+ +S PHF +ADP   ++++GLNP+ KE+   L + P TG+P++   K+Q+++ ++S+  +G    +  V+LP++W  +S
Sbjct:   30 LMVPSLIKQQVLKNVRIDPSSLSFGMWKEIPVPFYLSVYFFEVVNPNEVLNGQKPVVRERGPYVYREFRQKVNITFNDNDTVSFVENRSLHFQPDKSHGSESDYIVLPNI-LVLGGSILMESKPVSLKLMMTLALVTMGQRA-FMNRTVGEILWGYDDPFVHFLNTYLPDM-LPIKGKFGLFVGMNNSNSGVFTVFTGVQNFSRIHLVDKWNGLSKIDYWHSEQCNMINGTSGQMWAPFMTPESSLEFFSPEACRSMKLTYNESRVFEGIPTYRFTAPDTLFANGSVYPPNEGFCP---CRESGIQNVSTCRFGA-PLFLSHPHFYNADPVLSEAVLGLNPNPKEHSLFLDIHPVTGIPMNCSVKMQLSLYIKSVKGIGQTGKIEPVVLPLLWFEQS 419          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Mouse
Match: Scarb1 (scavenger receptor class B, member 1 [Source:MGI Symbol;Acc:MGI:893578])

HSP 1 Score: 278.485 bits (711), Expect = 2.367e-86
Identity = 146/397 (36.78%), Postives = 236/397 (59.45%), Query Frame = 1
Query:  139 FIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEIN-KLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPS-KEYKTILKLEPTTGLPLHIQKKLQINIALESITALGLE-NLPSVLLPVMWLNES 1320
             ++P +++ QV K + +   +L F  W+   VP Y+  +FF+V+NP+ +L+G KP VR+ GPY YRE+R K NI F+ N TVS+++ R   F+P  S G ESD     NI  ++ G+ + + K ++ KLM+  ++  +   + F+  +V  I WGY DPF+      L D     +   GLF G NN+N  V+ V TG  N      ++ WNG SK+  W+++  NM+NGT G M+ PF+   S L  F  + CR++  TY  S V +GIP++ + AP  LFAN +V P N+GFC    C  +G+ N++ C  G+ P+ +S PHF +ADP   ++++GLNP+ KE+   L + P TG+P++   K+Q+++ ++S+  +G    +  V+LP++W  +S
Sbjct:   30 LMVPSLIKQQVLKNVRIDPSSLSFGMWKEIPVPFYLSVYFFEVVNPNEVLNGQKPVVRERGPYVYREFRQKVNITFNDNDTVSFVENRSLHFQPDKSHGSESDYIVLPNI-LVLGGSILMESKPVSLKLMMTLALVTMGQRA-FMNRTVGEILWGYDDPFVHFLNTYLPDM-LPIKGKFGLFVGMNNSNSGVFTVFTGVQNFSRIHLVDKWNGLSKIDYWHSEQCNMINGTSGQMWAPFMTPESSLEFFSPEACRSMKLTYNESRVFEGIPTYRFTAPDTLFANGSVYPPNEGFCP---CRESGIQNVSTCRFGA-PLFLSHPHFYNADPVLSEAVLGLNPNPKEHSLFLDIHPVTGIPMNCSVKMQLSLYIKSVKGIGQTGKIEPVVLPLLWFEQS 419          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Mouse
Match: Cd36 (CD36 molecule [Source:MGI Symbol;Acc:MGI:107899])

HSP 1 Score: 258.07 bits (658), Expect = 5.008e-79
Identity = 163/444 (36.71%), Postives = 238/444 (53.60%), Query Frame = 1
Query:  121 FGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAIL-DGDKPSVRQIGPYTYR-EYRIKYNIVFD-ANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDV-IKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGY----CLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINIALESITAL-GLENLPS-VLLPVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCG 1419
            FG  +  +  +++   +++ + L  GT  F+ W       Y QFW FDV NPD +  +  K  V+Q GPYTYR  Y  K NI  D  + TVS++Q     FEPSLSVG E D FT  N+    +      Y+     +V NS+      S F   S+K + WGY DPFL           +     +G+FY  N+T D VYKV  G  N+     IES+ G   LS W + Y +M+NGTD + F PF+ KS  L  F SDICR+I+A + GS++ +KGIP + +  P+  FA+   NPDN  FC +      C   GVL++ KC  G  P+ +S PHF  A P   + I GL+P++ E++T L +EP TG  L   K+LQ+NI ++    +  L+NL    ++P++WLNE+  I D+ A   K ++   + +  +  +AL+  G
Sbjct:   22 FGGILMPVGDMLIEKTIKREVVLEEGTTAFKNWVKTGTTVYRQFWIFDVQNPDDVAKNSSKIKVKQRGPYTYRVRYLAKENITQDPEDHTVSFVQPNGAIFEPSLSVGTEDDNFTVLNL---AVAAAPHIYQNSFVQVVLNSLIKKSKSSMFQTRSLKELLWGYKDPFLSL-------VPYPISTTVGVFYPYNDTVDGVYKVFNGKDNISKVAIIESYKGKRNLSYWPS-YCDMINGTDAASFPPFVEKSRTLRFFSSDICRSIYAVF-GSEIDLKGIPVYRFVLPANAFASPLQNPDNHCFCTEKVISNNCTSYGVLDIGKCKEGK-PVYISLPHFLHASPDVSEPIEGLHPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETGTIGDEKAEMFKTQVTGKIKLLGMVEMALLGIG 452          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Mouse
Match: Cd36 (CD36 molecule [Source:MGI Symbol;Acc:MGI:107899])

HSP 1 Score: 258.07 bits (658), Expect = 5.008e-79
Identity = 163/444 (36.71%), Postives = 238/444 (53.60%), Query Frame = 1
Query:  121 FGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAIL-DGDKPSVRQIGPYTYR-EYRIKYNIVFD-ANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDV-IKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGY----CLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINIALESITAL-GLENLPS-VLLPVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCG 1419
            FG  +  +  +++   +++ + L  GT  F+ W       Y QFW FDV NPD +  +  K  V+Q GPYTYR  Y  K NI  D  + TVS++Q     FEPSLSVG E D FT  N+    +      Y+     +V NS+      S F   S+K + WGY DPFL           +     +G+FY  N+T D VYKV  G  N+     IES+ G   LS W + Y +M+NGTD + F PF+ KS  L  F SDICR+I+A + GS++ +KGIP + +  P+  FA+   NPDN  FC +      C   GVL++ KC  G  P+ +S PHF  A P   + I GL+P++ E++T L +EP TG  L   K+LQ+NI ++    +  L+NL    ++P++WLNE+  I D+ A   K ++   + +  +  +AL+  G
Sbjct:   22 FGGILMPVGDMLIEKTIKREVVLEEGTTAFKNWVKTGTTVYRQFWIFDVQNPDDVAKNSSKIKVKQRGPYTYRVRYLAKENITQDPEDHTVSFVQPNGAIFEPSLSVGTEDDNFTVLNL---AVAAAPHIYQNSFVQVVLNSLIKKSKSSMFQTRSLKELLWGYKDPFLSL-------VPYPISTTVGVFYPYNDTVDGVYKVFNGKDNISKVAIIESYKGKRNLSYWPS-YCDMINGTDAASFPPFVEKSRTLRFFSSDICRSIYAVF-GSEIDLKGIPVYRFVLPANAFASPLQNPDNHCFCTEKVISNNCTSYGVLDIGKCKEGK-PVYISLPHFLHASPDVSEPIEGLHPNEDEHRTYLDVEPITGFTLQFAKRLQVNILVKPARKIEALKNLKRPYIVPILWLNETGTIGDEKAEMFKTQVTGKIKLLGMVEMALLGIG 452          
BLAST of Scavenger receptor class B member 1 vs. UniProt/SwissProt
Match: sp|P27615|SCRB2_RAT (Lysosome membrane protein 2 OS=Rattus norvegicus OX=10116 GN=Scarb2 PE=1 SV=2)

HSP 1 Score: 286.96 bits (733), Expect = 3.625e-89
Identity = 157/408 (38.48%), Postives = 242/408 (59.31%), Query Frame = 1
Query:  157 VRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGYES-DTFTTANIPYIVLGTRIKD--YKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINIALESITA-LGLENLPSVLLPVMWLNESVLITDDLARKIKN 1359
            V   + K + L+NGT +F  W+ P +P Y+QF+FF+V NP+ IL G+ P + ++GPYTYRE R K N+ F  NGT +S +  + Y FE + SVG  + D   T NIP + +    +    +EI + M++   + +     F+  +V  + WGY D  L     +++ F     PN GLFY +N TND  Y   TG  N  N+ KI  WNG + L  W  D  NM+NGTDG  F P ++K   LYIF SD CR+++ T+   + ++G+P+F Y  P+ + AN +   +N GFC+ +G C+ AGVLN++ C  G+ PI+MS PHF  AD K+  +I G+ P+K E+++ + + P TG+ L   K+ QIN  ++ +   +   N+ +++ PVM+LNESVLI  + A ++K+
Sbjct:   33 VDQTIEKNMVLQNGTKVFDSWEKPPLPVYIQFYFFNVTNPEEILQGEIPLLEEVGPYTYRELRNKANVQFGENGTTISAVTNKAYIFERNQSVGDPTVDLIRTINIPLLTVVEMAQQPFLREIIEAMLKAYQQTL-----FVTHTVHELLWGYKDEVLS----LVHIFRPDVSPNFGLFYERNGTNDGEYVFLTGEDNYLNFTKIVEWNGKTSLDWWTTDTCNMINGTDGDSFHPLISKDETLYIFPSDFCRSVYITFSSFENVEGLPAFRYKVPAEILANSS---ENAGFCIPEGNCMDAGVLNVSICKNGA-PIIMSFPHFYQADEKFVSAIKGMRPNKEEHESFVDINPLTGIILRGAKRFQINTYVKKLDDFVETGNIRTMVFPVMYLNESVLIDKETASQLKS 427          
BLAST of Scavenger receptor class B member 1 vs. UniProt/SwissProt
Match: sp|Q14108|SCRB2_HUMAN (Lysosome membrane protein 2 OS=Homo sapiens OX=9606 GN=SCARB2 PE=1 SV=2)

