wntP-2

Overview
NamewntP-2 (ABY85208.1)
Smed IDSMED30031256
Length (bp)1576
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of wntP-2 (SMED30031256) t-SNE clustered cells

Violin plots show distribution of expression levels for wntP-2 (SMED30031256) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of wntP-2 (SMED30031256) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for wntP-2 (SMED30031256) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031256

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 36

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031256SMESG000066476.1 wntP-2smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30031256SMESG000066476.1 wntP-2smed_ncbi_20200123PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30031256SMESG000066476.1 EU296631.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
esophagusSMED30031256SMESG000066476.1 EU296631.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30031256SMESG000066476.1 EU296631.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30031256SMESG000066476.1 ABY85208.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
esophagusSMED30031256SMESG000066476.1 ABY85208.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30031256SMESG000066476.1 ABY85208.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30031256SMESG000066476.1 dd_Smed_v4_7326_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30031256SMESG000066476.1 dd_Smed_v4_7326_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30031256SMESG000066476.1 SmedASXL_010181SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30031256SMESG000066476.1 dd_Smed_v4_7326_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30031256SMESG000066476.1 dd_Smed_v4_7326_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30031256SMESG000066476.1 dd_Smed_v4_7326_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30031256SMESG000066476.1 wntP-2smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30031256SMESG000066476.1 wntP-2smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30031256SMESG000066476.1 ABY85208.1smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30031256SMESG000066476.1 ABY85208.1smed_ncbi_20200123PMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30031256SMESG000066476.1 dd_Smed_v6_7326_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30031256SMESG000066476.1 dd_Smed_v6_7326_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30031256SMESG000066476.1 dd_Smed_v6_7326_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
posterior region of the whole animalSMED30031256SMESG000066476.1 Smed-wntP-2smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30031256SMESG000066476.1 Smed-wntP-2smed_ncbi_20200123PMID:18063755
Petersen et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30031256SMESG000066476.1 OX_Smed_1.0.10882ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
posterior region of the whole animalSMED30031256SMESG000066476.1 EU296631smed_ncbi_20200123PMID:30485821
Tewari et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
musculature systemSMED30031256SMESG000066476.1 EU296631smed_ncbi_20200123PMID:30485821
Tewari et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
muscle cellSMED30031256SMESG000066476.1 dd_Smed_v4_7326_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30031256SMESG000066476.1 wntP-2smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30031256SMESG000066476.1 wntP-2smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30031256SMESG000066476.1 ABY85208.1smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
posterior poleSMED30031256SMESG000066476.1 ABY85208.1smed_ncbi_20200123PMID:21566195
Petersen et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30031256SMESG000066476.1 EU296631.1smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx pouchSMED30031256SMESG000066476.1 EU296631.1smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30031256SMESG000066476.1 EU296631.1smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30031256SMESG000066476.1 EU296631.1smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30031256SMESG000066476.1 EU296631.1smed_ncbi_20200123PMID:26556349
Sureda-Gómez et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of wntP-2 vs. Ensembl Human
Match: WNT4 (Wnt family member 4 [Source:HGNC Symbol;Acc:HGNC:12783])

HSP 1 Score: 245.743 bits (626), Expect = 2.607e-76
Identity = 131/333 (39.34%), Postives = 180/333 (54.05%), Query Frame = 3
Query:  450 KRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            K +++ Q  +C+ +  +M SV  G  L I ECQ+QF N  WNC                  + +   P            +++ + T E+AF+ +I SAGV++ VT+ACS G    CGCDRTV+       F WSGCS NI +G AFS+ F+D RE+ +    +S AL N+HNN  GR++++  M V+CKCHGVSGSCE++TC R +P FR VG  LKE+F    +V+         L+P+    +   + D++YL  SPD C  D   G LGT GR CN T         + C  LCC RG+H       E+C CKF WCC V C  C+R V
Sbjct:   47 KGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNC------------------STLDSLP---------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQG-FQWSGCSDNIAYGVAFSQSFVDVRERSK-GASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTSKAI-----DGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLV 345          
BLAST of wntP-2 vs. Ensembl Human
Match: WNT7B (Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:12787])

HSP 1 Score: 219.55 bits (558), Expect = 1.863e-66
Identity = 123/348 (35.34%), Postives = 177/348 (50.86%), Query Frame = 3
Query:  429 LSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSK-FTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNK--------LIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            L  + IC ++      Q+ +C+     +  +  G  +GINECQ+QF    WNC    +                            T   Q +   + E+AF  +I +AGV++ VT ACSQG  SNCGCDR        ++ + W GCS ++ +G  FSRRF+DARE     K+ +  L N+HNN  GR+ + ++M ++CKCHGVSGSC  +TC   LP FR VG  LKE++   +QV+              I +  S +   E D++Y+  SP++C  D   G++GT GR+CN T         + C  +CC RGY+   Y K  QC+CKF WCC V C TC  + 
Sbjct:   16 LGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGE---------------------------KTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDARE----IKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGA-----DGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERT 327          
BLAST of wntP-2 vs. Ensembl Human
Match: WNT7B (Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:12787])