HSP 1 Score: 285.419 bits (729), Expect = 1.543e-88
Identity = 158/410 (38.54%), Postives = 242/410 (59.02%), Query Frame = 1
Query:  157 VRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGY-ESDTFTTANIPY--IVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITA-LGLENLPSVLLPVMWLNESVLITDDLARKIKNRL 1365
            V   + K + LRNGT  F  W+ P +P Y QF+FF+V NP+ IL G+ P V ++GPYTYRE R K NI F  NGT +S +  + Y FE   SVG  + D   T NIP   ++  +++   +EI + M++   + +     F+  +V  + WGY D  L     +++ F     P  GLFY KN TND  Y   TG  +  N+ KI  WNG + L  W  D  NM+NGTDG  F P + K   LY+F SD CR+++ T+   + ++G+P+F Y  P+ + AN +   DN GFC+ +G CLG+GVLN++ C  G+ PI+MS PHF  AD ++  +I G++P++E ++T + + P TG+ L   K+ QINI ++ +   +   ++ +++ PVM+LNESV I  + A ++K+ +
Sbjct:   33 VDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEEILRGETPRVEEVGPYTYRELRNKANIQFGDNGTTISAVSNKAYVFERDQSVGDPKIDLIRTLNIPVLTVIEWSQVHFLREIIEAMLKAYQQKL-----FVTHTVDELLWGYKDEILS----LIHVFRPDISPYFGLFYEKNGTNDGDYVFLTGEDSYLNFTKIVEWNGKTSLDWWITDKCNMINGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTS---DNAGFCIPEGNCLGSGVLNVSICKNGA-PIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMI 429          
BLAST of Scavenger receptor class B member 1 vs. UniProt/SwissProt
Match: sp|O35114|SCRB2_MOUSE (Lysosome membrane protein 2 OS=Mus musculus OX=10090 GN=Scarb2 PE=1 SV=3)

HSP 1 Score: 285.034 bits (728), Expect = 1.645e-88
Identity = 159/410 (38.78%), Postives = 243/410 (59.27%), Query Frame = 1
Query:  157 VRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGYES-DTFTTANIPYIVLGTRIKDYKEINKL--MVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINI---ALESITALGLENLPSVLLPVMWLNESVLITDDLARKIKN 1359
            V   + K + L+NGT +F  W+ P +P Y+QF+FF+V NP+ IL G+ P + ++GPYTYRE R K NI F  NGT +S +  + Y FE + SVG  + D   T NIP +     + D  ++  L  ++E  +K  +    F+  +V  + WGY D  L     +++ F     PN GLFY +N TND  Y   TG  N  N+ KI  WNG + L  W  D  NM+NGTDG  F P ++K   LY+F SD+CR++H T+   + ++G+P+F Y  P+ + AN +   +N GFC+ +G C+ +GVLN++ C  G+ PI+MS PHF  AD K+  +I G++P+K E+++ + + P TG+ L   K+ QIN     L+     G  ++ +++ PVM+LNESVLI  + A ++K+
Sbjct:   33 VDQTIEKNMVLQNGTKVFNSWEKPPLPVYIQFYFFNVTNPEEILQGEIPLLEEVGPYTYRELRNKANIQFGENGTTISAVTNKAYVFERNQSVGDPNVDLIRTINIPLLT----VVDLAQLTLLRELIEAMLKAYQQ-KLFVIHTVHELLWGYKDEILS----LVHIFKPDVSPNFGLFYERNGTNDGEYVFLTGEDNYLNFSKIVEWNGKTSLDWWTTDTCNMINGTDGDSFHPLISKDEVLYLFPSDLCRSVHITFSSFENVEGLPAFRYKVPAEILANTS---ENAGFCIPEGNCMDSGVLNISICKNGA-PIIMSFPHFYQADEKFVSAIKGMHPNKEEHESFVDINPLTGIILRGAKRFQINTYVRKLDDFVETG--DIRTMVFPVMYLNESVLIDKETANQLKS 427          
BLAST of Scavenger receptor class B member 1 vs. UniProt/SwissProt
Match: sp|Q8SQC1|SCRB1_PIG (Scavenger receptor class B member 1 OS=Sus scrofa OX=9823 GN=SCARB1 PE=2 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 3.299e-86
Identity = 149/437 (34.10%), Postives = 244/437 (55.84%), Query Frame = 1
Query:  118 CFGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLE-ANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNP-SKEYKTILKLEPTTGLPLHIQKKLQINIALESITALGLE-NLPSVLLPVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCG 1419
              G  +  ++P I++ QV K + +   +L F  W+   VP Y+  +FFDV+NP+ IL G KP VR+ GPY YRE+R K NI F+ N TVS+L+ R Y F+P  S G ESD     NI  +     ++D     KL++  +   +   + F+  +V  I WGY DP +   NK   N F F+ +   GLF   NN++  ++ V TG  +      ++ WNG SK++ W++D  NM+NGT G M+ PF+   S L  +  + CR++   Y    V +GIP+F + AP+ LFAN +V P N+GFC    C+ +G+ N++ C   + P+ +S PHF +ADP   +++ GL+P ++E+   L + P TG+P++   KLQ+++ ++S+  +G    +  V+LP++W  ES  +  +  +    +L++   +       L+  G
Sbjct:   23 ALGAVMIVMVPSIIKQQVLKNVRIDPSSLSFNMWKEIPVPFYLSVYFFDVINPNEILQGQKPQVRERGPYVYREFRHKSNITFNDNDTVSFLEYRSYQFQPHKSRGLESDYIVIPNILVLSASVMMEDRPMSLKLIMTFAFSALGERA-FVNRTVGEIMWGYEDPLIHLINKYFPNMFPFKGK--FGLFAELNNSDSGLFTVFTGVKDFSRIHLVDKWNGLSKVNFWHSDQCNMINGTSGQMWAPFMTPESSLEFYSPEACRSMKLIYKEQGVFEGIPTFRFVAPNTLFANGSVYPPNEGFCP---CMESGIQNVSTCRFNA-PLFLSHPHFYNADPVLAEAVSGLHPNTEEHSLFLDIHPVTGIPMNCSVKLQLSLYIKSVKGIGQTGKIEPVVLPLLWFAESGAMEGETLQTFYTQLVLMPKVLHYAQYVLLALG 452          
BLAST of Scavenger receptor class B member 1 vs. UniProt/SwissProt
Match: sp|P97943|SCRB1_RAT (Scavenger receptor class B member 1 OS=Rattus norvegicus OX=10116 GN=Scarb1 PE=1 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.049e-85
Identity = 144/406 (35.47%), Postives = 235/406 (57.88%), Query Frame = 1
Query:  118 CFGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPS-KEYKTILKLEPTTGLPLHIQKKLQINIALESITALGLE-NLPSVLLPVMWLNESVLI 1329
              G+ +  ++P +++ QV K + +   +L F  W+   VP Y+  +FF+V+NP  +L+G KP VR+ GPY YRE+R K NI F+ N TVSY++ R   F+P  S G ESD     NI  +     ++D     KL++   +  +   + F+  +V  I WGY DPF+        D  F  +   GLF G N+++  V+ V TG  N      ++ WNG S+++ W+++  NM+NGT G M+ PF+   S L  F  + CR++  TY  S V +GIP++ + AP  LFAN +V P N+GFC    C  +G+ N++ C  G+ P+ +SQPHF +ADP   ++++GLNP  KE+   L + P TG+P++   K+Q+++ ++S+  +G    +  V+LP++W  +S ++
Sbjct:   23 ALGVIMILMVPSLIKQQVLKNVRIDPSSLSFGMWKEIPVPFYLSVYFFEVVNPSEVLNGQKPVVRERGPYVYREFRQKVNITFNDNDTVSYIENRSLRFQPDRSQGSESDYIVLPNILVLGGAVMMEDKPTSLKLLMTLGLVTMGQRA-FMNRTVGEILWGYEDPFVNFLSKYFPDM-FPIKGKFGLFVGMNDSSSGVFTVFTGVQNFSKIHLVDKWNGLSEVNYWHSEQCNMINGTAGQMWAPFMTPESSLEFFSPEACRSMKLTYQESRVFEGIPTYRFTAPDTLFANGSVYPPNEGFCP---CRESGIQNVSTCRFGA-PLFLSQPHFYNADPVLSEAVLGLNPDPKEHSLFLDIHPVTGIPMNCSVKMQLSLYIKSVKGVGQTGKIEPVVLPLLWFEQSGMM 422          
BLAST of Scavenger receptor class B member 1 vs. TrEMBL
Match: A0A267H4W3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007933g1 PE=3 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 2.800e-110
Identity = 178/444 (40.09%), Postives = 265/444 (59.68%), Query Frame = 1
Query:  112 MFCFGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPT--VPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKEYKTILKLEPTTGLPLHIQKKLQINIALESITALGL---ENLPSVLLPVMWLNESVLITDDLARKIKNRLLVPVSIG---QLGALAL-MVC 1416
            + C  + +    PV+ R+ +  MLP+ NG++ +  W++P+   P YMQFW F++ N    L+G KP+V QIGP+TY E R K NI   +N T++Y + R + F P LS   E    + AN+ Y  L   ++    I +L+ ++  K   N  P +  SVK I WGY DP L+    I     ++  P IGLFYGKN ++D  Y + TG  ++ +   ++ W  ++ LS W++  +NM+NGTDG+MF PF++   RLYI+ +DICR+I+ TY G   ++GI    + AP+ +F N T+NP+N+GFC+ G CL +GVLNLT C PG P +  SQPHF  A   Y  S+IGL PS +  T+L +EP TGL +   KKLQIN+AL  +T  G    +++  V +P+MW+NES  I  D A + +  +L+ V      Q G+LA+ +VC
Sbjct:   46 LICLSITVAVAFPVVFRNLIATMLPIANGSVTYSTWESPSDSTPIYMQFWLFNLTNGVEFLNGAKPAVEQIGPFTYEEQRNKGNITAYSNSTIAYKEYRSFHFRPDLSCCPEETELSIANLAYFTLTNMLRYSSSILQLLADDLFKSTHN-PPVMHRSVKEILWGYDDPTLKFGAEIAKIVKYKINPTIGLFYGKNGSDDGEYLIFTGQSDVSHLALVDRWQFNTSLSNWDSKSSNMLNGTDGTMFPPFVDPKKRLYIYSTDICRSIYVTYAGPTSVRGIDLLRFTAPAEVFYNSTLNPENQGFCVGGVCLDSGVLNLTTCQPGVPALA-SQPHFYQAAQHYIDSVIGLQPSPDCSTVLDVEPNTGLVMRAAKKLQINLAL--VTGPGFHMSKSMKPVFMPIMWVNESATIGSDSADQFRGSVLLVVKAAAAVQWGSLAVGLVC 485          
BLAST of Scavenger receptor class B member 1 vs. TrEMBL
Match: A0A3B4BK39 (Scavenger receptor class B, member 2c OS=Pygocentrus nattereri OX=42514 PE=3 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 9.357e-109
Identity = 172/412 (41.75%), Postives = 258/412 (62.62%), Query Frame = 1
Query:  166 QVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLI---LNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITALG-LENLPSVLLPVMWLNESVLITDDLARKIKNRLLVPVSI 1383
            ++   + L NGT  F  WQ+P  P YMQF+FF++ NP+ +L G++P+V ++GPYTYREYR   ++ F  NGT V+ +  + Y FEP++S G E D   T NIP +V+  R KD+  I++++  + +      + F+   V  + WGY DP L+   LI   L+D+        GLFY  N TND  Y   TG  N  ++ +++ W G S L+ W++D  NM+NGT+G+ F P + K+ RLY+F SD+CR+++AT+     + GIP++ +  PS +FAN TVNPDN GFC+ G CLG+G+LN++ C  G+ PI+MS PHF  AD  Y Q + G+ P KE ++T + + P TGL L   K+LQ+N+ +E +      EN+ +++ PVM+LNESVLI  D ARK+ + LL   S+
Sbjct:   37 RIETEMVLENGTEAFAVWQDPPAPVYMQFYFFNLTNPEEMLKGERPAVTEVGPYTYREYRPMESVTFTDNGTKVAAVNPKTYVFEPNMSRGLEDDLIRTVNIPAMVVMERFKDHSFISRII--SDLMTAGGMTLFVTRPVAELLWGYEDPLLKELHLIDPLLDDY-------FGLFYKMNGTNDGEYVFLTGKQNYQDFARVDLWKGQSSLNWWSSDECNMINGTNGASFHPVITKTERLYMFSSDLCRSLYATFDSEVRVSGIPAYRFVPPSEVFANMTVNPDNAGFCVGGNCLGSGLLNVSVCKEGA-PIIMSSPHFYQADENYVQDVFGMRPKKEDHQTAIDINPLTGLVLRAAKRLQVNVFVEKLPVFSQTENVKTLVFPVMYLNESVLIDPDSARKL-SALLAKASV 437          
BLAST of Scavenger receptor class B member 1 vs. TrEMBL
Match: A0A267E010 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005065g1 PE=3 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 1.610e-108
Identity = 176/444 (39.64%), Postives = 264/444 (59.46%), Query Frame = 1
Query:  112 MFCFGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPT--VPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKEYKTILKLEPTTGLPLHIQKKLQINIALESITALGL---ENLPSVLLPVMWLNESVLITDDLARKIKNR---LLVPVSIGQLGALAL-MVC 1416
            + C  + +    PV+ R+ +  MLP+ NG++ +  W++P+   P YMQFW F++ N    L+G KP+V QIGP+TY E R K NI   +N T++Y + R + F P LS   E    + AN+ Y  L   ++    + +L+ ++  K   N  P +  SVK I WGY DP L+    I    G++  P IGLFYGKN ++D  Y + TG  ++ +   ++ W  ++ LS W++  +NM+NGTDG+MF PF++   RLYI+ +DICR+I+ TY G   ++GI    + AP+ +F N T+NP+N+GFC+ G CL +GVLNLT C PG P +  SQPHF  A   Y  S+IGL PS +  T+L +EP TGL +   KKLQIN+AL  +T  G    +++  V +P+MW+NES  I  D A + +      +   +  Q G+LA+ +VC
Sbjct:   45 LICLSITVAVAFPVVFRNLIATMLPIANGSVTYSTWESPSDSTPIYMQFWLFNLTNGVEFLNGAKPAVEQIGPFTYEEQRNKGNITAYSNSTIAYKEYRSFHFRPDLSCCPEETELSIANLAYFTLTNMLRYSSSVLQLLADDLFKSTHN-PPVMHRSVKEILWGYDDPTLKFGADIAKIVGYKINPTIGLFYGKNGSDDGEYLIFTGQSDVGHLALVDRWQFNTSLSNWDSKSSNMLNGTDGTMFPPFVDPKKRLYIYSTDICRSIYVTYAGPTSVRGIDLLRFTAPAEVFYNSTLNPENQGFCVGGICLDSGVLNLTTCQPGVPALA-SQPHFYQAAQHYIDSVIGLQPSPDCATVLDVEPNTGLVMRAAKKLQINLAL--VTGPGFHMSKSMKPVFMPIMWVNESATIGSDSADQFRGSVLLAVKAAAAVQWGSLAVGLVC 484          
BLAST of Scavenger receptor class B member 1 vs. TrEMBL
Match: A0A3Q2CKP0 (Scavenger receptor class B, member 2c OS=Cyprinodon variegatus OX=28743 PE=3 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 2.355e-105
Identity = 171/415 (41.20%), Postives = 261/415 (62.89%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINIALESITAL-GLENLPSVLLPVMWLNESVLITDDLARKIK 1356
             L +  + P +++  V+  + LRNGT  F+ W +P  P YMQF+FF++ NP+ +L G++P+V +IGPYTYRE+R    +VF +NGT V+ +  + YFFE ++S G ESD   T NIP + +  R KD K    L+    +   +    F   +V  + WGY D  L+A K++  +     + N GLFY  N ++D  Y   TG  N  ++ ++++WNG S L  W +D  NM+NGT+G+ F P ++K+  LY+F SD+CR+++A Y    ++KGIP + +A P  +FAN TVNP N GFC+  G CLG+G+LN++ C  G+ PI+MS PHF  AD K+ + + G+ P K E++T + + P TG+ L   K+LQIN+ +E I      EN+P+V+LPV++LNESVLI D  A+K++
Sbjct:   24 ALVLSNVFPNLMQSLVKTEVVLRNGTDAFEAWLDPPAPVYMQFYFFNLTNPEEVLKGERPAVMEIGPYTYREHRPMEEVVFGSNGTRVAAVNPKTYFFERNMSRGPESDLIRTVNIPAMTVMERFKDNKVAANLISAYMLS--QEIGLFTTHTVGELLWGYEDGLLKALKVVDPNL----DDNFGLFYKNNGSDDGEYLFFTGQQNYKDFARVDTWNGKSSLDWWTSDECNMINGTNGASFHPIISKNEVLYMFSSDLCRSLYAVYTDDVIVKGIPGYRFAPPFEVFANLTVNPANTGFCVPAGNCLGSGLLNVSMCKQGA-PIIMSSPHFYQADEKFVKDVFGMRPKKEEHQTAIDINPLTGIILQAAKRLQINVYVEKIPDFRQAENVPTVILPVVYLNESVLIDDASAKKLQ 431          
BLAST of Scavenger receptor class B member 1 vs. TrEMBL
Match: A0A3Q9D440 (Scavenger receptor class B, member 2b OS=Ctenopharyngodon idella OX=7959 GN=scarb2b PE=2 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 7.059e-105
Identity = 176/410 (42.93%), Postives = 256/410 (62.44%), Query Frame = 1
Query:  154 IVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDY---KEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLI--LNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINIALESITALG-LENLPSVLLPVMWLNESVLITDDLARKIK 1356
            ++ +++++ + L NGT  F  WQNP  P YMQF+FF++ NP  +L+GDKPSV +IGPYTYREYR K ++ F  NGT V  +  + Y FEP +S G E D   T NIP + +  + KD    + I+ LM   S+   K +       V ++ WGY DP L+  K+   L D  F      GLFY KN T+D  Y   TG  N  ++ +I  WNG S L+ W++D  NM+NGTDG+ F P + K+ +LYIF SD+CR+++A Y     ++G+P F +  PS +FAN TVNPDN GFC+  G CLG+G+LN + C  G+ PI+MS PHF  AD K+ Q + G+NP K E++T++ + P TGL L   K++Q+N+ L  I A      + +++ PVM+LNESV+I ++ A+K++
Sbjct:   34 LLNNRIKEQVVLENGTEAFSVWQNPPPPVYMQFYFFNLTNPAEVLNGDKPSVIEIGPYTYREYRPKEDVKFMDNGTRVQAVNPKTYVFEPDMSRGSEDDLVRTVNIPAVTVMEKFKDSILSRVISDLMKSMSVGVFKTFR------VGDLLWGYEDPLLKKLKVFDPLLDIYF------GLFYKKNGTDDGDYVFFTGKQNYQDFARINEWNGQSSLNWWSSDECNMINGTDGASFHPIVTKTEKLYIFSSDLCRSLYALYESDVNVQGVPGFRFVPPSEVFANVTVNPDNAGFCVPAGNCLGSGLLNASVCKEGA-PIIMSSPHFYQADDKFVQDVFGMNPKKEEHETVIDINPLTGLLLRGAKRVQVNVYLHQIPAFSETGKIRTLVFPVMYLNESVVIDEESAKKLQ 430          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Cavefish
Match: scarb2c (lysosome membrane protein 2-like [Source:NCBI gene;Acc:103028570])

HSP 1 Score: 326.25 bits (835), Expect = 2.506e-105
Identity = 166/416 (39.90%), Postives = 255/416 (61.30%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIK---NYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINIALESITALGLE-NLPSVLLPVMWLNESVLITDDLARKI 1353
             L +  + P  + ++++  + L NGT  +  WQ+P  P YMQF+FF++ NP  +L G++P+V ++GPYTYREYR   N+ F  NGT V+ +  + Y FEP++S G E D   T NIP + +    KD       M   +I D+    N   F+  +V  + WGY D  L+  K +        +P  GLFY  N T+D  Y   TG  +  ++ +I+ W G+S L  WN    NM+NGT+G+ F P ++K+ RLY+F SD+CR+I+AT+     + GIP++ +  PS +FAN TVNPDN GFC+  YCL +G+LN++ C  G+ PI+MS PHF  AD  + Q +IG++P+K E++T + + P TG+ +   K+LQ+N+ +E ++A  L  N+ +++ PVM+LNESVLI  D A+K+
Sbjct:   23 ALVLSHVFPTALNNRIKNEVVLENGTEAYAVWQDPPAPVYMQFYFFNLTNPGEMLKGERPAVMEVGPYTYREYRPMENVTFMENGTKVAAVNPKTYVFEPNMSRGSEDDLIRTVNIPAVTVMEMYKDS------MFAWAIADLMTGFNVELFVTRTVGELLWGYEDILLKELKKLKPSL----DPYFGLFYKMNTTDDGEYVFFTGKQDYRDFARIDQWRGNSSLDWWNTPECNMINGTNGASFHPIISKTERLYMFSSDLCRSIYATFESELSVMGIPAYRFVPPSEVFANKTVNPDNAGFCVGNYCLSSGLLNVSVCKQGA-PIIMSSPHFYQADDMFAQDVIGMHPNKEEHQTAIDINPLTGMVVQAAKRLQVNVFVEKLSAFTLTGNVRTLVYPVMYLNESVLIDADSAKKL 427          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Cavefish
Match: scarb2a (lysosome membrane protein 2 [Source:NCBI gene;Acc:103046960])

HSP 1 Score: 299.671 bits (766), Expect = 1.939e-94
Identity = 166/438 (37.90%), Postives = 253/438 (57.76%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGD-KPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQK-RLYFFEPSLSVGY-ESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINIALESITAL-GLENLPSVLLPVMWLNESVLITDDLARKIKNRLLV-------PVSIGQLGA 1398
             L +  +   +++ +++K + L   + +   W NP  P YMQ++FF+V NPD  L G  KP V Q+GPYTYREYR + N+ F  NGT  +    + + F P +SVG  E D  TT NIP+I +   +  Y    + ++   IK +   + F+  SV    WG+ DP +      L+      +   GL Y KN T++  +   TG  N  +Y KI++WNG  K++ W+++ +NM+NGTDGS+F  FL++   LYIF +D+CR+IH  YV    +KGIP+F +A PS + A    NP N GFC+  G CLG GVL ++ C  G+ PIV+S PHF  AD +Y  +I G+NP+K E++T L L PTTG+P+   K+ Q+N+ ++ +      + L   + P+M++NE+  I DD A +++  LL+       PV I  +GA
Sbjct:   24 ALLVAQVFQTMIQERIKKEITLGENSRVLGGWINPPPPVYMQYFFFNVTNPDEFLAGKAKPHVTQMGPYTYREYRPRENVTFLENGTKIFATNPKSFVFLPEMSVGDPEVDMLTTPNIPFIAVMNEMHSYSFFIRPLISMFIKSL-GVNMFMTRSVHEFLWGFKDPLMTK----LHTLKPEVDEYFGLMYKKNGTHEGEFVFHTGEKNYMDYGKIDTWNGIRKMNWWSSEQSNMINGTDGSVFHTFLSRKELLYIFAADLCRSIHLGYVSDTEVKGIPAFRFAPPSDVLAAPDENPSNAGFCVPAGDCLGKGVLKVSVCREGA-PIVVSFPHFYQADTQYIDAIDGMNPNKEEHETYLDLNPTTGVPIRACKRAQLNVIMKRVPGFPQTKFLNETIFPIMYVNETATIDDDSASQMRTLLLIVTLVSNFPVIIVGMGA 455          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Cavefish
Match: ENSAMXT00000053358.1 (lysosome membrane protein 2-like [Source:NCBI gene;Acc:103034805])

HSP 1 Score: 286.574 bits (732), Expect = 1.088e-89
Identity = 159/424 (37.50%), Postives = 236/424 (55.66%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGYES-DTFTTANIPYIVLGTRIKD---YKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLD-GYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITALGL-ENLPSVLLPVMWLNESVLITDDLARKIKNRLLV 1371
             L +  +   I+  +++  + L  G+ +F  W+NP  P +M+F+F++V NP   ++G KP V  +GPYTYREYR K N+ F  +G  VS L  + + F P LS G  S D  TT NIP + +  ++KD   + +    M   S+      + F   +V  + WG+ DP L      L+      +   GL   KN + D  +   TG  N   Y +I++W G   +S WN + +NM+NGTDGS F PFL K  RL +F +D+CR+IH  +     +KGI ++ Y  P  + A+   NP+N+GFCLD   CL  GVLN+  C  G+ P+++S PHF   D KY  +I GL+P  E ++T L L PTTG+P+   K+ QINI L+ +T   +  NL   + PVM+LNESV+I D  A ++   L +
Sbjct:   24 ALLVAGVFQNIINKRLKGEITLTEGSKVFGTWKNPPPPVFMEFFFYNVTNPKEFMEGKKPRVNTMGPYTYREYRPKANVTFVEDGKKVSALTPKTFVFVPELSAGDPSKDNVTTVNIPAVAVMNKLKDSGFWVKSGMSMFMGSL----GTTMFFTHTVNELLWGFEDPLLSR----LHKIKPEVDEKFGLMLDKNGSTDGEFVYFTGEQNYLEYGRIDTWKGQKLMSFWNTNQSNMINGTDGSAFHPFLTKEERLDVFTADLCRSIHMLFEKEVKVKGILAYRYTPPRAVLASGKNNPENEGFCLDPANCLDDGVLNVAVCRKGA-PVIVSFPHFYLGDKKYADAIDGLSPVHEHHQTYLDLNPTTGVPVRAAKRAQINILLDRVTGFPMTRNLNGTVFPVMFLNESVVIDDASAARLHKLLTI 438          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Cavefish
Match: ENSAMXT00000057832.1 (lysosome membrane protein 2-like [Source:NCBI gene;Acc:103034805])

HSP 1 Score: 286.189 bits (731), Expect = 2.218e-89
Identity = 159/424 (37.50%), Postives = 236/424 (55.66%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGYES-DTFTTANIPYIVLGTRIKD---YKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLD-GYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITALGL-ENLPSVLLPVMWLNESVLITDDLARKIKNRLLV 1371
             L +  +   I+  +++  + L  G+ +F  W+NP  P +M+F+F++V NP   ++G KP V  +GPYTYREYR K N+ F  +G  VS L  + + F P LS G  S D  TT NIP + +  ++KD   + +    M   S+      + F   +V  + WG+ DP L      L+      +   GL   KN + D  +   TG  N   Y +I++W G   +S WN + +NM+NGTDGS F PFL K  RL +F +D+CR+IH  +     +KGI ++ Y  P  + A+   NP+N+GFCLD   CL  GVLN+  C  G+ P+++S PHF   D KY  +I GL+P  E ++T L L PTTG+P+   K+ QINI L+ +T   +  NL   + PVM+LNESV+I D  A ++   L +
Sbjct:   24 ALLVAGVFQNIINKRLKGEITLTEGSKVFGTWKNPPPPVFMEFFFYNVTNPKEFMEGKKPRVNTMGPYTYREYRPKANVTFVEDGKKVSALTPKTFVFVPELSAGDPSKDNVTTVNIPAVAVMNKLKDSGFWVKSGMSMFMGSL----GTTMFFTHTVNELLWGFEDPLLSR----LHKIKPEVDEKFGLMLDKNGSTDGEFVYFTGEQNYLEYGRIDTWKGQKLMSFWNTNQSNMINGTDGSAFHPFLTKEERLDVFTADLCRSIHMLFEKEVKVKGILAYRYTPPRAVLASGKNNPENEGFCLDPANCLDDGVLNVAVCRKGA-PVIVSFPHFYLGDKKYADAIDGLSPVHEHHQTYLDLNPTTGVPVRAAKRAQINILLDRVTGFPMTRNLNGTVFPVMFLNESVVIDDASAARLHKLLTI 438          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Cavefish
Match: ENSAMXT00000052632.1 (lysosome membrane protein 2-like [Source:NCBI gene;Acc:103034805])

HSP 1 Score: 286.189 bits (731), Expect = 2.218e-89
Identity = 159/424 (37.50%), Postives = 236/424 (55.66%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGYES-DTFTTANIPYIVLGTRIKD---YKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLD-GYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITALGL-ENLPSVLLPVMWLNESVLITDDLARKIKNRLLV 1371
             L +  +   I+  +++  + L  G+ +F  W+NP  P +M+F+F++V NP   ++G KP V  +GPYTYREYR K N+ F  +G  VS L  + + F P LS G  S D  TT NIP + +  ++KD   + +    M   S+      + F   +V  + WG+ DP L      L+      +   GL   KN + D  +   TG  N   Y +I++W G   +S WN + +NM+NGTDGS F PFL K  RL +F +D+CR+IH  +     +KGI ++ Y  P  + A+   NP+N+GFCLD   CL  GVLN+  C  G+ P+++S PHF   D KY  +I GL+P  E ++T L L PTTG+P+   K+ QINI L+ +T   +  NL   + PVM+LNESV+I D  A ++   L +
Sbjct:   24 ALLVAGVFQNIINKRLKGEITLTEGSKVFGTWKNPPPPVFMEFFFYNVTNPKEFMEGKKPRVNTMGPYTYREYRPKANVTFVEDGKKVSALTPKTFVFVPELSAGDPSKDNVTTVNIPAVAVMNKLKDSGFWVKSGMSMFMGSL----GTTMFFTHTVNELLWGFEDPLLSR----LHKIKPEVDEKFGLMLDKNGSTDGEFVYFTGEQNYLEYGRIDTWKGQKLMSFWNTNQSNMINGTDGSAFHPFLTKEERLDVFTADLCRSIHMLFEKEVKVKGILAYRYTPPRAVLASGKNNPENEGFCLDPANCLDDGVLNVAVCRKGA-PVIVSFPHFYLGDKKYADAIDGLSPVHEHHQTYLDLNPTTGVPVRAAKRAQINILLDRVTGFPMTRNLNGTVFPVMFLNESVVIDDASAARLHKLLTI 438          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Sea Lamprey
Match: scarb2a (scavenger receptor class B, member 2a [Source:ZFIN;Acc:ZDB-GENE-020419-29])

HSP 1 Score: 251.906 bits (642), Expect = 2.845e-77
Identity = 150/432 (34.72%), Postives = 230/432 (53.24%), Query Frame = 1
Query:  118 CFG-----LFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYE-SDTFTTANIPYIVLGTRIKDYKEINKLM--VENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLD-GYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPS----KEYKTIL-KLEPTTGLPLHIQKKLQINIALESI-TALGLENLPSVLLPVMWLNESVLITDDLARKIKNRLL 1368
            C G     LF   + P +    V++ + L+  + +++ W+NP    Y+ F  F ++NP  +L G+KP V++ GPYTYRE RI+ +IVF  N TVS    + Y   P  SVG   +D  TT NIP + L   ++      K +  +   +  +   + F   +V  + WGY DP L      ++ F     PN GLFYG N + D VY   TG     ++ KI  W G S L+ W  D  N +NGTDGS F P +NK+  LY+F SD+CR+I+ ++     +K + ++ +  P+ +FAN T    N GFC    +C G+GVLN++ C   +  I    P F     K+ Q  I LNP     KE + +L  +   TG PL  +KK+QIN+ ++     L   N+ ++L PV+++NES LI DD A ++++++L
Sbjct:   16 CIGITWVILFALDVFPNLAHSMVKEQVVLKLNSTVYENWKNPPADIYLSFTLFHLVNPKEVLGGEKPLVQERGPYTYREMRIRQDIVFYENHTVSATLPKSYVLVPEQSVGDPMTDKITTVNIPLMTLVEMVRHSFLPQKWLDIILTVVAIMHKETLFQSRTVHELLWGYEDPILAQ----IHKFLDSVNPNFGLFYGMNGSADGVYLFHTGQNKSTDFAKIALWKGESSLNWWTTDSCNKINGTDGSTFHPLINKNDILYLFSSDLCRSIYVSFEKELSVKALSTYRFTTPASVFANSTA---NHGFCTTPSHCPGSGVLNISVCKQAALLITF-LPSFVQNKSKFAQR-IQLNPPSLIIKEAQEVLVTVSLVTGFPLRAEKKVQINVHVQRAPNILQTGNVRTLLFPVVFINESALIKDDSAAQLRSQIL 438          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Sea Lamprey
Match: cd36 (CD36 molecule (thrombospondin receptor) [Source:ZFIN;Acc:ZDB-GENE-040718-55])

HSP 1 Score: 223.402 bits (568), Expect = 1.334e-66
Identity = 144/443 (32.51%), Postives = 227/443 (51.24%), Query Frame = 1
Query:  154 IVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAI-LDGD-----KPSVRQIGPYTYR-EYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGY-----CLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITALGL-ENLPS-VLLPVMWLNESVLITDDLARKIKNRLLVP--------VSIGQLGALALMV 1413
            I+   V K   L NGT+ F  W       Y QFWFF+V N +   L  +     KP ++Q+GPYTY+  +  K  +V+  N +VSY+  +   F   +SVG E D  T+ N+    L   I  +       V NS     N S F   +V+ + WGY DP LE+      D  F      GLFY  N +ND VY + TG  ++     I  W  +  ++ W +++ + + GTDGS F PFLNK ++L  F SD+CR + A +     +KGI  + Y  P+ L +    N  N+  C   Y     C   GVL+++ C  G  P+ +S PHF     +Y   + GL P++E ++T L +EPTTG+ L + K++QIN+ L+ +  + + +N+P   + P++WLNE+  + DD A+  +  L +P        +++  LG++ ++V
Sbjct:   35 IISSTVTKEAVLINGTVAFDAWVQSPSDVYRQFWFFNVTNSEEFSLQSNSSVTVKPKLKQLGPYTYKVRHLAKDKLVYHPNDSVSYVLPQQAIFLRDMSVGPEEDLITSINMVASALPV-IMGFPG-----VLNSFYKKTNTSIFHTRTVRELLWGYKDPILESVASTGIDSTF------GLFYPYNGSNDGVYTIFTGQGDISRVAIIHEWKYNKSMNFWPDEFCDRIKGTDGSSFPPFLNKKNKLEFFSSDVCRNLVAEFDQRRKLKGIDVYRYLLPTSLLSASNKNTANQ--CYTEYLNRTGCTRDGVLDISSC-KGGAPVFISLPHFLDGSREYIDDVEGLEPNREDHETYLDVEPTTGITLSVTKRIQINVLLQPVKQIDIFKNVPQDYIFPIIWLNETGTLGDDSAKAFREALTIPMHALFSVQITLMALGSIGIVV 462          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Nematostella
Match: EDO37700 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF17])

HSP 1 Score: 253.447 bits (646), Expect = 9.050e-78
Identity = 149/447 (33.33%), Postives = 244/447 (54.59%), Query Frame = 1
Query:  136 YFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVF-DANGTVSYLQKRLYFFEPSLSVGY---ESDTFTTANIPYIVLGTRIKD------YKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEA-----NKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKC--VPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINIALESITALG-LENLPSVLLPVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCG 1419
            Y +I  ++++++ + L L+ G+  F+QW+ P +P Y+QF+ F+V+N     +G    V Q GPY+YREYR K NI +   N TV+Y +K+ + F+P+ S        D  TT N+P + L   +K+      +KE+  L+ +   + +     F K +V  + WGY D  L       +K  L+       P I L   KNNT   +  V TG  ++++ ++ + W G   L +WN+ YANM+NGTDG+ F P ++    L++F + +CR++  TY  S  I GI ++ +  PS L+ N ++N +N  FC    C   G+L+++ C   P S P+ +S PHF   DP    +I GL+PSK E+ T L +E   G+PL   K+LQINI +E +  +   + L S+ LP++++NE+  I    A  IK ++L+P  +      A++  G
Sbjct:   35 YPMIDSVIKNKIDQQLVLKPGSSSFKQWKEPPIPIYLQFFIFNVVNEMEAKNGSPLVVAQQGPYSYREYRRKENITWCQMNSTVTYNEKQWFVFDPATSCNTCDPYKDVVTTVNVPLVTLAGVLKNLKDTFHWKELVTLLFDEFSETL-----FEKRTVHEMLWGYNDTMLMKYNEYRDKFHLSGILPAINPTIAL--QKNNTYQGLTSVSTGVKDINSIVEWQEWKGKHSLGVWNSSYANMINGTDGTQFSPGISTDDTLFVFVTQLCRSLFLTYDKSTTIHGIDTYQFTTPSSLYLNASLNGNNAAFCTKK-CYPTGILDISVCQDAPISIPLFVSAPHFYLGDPSLRCNIKGLSPSKEEHGTFLDVETDLGIPLSSGKRLQINIFIEPVEDIKQTQGLGSLFLPILYINETATIDSATADMIKGKVLLPFKVAHGVEFAVIAIG 473          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Nematostella
Match: EDO34698 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNL9])

HSP 1 Score: 237.269 bits (604), Expect = 2.017e-72
Identity = 136/426 (31.92%), Postives = 230/426 (53.99%), Query Frame = 1
Query:  181 LPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDK-PSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSV---GYESDTFTTANIPYIVLGTRIKDYKEINKLMVEN-SIKDIKNYSP-FIKTSVKNITWGYTDPF---LEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINIALESITALGLENLP--SVLLPVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCG 1419
            + L+NGTL+F+QW+  T P YMQ++ FD+ NP  +++G + P V + GPY+Y+E R    + + A+ + V+++  R + F+P  S       +DTFT  NIP +       DYK  +    +   +  +KN +  F   +V  I WGY DP    L A  L  +            F+  NNT   +  ++TG   ++   + E W     L+ W +DYANM+NGTDG+ F P ++KS  LY F  +ICR+I++ Y  +  ++ I  + + APS ++ +  + P N GFC+   CL  G+LNLT+C P +PP+ +S PHF  ++    +++ G++P K E+ T + +EP TG+ +   K++QIN+ALE     G       + + P    ++S LI++  A+  ++++  P+ +       L+  G
Sbjct:    1 IELKNGTLVFKQWRKQTSPIYMQYFVFDLQNPAEVMNGSELPYVIERGPYSYKETRSVDILNYSADKSIVTFMPNRTFIFDPETSCKGCNDTTDTFTNVNIPLLT-----TDYKSKHSFCFQGVEVILLKNKAALFQAKTVYEILWGYVDPLFLSLHAKYLCFD------------FFQYNNTYYGISAINTGIKEINKLEQYEMWKNRPNLTWWESDYANMLNGTDGTQFKPRISKSDTLYTFVPEICRSIYSVYDSTVTVRDIKLYRFTAPSVVYLSGDIYPPNMGFCVPPGCLPTGLLNLTRCQPQNPPVAVSPPHFYQSNSSLVKAVRGMHPVKSEHATFIDIEPITGITMQANKRIQINVALEPRRKAGSMRCSHKAKVHPKSLPHQSALISEADAKTFRDKVYGPIDLAHGAEYGLVAVG 409          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Nematostella
Match: EDO45095 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTV2])

HSP 1 Score: 210.305 bits (534), Expect = 2.062e-61
Identity = 132/445 (29.66%), Postives = 224/445 (50.34%), Query Frame = 1
Query:  154 IVRHQVRKMLPLRNGTL-IFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGY---ESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIG--LFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSD----VIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCL---GAGVLNLTKCVPGSP-------PIVMSQPHFSSADPKYHQSIIGLNPSKEYKTI-LKLEPTTGLPLHIQKKLQINIALESITALG-LENLPSVLLPVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCG 1419
            +++ Q++K +PLR GT   ++QW  PTVP +++ + F V+NPD +  G  P +R++GPYTYREY +K NI F+ + T VSY QK+ Y F P LS      E+D+ TT NI Y ++    K Y  I ++ ++  +K  K +  F+  +V+ + WGY DP       + + F  +  P I   +    N T D +  V+TG  N+D  L   +W G S + +WN+ YANM+NG+DG+ F P       L + +       +A+ V S     +++ + S        +F N + +       L+  C     A +  + K   G P       P+     +   +DP+    + GL P +E   + + +EPTTG+PL    +LQIN+ ++S+  +     +P   +PVM  + +  + D  AR ++  L+V + + +   + +   G
Sbjct:   33 MLKWQLKKNVPLRPGTTDRYKQWIFPTVPIHIELYVFHVVNPDEVRSGATPVIRELGPYTYREYLLKENITFNQDETLVSYNQKKWYVFTPELSCSGCDPEADSVTTVNIAYAIMTEVAKSYSRIVRVGIDALLKYEKEHL-FMTRTVREVLWGYDDPLFAEFSKLKDMFNLKFLPEISPLITMEYNETYDGISTVNTGTKNMDRTLDWIAWKGQSSMGLWNSSYANMINGSDGTQFPPGSGPGDTLPVLE-------YASPVWSALPEYLVELVESVQKKVLRIVFPNLSYHEALSHAKLETLCQRRETACIALVAKAKRGGPLKRLIPIPVATHHGYGLRSDPQLRTQVKGLKPDREKHGLYISIEPTTGIPLQALIRLQINVFIQSVPGISETTGIPQAFVPVMHFSNNASVDDSTARTLREGLVVQLLVAKYAEMVVFALG 469          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Nematostella
Match: EDO26198 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCM1])

HSP 1 Score: 149.828 bits (377), Expect = 1.572e-41
Identity = 86/247 (34.82%), Postives = 131/247 (53.04%), Query Frame = 1
Query:  394 QKRLYFFEPSLSVGY---ESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIG--LFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTK-CVPG--SPPIVMSQPHF 1110
            QK+ Y F P LS      E+D+ TT NI Y ++    K Y  I ++ ++  +K  K +  F+  +V+ + WGY DP       + + F  +  P I   +    N T D +  V+TG  N+D  L   +W G S + +WN+ YANM+NG+DG+ F P       LY F +++CR+I+  +  +  +KGIP   Y  P+ LF N+T    N+ FCL G C   G+L  ++ C P   + PIV+S PHF
Sbjct:    1 QKKWYVFTPELSCSGCDPEADSVTTVNIAYAIMTEVAKGYSRIVRVGIDALLKYEKEHL-FMTRTVREVLWGYDDPLFAEFSKLKDMFNLKFLPEISPLITMEYNETYDGISTVNTGTKNMDRTLDWIAWKGQSSMGLWNSSYANMINGSDGTQFPPGSGPGDTLYFFSTNLCRSIYLKFDSAKKMKGIPVNRYTTPASLFKNYTEVSSNRDFCL-GRCYPDGILAGSQDCTPSTVTSPIVISTPHF 245          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Medaka
Match: scarb2c (lysosome membrane protein 2-like [Source:NCBI gene;Acc:101155208])

HSP 1 Score: 307.375 bits (786), Expect = 4.989e-98
Identity = 163/416 (39.18%), Postives = 247/416 (59.38%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGT-VSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPN--IGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITALGLE-NLPSVLLPVMWLNESVLITDDLARKI 1353
             L +  + P +++  V   + L+NGT  F+ W +P  P YMQF+FF++ NP+ +L G++P+V ++GPYTYREYR    + F  NGT V+ +  + Y F+ ++S G ESD   T NIP + +    KD      L+  ++         F   +V  + WGY D  L+A KL      FR E +   GLFY  N +ND  Y   TG  + +++ ++ +WNG S L+ W +   NM+NGT+G+ F P + K+  L IF S++CR+++A Y     +KGIP + +  PS +FAN +VNP N GFC+  G CLG+G+LN++ C  G+ PI+MS PHF  AD KY QS+ G+ P KE ++T + + P TG  L   K+LQIN+ +E I       N+ +++ PV++LNESVLI D   +K+
Sbjct:   24 ALVLSGVFPHLLQSFVETEVVLKNGTDAFEAWADPPAPIYMQFYFFNLTNPEEVLKGERPAVVELGPYTYREYRPMEEVAFLENGTKVAAVNTKTYIFQLNMSRGPESDLIRTVNIPAVTVMEMFKDSTLEANLI--SAYMRSSGEGLFSTHTVGELLWGYEDGLLKALKL------FRPELDDVFGLFYKTNASNDGQYVFFTGQQSYEDFARVSTWNGESSLNWWTSKECNMINGTNGASFHPVITKNELLRIFSSELCRSLYAVYEDDVSVKGIPGYRFILPSEVFANESVNPANAGFCVPAGNCLGSGLLNVSACKQGA-PIIMSSPHFYQADAKYVQSVFGMKPVKEQHETTIDVHPLTGFLLQAAKRLQINVYVEQIETFSQTGNVRTLIFPVVYLNESVLIDDASVQKL 430          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Medaka
Match: zenzai (zenzai protein [Source:NCBI gene;Acc:100301630])

HSP 1 Score: 296.204 bits (757), Expect = 4.523e-93
Identity = 157/421 (37.29%), Postives = 247/421 (58.67%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSY-LQKRLYFFEPSLSVGY-ESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINIALESITAL-GLENLPSVLLPVMWLNESVLITDDLARKIKNRLLV 1371
             L +  +   ++  ++++ + L   + +F+ W+NP  P YM+++FF+V NP   L G K SV+QIGPYTYREYR + N+ F  NGT  Y L  + + F P  S G  E D  TT NIP++ +   +  Y    + MV   +  +     F+  +V  I WG+ DP L     +  D     +   GL + KN T++  +   TG  N  +Y KI++WNG  ++S W+++ +NM+NGTDG++F P +N++  LYIF +D+CR+IH  YV    +KGI +F +A P  +  +   NP N GFC+  G CLG GVL ++ C  G+ PIV+S PHF  ADPKY  ++ G+NP+K E++T L L+PTTG+P+   K+ Q+N+ ++ I       ++   + P+M++NE+  I D  A ++K  LL+
Sbjct:   24 ALVVAQVFQTMIHERLKQEITLTEKSQVFESWKNPPPPVYMEYYFFNVTNPWEFLQGKKASVKQIGPYTYREYRPRENVTFLENGTKLYALNPKSFVFVPEKSAGNPEVDMVTTINIPFVAVMDELNSYSFFLRSMVSIYMSSL-GVDVFMNRTVHEILWGFKDPLLSKIHSMKPD----VDEYFGLMWKKNGTHEGEFVFHTGEQNYLDYGKIDTWNGLREMSWWSSNQSNMINGTDGAVFHPLINRNELLYIFAADLCRSIHLAYVEDVEVKGIQAFRFAPPEDVLMSPKDNPANAGFCVPAGDCLGTGVLKVSVCREGA-PIVVSFPHFYQADPKYINAVEGMNPNKDEHETYLDLQPTTGVPIRACKRAQLNVIVKRIPGFPKTRHINETIFPIMFVNETATIDDGSAAQMKTLLLI 438          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Medaka
Match: zenzai (zenzai protein [Source:NCBI gene;Acc:100301630])

HSP 1 Score: 296.204 bits (757), Expect = 4.523e-93
Identity = 157/421 (37.29%), Postives = 247/421 (58.67%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSY-LQKRLYFFEPSLSVGY-ESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCL-DGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSK-EYKTILKLEPTTGLPLHIQKKLQINIALESITAL-GLENLPSVLLPVMWLNESVLITDDLARKIKNRLLV 1371
             L +  +   ++  ++++ + L   + +F+ W+NP  P YM+++FF+V NP   L G K SV+QIGPYTYREYR + N+ F  NGT  Y L  + + F P  S G  E D  TT NIP++ +   +  Y    + MV   +  +     F+  +V  I WG+ DP L     +  D     +   GL + KN T++  +   TG  N  +Y KI++WNG  ++S W+++ +NM+NGTDG++F P +N++  LYIF +D+CR+IH  YV    +KGI +F +A P  +  +   NP N GFC+  G CLG GVL ++ C  G+ PIV+S PHF  ADPKY  ++ G+NP+K E++T L L+PTTG+P+   K+ Q+N+ ++ I       ++   + P+M++NE+  I D  A ++K  LL+
Sbjct:   24 ALVVAQVFQTMIHERLKQEITLTEKSQVFESWKNPPPPVYMEYYFFNVTNPWEFLQGKKASVKQIGPYTYREYRPRENVTFLENGTKLYALNPKSFVFVPEKSAGNPEVDMVTTINIPFVAVMDELNSYSFFLRSMVSIYMSSL-GVDVFMNRTVHEILWGFKDPLLSKIHSMKPD----VDEYFGLMWKKNGTHEGEFVFHTGEQNYLDYGKIDTWNGLREMSWWSSNQSNMINGTDGAVFHPLINRNELLYIFAADLCRSIHLAYVEDVEVKGIQAFRFAPPEDVLMSPKDNPANAGFCVPAGDCLGTGVLKVSVCREGA-PIVVSFPHFYQADPKYINAVEGMNPNKDEHETYLDLQPTTGVPIRACKRAQLNVIVKRIPGFPKTRHINETIFPIMFVNETATIDDGSAAQMKTLLLI 438          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Medaka
Match: ENSORLT00000033493.1 (lysosome membrane protein 2 [Source:NCBI gene;Acc:101175665])

HSP 1 Score: 288.886 bits (738), Expect = 1.258e-90
Identity = 158/422 (37.44%), Postives = 244/422 (57.82%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTV--SYLQKRLYFFEPSLSVGYES-DTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLD-GYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITAL-GLENLPSVLLPVMWLNESVLITDDLARKIKNRLLV 1371
            GL +  +   ++ ++++K + L  G+ +F+ W+NP  P +M+F+FF++ N +  L+G KP V QIGPYTYREYR K N+    NGT+  +Y  K+  F     SVG  + D  TT NIP   +  ++KD     + +V   +K + +  PF   +V  + WGY DP LE        +    +   GL Y KN ++   +   TG  N  +Y ++++W G SKL+ W ++ +N + G+DGS F P L K  R+YIF  D+CRTI+  +     +KGIP++ +  P  +FA+   N DN+GFC+    CLG GVL ++ C  G+ P+V S PHF  A+ KY  +I G++P +E ++T L L PTTG+ L   K+ Q+NI +  +      +NL   + PVM+LNESV+I D+ A K+K  LL+
Sbjct:   24 GLLVGRVFHTLMENRLKKEIVLVEGSRVFESWKNPPPPVFMEFFFFNITNAEDCLNGAKPKVTQIGPYTYREYRYKDNVTMVENGTMVSAYTMKKFVFLREK-SVGDPAVDNITTVNIPSWAVMEKMKD--SWFRTVVSMFMKTLGS-GPFTSRTVHELLWGYEDPLLEKAA----GYTPGLDKAFGLMYKKNGSDSGEFIYHTGEQNYLDYGRVKTWKGQSKLTFWTSEESNRIQGSDGSSFHPLLKKDERIYIFTPDLCRTIYMDFEKEVEVKGIPAYRFTPPRSVFASKEENSDNEGFCVSKKECLGTGVLKVSPCRKGA-PVVASFPHFYLAEDKYVDAIEGMSPDREHHQTYLDLNPTTGVILRASKRAQVNILMNRVGGFPDTKNLNETVFPVMFLNESVVIDDESAAKVKKLLLI 436          
BLAST of Scavenger receptor class B member 1 vs. Ensembl Medaka
Match: ENSORLT00000008152.2 (lysosome membrane protein 2 [Source:NCBI gene;Acc:101175665])

HSP 1 Score: 288.886 bits (738), Expect = 1.928e-90
Identity = 158/422 (37.44%), Postives = 244/422 (57.82%), Query Frame = 1
Query:  124 GLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTV--SYLQKRLYFFEPSLSVGYES-DTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLD-GYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKE-YKTILKLEPTTGLPLHIQKKLQINIALESITAL-GLENLPSVLLPVMWLNESVLITDDLARKIKNRLLV 1371
            GL +  +   ++ ++++K + L  G+ +F+ W+NP  P +M+F+FF++ N +  L+G KP V QIGPYTYREYR K N+    NGT+  +Y  K+  F     SVG  + D  TT NIP   +  ++KD     + +V   +K + +  PF   +V  + WGY DP LE        +    +   GL Y KN ++   +   TG  N  +Y ++++W G SKL+ W ++ +N + G+DGS F P L K  R+YIF  D+CRTI+  +     +KGIP++ +  P  +FA+   N DN+GFC+    CLG GVL ++ C  G+ P+V S PHF  A+ KY  +I G++P +E ++T L L PTTG+ L   K+ Q+NI +  +      +NL   + PVM+LNESV+I D+ A K+K  LL+
Sbjct:   24 GLLVGRVFHTLMENRLKKEIVLVEGSRVFESWKNPPPPVFMEFFFFNITNAEDCLNGAKPKVTQIGPYTYREYRYKDNVTMVENGTMVSAYTMKKFVFLREK-SVGDPAVDNITTVNIPSWAVMEKMKD--SWFRTVVSMFMKTLGS-GPFTSRTVHELLWGYEDPLLEKAA----GYTPGLDKAFGLMYKKNGSDSGEFIYHTGEQNYLDYGRVKTWKGQSKLTFWTSEESNRIQGSDGSSFHPLLKKDERIYIFTPDLCRTIYMDFEKEVEVKGIPAYRFTPPRSVFASKEENSDNEGFCVSKKECLGTGVLKVSPCRKGA-PVVASFPHFYLAEDKYVDAIEGMSPDREHHQTYLDLNPTTGVILRASKRAQVNILMNRVGGFPDTKNLNETVFPVMFLNESVVIDDESAAKVKKLLLI 436          
BLAST of Scavenger receptor class B member 1 vs. Planmine SMEST
Match: SMESG000058914.1 (SMESG000058914.1)

HSP 1 Score: 931.784 bits (2407), Expect = 0.000e+0
Identity = 467/476 (98.11%), Postives = 467/476 (98.11%), Query Frame = 1
Query:   97 FCRNFMFCFGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKEYKTILKLEPTTGLPLHIQKKLQINIALESITALGLENLPSVLLPVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCGXXXXXXXXXNQLNPVRYRRPIKFKLINTSYRDSKL 1524
            F     F FGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILN FGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKEYKTILKLEPTTGLPL IQKKLQINIALESITALGLENLPSVLLPVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCGILVVILIVLNQLNPVRYRR IKFKLINTSYRDSKL
Sbjct:   18 FVGILCFVFGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNGFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKEYKTILKLEPTTGLPLQIQKKLQINIALESITALGLENLPSVLLPVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCGILVVILIVLNQLNPVRYRRSIKFKLINTSYRDSKL 493          

HSP 2 Score: 53.1434 bits (126), Expect = 3.564e-7
Identity = 25/25 (100.00%), Postives = 25/25 (100.00%), Query Frame = 2
Query:   47 MFKNLSTSKLKCIITWIFVGILCFV 121
            MFKNLSTSKLKCIITWIFVGILCFV
Sbjct:    1 MFKNLSTSKLKCIITWIFVGILCFV 25          
BLAST of Scavenger receptor class B member 1 vs. Planmine SMEST
Match: SMESG000058915.1 (SMESG000058915.1)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 274/415 (66.02%), Postives = 334/415 (80.48%), Query Frame = 1
Query:  178 MLPLRNGTLIFQQWQNPTVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANGTVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMVENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGLFYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGTDGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYLFANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPKYHQSIIGLNPSKEYKTILKLEPTTGLPLHIQKKLQINIALESITA-LGLENLPSVLLPVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCG 1419
            MLPL+NGTLI+QQWQN TVPAY+QFWFFDVLNP  IL+GDKP V QIGPYTYREYRIKYNI F  NGTVSYLQKR++ F+   SVG E+DTFTTANIP +V+G ++K + +  K +V   IK    Y  F+K SVK++TWGY DP LE     +  FG + E +IGLFYGKNNTND +Y VD+GN+NLDN+L I  WNGS+ LSMWN+ YAN++NGTDGSMFGPFLN+SSRLYIFQSDICR+I+ATYVG   IKGIPS N+ AP  +FANHTVNPDN GFCL GYCLGAGVLNL++CVPG  P+VMSQPHF +AD KY  SIIG++PS ++KT+LKLEPTTGLPL ++KKLQIN+A+E I   L ++NL SV+LP+MWLNES +I+DDLA  +K++L++PV  G  G+LA M+ G
Sbjct:    1 MLPLKNGTLIYQQWQNTTVPAYLQFWFFDVLNPAEILNGDKPVVHQIGPYTYREYRIKYNIEFHDNGTVSYLQKRVFQFDREKSVGDENDTFTTANIPIVVVGDKLKTFPDAVKELVAVVIKFFDKYQLFMKISVKDLTWGYVDPMLEKLNYFVEKFGIKVESHIGLFYGKNNTNDSIYTVDSGNVNLDNFLLINRWNGSNSLSMWNDKYANLINGTDGSMFGPFLNRSSRLYIFQSDICRSIYATYVGGGDIKGIPSINFEAPDSVFANHTVNPDNFGFCLGGYCLGAGVLNLSRCVPGDAPVVMSQPHFYAADQKYIDSIIGISPSSQFKTVLKLEPTTGLPLQLEKKLQINLAIEPIEGYLKMDNLKSVILPMMWLNESAIISDDLASTLKSQLVIPVLAGNWGSLAAMLFG 415          
The following BLAST results are available for this feature:
BLAST of Scavenger receptor class B member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCARB21.373e-8938.54scavenger receptor class B member 2 [Source:HGNC S... [more]
SCARB22.161e-8938.54scavenger receptor class B member 2 [Source:HGNC S... [more]
SCARB23.213e-8938.54scavenger receptor class B member 2 [Source:HGNC S... [more]
SCARB23.144e-8638.83scavenger receptor class B member 2 [Source:HGNC S... [more]
SCARB24.462e-8638.05scavenger receptor class B member 2 [Source:HGNC S... [more]
back to top
BLAST of Scavenger receptor class B member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scav-34.160e-5230.22SCAVenger receptor (CD36 family) related [Source:... [more]
scav-24.257e-4627.64SCAVenger receptor (CD36 family) related [Source:... [more]
scav-18.025e-2725.60SCAVenger receptor (CD36 family) related [Source:... [more]
scav-18.025e-2725.60SCAVenger receptor (CD36 family) related [Source:... [more]
scav-51.902e-2324.79SCAVenger receptor (CD36 family) related [Source:... [more]
back to top
BLAST of Scavenger receptor class B member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
emp5.752e-6530.04gene:FBgn0010435 transcript:FBtr0343508[more]
emp7.556e-6530.04gene:FBgn0010435 transcript:FBtr0072402[more]
emp7.556e-6530.04gene:FBgn0010435 transcript:FBtr0072400[more]
emp7.556e-6530.04gene:FBgn0010435 transcript:FBtr0343507[more]
emp1.213e-6430.04gene:FBgn0010435 transcript:FBtr0072401[more]
back to top
BLAST of Scavenger receptor class B member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01076275.11.101e-9338.03scavenger receptor class B, member 2b [Source:NCBI... [more]
CABZ01076275.11.374e-9338.03scavenger receptor class B, member 2b [Source:NCBI... [more]
scarb2a2.752e-9037.30scavenger receptor class B, member 2a [Source:ZFIN... [more]
scarb2a3.154e-9037.30scavenger receptor class B, member 2a [Source:ZFIN... [more]
cd361.064e-8136.43CD36 molecule (thrombospondin receptor) [Source:ZF... [more]
back to top
BLAST of Scavenger receptor class B member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scarb21.766e-9640.73scavenger receptor class B member 2 [Source:NCBI g... [more]
scarb22.821e-9039.01scavenger receptor class B member 2 [Source:NCBI g... [more]
scarb23.311e-8939.01scavenger receptor class B member 2 [Source:NCBI g... [more]
znf6522.904e-7834.69zinc finger protein 652 [Source:Xenbase;Acc:XB-GEN... [more]
f123.073e-7636.69coagulation factor 12 (Hageman factor) [Source:Xen... [more]
back to top
BLAST of Scavenger receptor class B member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scarb22.352e-8938.78scavenger receptor class B, member 2 [Source:MGI S... [more]
Scarb11.728e-8636.78scavenger receptor class B, member 1 [Source:MGI S... [more]
Scarb12.367e-8636.78scavenger receptor class B, member 1 [Source:MGI S... [more]
Cd365.008e-7936.71CD36 molecule [Source:MGI Symbol;Acc:MGI:107899][more]
Cd365.008e-7936.71CD36 molecule [Source:MGI Symbol;Acc:MGI:107899][more]
back to top
BLAST of Scavenger receptor class B member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P27615|SCRB2_RAT3.625e-8938.48Lysosome membrane protein 2 OS=Rattus norvegicus O... [more]
sp|Q14108|SCRB2_HUMAN1.543e-8838.54Lysosome membrane protein 2 OS=Homo sapiens OX=960... [more]
sp|O35114|SCRB2_MOUSE1.645e-8838.78Lysosome membrane protein 2 OS=Mus musculus OX=100... [more]
sp|Q8SQC1|SCRB1_PIG3.299e-8634.10Scavenger receptor class B member 1 OS=Sus scrofa ... [more]
sp|P97943|SCRB1_RAT1.049e-8535.47Scavenger receptor class B member 1 OS=Rattus norv... [more]
back to top
BLAST of Scavenger receptor class B member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H4W32.800e-11040.09Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A3B4BK399.357e-10941.75Scavenger receptor class B, member 2c OS=Pygocentr... [more]
A0A267E0101.610e-10839.64Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A3Q2CKP02.355e-10541.20Scavenger receptor class B, member 2c OS=Cyprinodo... [more]
A0A3Q9D4407.059e-10542.93Scavenger receptor class B, member 2b OS=Ctenophar... [more]
back to top
BLAST of Scavenger receptor class B member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scarb2c2.506e-10539.90lysosome membrane protein 2-like [Source:NCBI gene... [more]
scarb2a1.939e-9437.90lysosome membrane protein 2 [Source:NCBI gene;Acc:... [more]
ENSAMXT00000053358.11.088e-8937.50lysosome membrane protein 2-like [Source:NCBI gene... [more]
ENSAMXT00000057832.12.218e-8937.50lysosome membrane protein 2-like [Source:NCBI gene... [more]
ENSAMXT00000052632.12.218e-8937.50lysosome membrane protein 2-like [Source:NCBI gene... [more]
back to top
BLAST of Scavenger receptor class B member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
scarb2a2.845e-7734.72scavenger receptor class B, member 2a [Source:ZFIN... [more]
cd361.334e-6632.51CD36 molecule (thrombospondin receptor) [Source:ZF... [more]
back to top
BLAST of Scavenger receptor class B member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Scavenger receptor class B member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO377009.050e-7833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346982.017e-7231.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450952.062e-6129.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261981.572e-4134.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Scavenger receptor class B member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scarb2c4.989e-9839.18lysosome membrane protein 2-like [Source:NCBI gene... [more]
zenzai4.523e-9337.29zenzai protein [Source:NCBI gene;Acc:100301630][more]
zenzai4.523e-9337.29zenzai protein [Source:NCBI gene;Acc:100301630][more]
ENSORLT00000033493.11.258e-9037.44lysosome membrane protein 2 [Source:NCBI gene;Acc:... [more]
ENSORLT00000008152.21.928e-9037.44lysosome membrane protein 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Scavenger receptor class B member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000058914.13.564e-798.11SMESG000058914.1[more]
SMESG000058915.10.000e+066.02SMESG000058915.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031265 ID=SMED30031265|Name=Scavenger receptor class B member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1743bp
GTTTTCACTAACTTGTGGCGTGTGCATTAAGTGTTTTATATGTAACATGT
TTAAGAATCTTTCAACTTCAAAATTGAAATGCATCATTACGTGGATTTTT
GTAGGAATTTTATGTTTTGTTTCGGATTATTCATTTATTTTATTATTCCT
GTTATTGTTCGTCATCAAGTTAGGAAAATGCTCCCTCTAAGAAATGGGAC
TTTAATTTTTCAACAATGGCAAAATCCAACAGTGCCAGCATATATGCAAT
TTTGGTTTTTTGACGTTTTGAATCCTGATGCAATTCTGGATGGTGATAAA
CCTAGTGTACGTCAAATCGGTCCATATACATATCGTGAATATCGAATTAA
ATATAATATCGTATTTGATGCTAATGGAACTGTGAGTTATTTACAAAAGC
GGTTATATTTTTTTGAGCCTAGTCTATCAGTTGGATATGAAAGTGATACT
TTTACTACTGCGAATATTCCTTATATTGTTCTGGGAACTAGAATTAAAGA
TTATAAAGAAATTAACAAATTGATGGTTGAGAATTCTATTAAAGATATTA
AAAATTATAGTCCTTTTATAAAAACATCGGTGAAAAATATTACTTGGGGG
TATACTGATCCGTTTTTAGAAGCTAATAAATTAATTCTAAATGATTTTGG
GTTTCGTGCTGAACCTAATATAGGATTATTTTATGGTAAAAATAACACAA
ACGATAAAGTATATAAAGTTGATACCGGAAATATAAATCTCGATAACTAT
TTGAAAATCGAGAGTTGGAATGGATCTAGTAAATTAAGTATGTGGAATAA
TGATTATGCAAATATGGTAAATGGAACTGATGGATCGATGTTTGGTCCAT
TTCTTAATAAATCTTCTCGTCTTTACATATTCCAATCTGATATTTGCAGA
ACGATACATGCGACCTATGTTGGAAGTGATGTTATTAAAGGGATACCGTC
ATTTAATTATGCTGCGCCTAGTTACTTATTTGCAAATCACACGGTAAATC
CAGATAATAAAGGATTCTGCCTAGATGGATATTGTCTAGGAGCGGGTGTA
TTGAATCTCACTAAATGCGTACCAGGGAGCCCACCTATCGTTATGTCGCA
ACCGCATTTCTCATCCGCAGACCCAAAATACCATCAATCTATTATCGGTC
TAAATCCATCGAAAGAATATAAGACCATTCTAAAATTAGAGCCGACCACT
GGGTTACCGTTGCATATTCAGAAAAAGTTGCAAATAAATATTGCTTTAGA
ATCGATTACTGCTTTGGGTTTGGAAAACTTACCATCTGTACTTTTACCGG
TCATGTGGTTAAATGAAAGCGTATTAATCACTGATGATTTGGCAAGGAAA
ATTAAAAACCGATTACTGGTGCCTGTATCGATTGGTCAGCTTGGTGCTTT
AGCTTTGATGGTGTGTGGAATTCTGGTTGTGATTTTGATTGTTCTTAACC
AATTAAATCCAGTTCGTTATCGGCGGCCTATTAAATTTAAGCTCATCAAT
ACAAGCTACAGGGACTCTAAACTATAGATCTGGTGAGTTTCCGATAAAAA
TAATACTGATAATTGCAATATTTTGGTTGTTGTGCTCAATATATTTTCGT
TTTCAATTATCGATTTTTTTAAATGTATTAGTTATTTTTCAGTCATTTTT
GAATTATAATCTTTACTTATTATTCTTGATGAATAAGTGATCACCTGTTA
TTGTTATTACTACCTGTTATTGTTATTAATTAATAAATTTGAC
back to top

protein sequence of SMED30031265-orf-1

>SMED30031265-orf-1 ID=SMED30031265-orf-1|Name=SMED30031265-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=483bp
MHHYVDFCRNFMFCFGLFIYFIIPVIVRHQVRKMLPLRNGTLIFQQWQNP
TVPAYMQFWFFDVLNPDAILDGDKPSVRQIGPYTYREYRIKYNIVFDANG
TVSYLQKRLYFFEPSLSVGYESDTFTTANIPYIVLGTRIKDYKEINKLMV
ENSIKDIKNYSPFIKTSVKNITWGYTDPFLEANKLILNDFGFRAEPNIGL
FYGKNNTNDKVYKVDTGNINLDNYLKIESWNGSSKLSMWNNDYANMVNGT
DGSMFGPFLNKSSRLYIFQSDICRTIHATYVGSDVIKGIPSFNYAAPSYL
FANHTVNPDNKGFCLDGYCLGAGVLNLTKCVPGSPPIVMSQPHFSSADPK
YHQSIIGLNPSKEYKTILKLEPTTGLPLHIQKKLQINIALESITALGLEN
LPSVLLPVMWLNESVLITDDLARKIKNRLLVPVSIGQLGALALMVCGILV
VILIVLNQLNPVRYRRPIKFKLINTSYRDSKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0001530lipopolysaccharide binding
GO:0001540beta-amyloid binding
GO:0001875lipopolysaccharide receptor activity
GO:0008035high-density lipoprotein particle binding
GO:0030169low-density lipoprotein particle binding
GO:0034185apolipoprotein binding
GO:0034186apolipoprotein A-I binding
GO:0070506high-density lipoprotein particle receptor activity
GO:0004872receptor activity
Vocabulary: biological process
TermDefinition
GO:0001935endothelial cell proliferation
GO:0006707cholesterol catabolic process
GO:0010867positive regulation of triglyceride biosynthetic process
GO:0010886positive regulation of cholesterol storage
GO:0010899regulation of phosphatidylcholine catabolic process
GO:0015914phospholipid transport
GO:0015920lipopolysaccharide transport
GO:0030301cholesterol transport
GO:0031663lipopolysaccharide-mediated signaling pathway
GO:0032497detection of lipopolysaccharide
GO:0033344cholesterol efflux
GO:0034375high-density lipoprotein particle remodeling
GO:0034383low-density lipoprotein particle clearance
GO:0034384high-density lipoprotein particle clearance
GO:0035461vitamin transmembrane transport
GO:0042632cholesterol homeostasis
GO:0043534blood vessel endothelial cell migration
GO:0043654recognition of apoptotic cell
GO:0043691reverse cholesterol transport
GO:0044406adhesion of symbiont to host
GO:0050892intestinal absorption
GO:0051000positive regulation of nitric-oxide synthase activity
GO:0070328triglyceride homeostasis
GO:0070508cholesterol import
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0005901caveola
GO:0009986cell surface
GO:0043231intracellular membrane-bounded organelle
GO:0016020membrane
GO:0005764lysosome
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002159CD36_fam
IPR005428CD36/SCARB1/SNMP1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 28..50