HSP 1 Score: 220.32 bits (560), Expect = 1.926e-66
Identity = 126/350 (36.00%), Postives = 181/350 (51.71%), Query Frame = 3
Query:  429 LSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRT---VYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFF-DNKL-------IPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            L  + IC ++      Q+ +C+     +  +  G  +GINECQ+QF    WNC    +                            T   Q +   + E+AF  +I +AGV++ VT ACSQG  SNCGCDR     Y+  +  K  W GCS ++ +G  FSRRF+DARE     K+ +  L N+HNN  GR+ + ++M ++CKCHGVSGSC  +TC   LP FR VG  LKE++   +QV+    ++L       I +  S +   E D++Y+  SP++C  D   G++GT GR+CN T         + C  +CC RGY+   Y K  QC+CKF WCC V C TC  + 
Sbjct:   36 LGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGE---------------------------KTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWK--WGGCSADVRYGIDFSRRFVDARE----IKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGA-----DGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERT 347          
BLAST of wntP-2 vs. Ensembl Human
Match: WNT7B (Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:12787])

HSP 1 Score: 219.55 bits (558), Expect = 3.422e-66
Identity = 126/350 (36.00%), Postives = 181/350 (51.71%), Query Frame = 3
Query:  429 LSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRT---VYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFF-DNKL-------IPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            L  + IC ++      Q+ +C+     +  +  G  +GINECQ+QF    WNC    +                            T   Q +   + E+AF  +I +AGV++ VT ACSQG  SNCGCDR     Y+  +  K  W GCS ++ +G  FSRRF+DARE     K+ +  L N+HNN  GR+ + ++M ++CKCHGVSGSC  +TC   LP FR VG  LKE++   +QV+    ++L       I +  S +   E D++Y+  SP++C  D   G++GT GR+CN T         + C  +CC RGY+   Y K  QC+CKF WCC V C TC  + 
Sbjct:   32 LGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGE---------------------------KTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWK--WGGCSADVRYGIDFSRRFVDARE----IKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRT-----SPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERT 343          
BLAST of wntP-2 vs. Ensembl Human
Match: WNT2B (Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:12781])

HSP 1 Score: 218.394 bits (555), Expect = 1.840e-65
Identity = 122/331 (36.86%), Postives = 173/331 (52.27%), Query Frame = 3
Query:  456 VLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSK--FTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDN--KLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            ++  Q+ LC+ +  +M SV  G    I ECQ QF +H WNC   ++ +                          T   +++ +S+ E+AF+ +I SAGV + +T+ACSQG  S C CD        D +  F W GCS NIH+G  F++ F+DA+EK RLK   + AL N+HNN  GR +V   + ++CKCHGVSGSC +RTC R L  FR  GD L+ R+   +QV    +                 D++Y ++SPD+C  D   G+LGT GR+C+ T   T     + C  +CC RGY      +  QC CKF WCC V C+ C+  V
Sbjct:   59 LVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDH--------------------------TVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEK-RLKD--ARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGT-----DGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTV 355          
BLAST of wntP-2 vs. Ensembl Celegans
Match: cwn-1 (pep chromosome:WBcel235:II:130983:133598:-1 gene:WBGene00000857.1 transcript:K10B4.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-1)

HSP 1 Score: 208.379 bits (529), Expect = 3.503e-62
Identity = 123/370 (33.24%), Postives = 190/370 (51.35%), Query Frame = 3
Query:  408 NTYANEYLSTS-KICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDA--REKIRLKKQTSAAL-------------TNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFR-----KIIQVDFFDN-KLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAIC 1451
            N +  +   TS K  K + + Q   C+++  LM SV SG +    ECQFQF    WNC   +   ++ I                         D  + ++T ESAF+ +I SA V+Y+VT+ C++G+   CGCD +  D    S+F + GCS N+ FG   S+ F+D+  R  + +K     +L              N+HNN  GR+ +   +  +CKCHG+SGSCEMRTC  +LP+FR +G  +K++F      K+++ D  +  +++ K    +     D++Y+  SPD C  D  +G LGT GR C    N       + C  LCC RGY  K  I +E+C+CKF +CC+V CE C++++   +C
Sbjct:   31 NRFDRDKPGTSCKSLKGLTRRQMRFCKKNIDLMESVRSGSLAAHAECQFQFHKRRWNCTLIDPVTHEVIP------------------------DVFLYENTRESAFVHAISSAAVAYKVTRDCARGISERCGCDYSKNDHSGKSQFQYQGCSDNVKFGIGVSKEFVDSAQRRVLMMKDDNGTSLLGPSQLSADGMHMINLHNNQAGRQVLEKSLRRECKCHGMSGSCEMRTCWDSLPNFRHIGMAIKDKFDGAAEVKVVKEDGIEKPRIVMKNSQFKRHTNADLVYMTPSPDFCESDPLRGILGTKGRQCTLAPNAI-----DDCSLLCCGRGYEKKVQIVEEKCNCKFIYCCEVRCEPCQKRIEKYLC 371          
BLAST of wntP-2 vs. Ensembl Celegans
Match: cwn-2 (pep chromosome:WBcel235:IV:10067824:10070251:1 gene:WBGene00000858.1 transcript:W01B6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-2)

HSP 1 Score: 204.142 bits (518), Expect = 1.194e-60
Identity = 117/338 (34.62%), Postives = 165/338 (48.82%), Query Frame = 3
Query:  465 NQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQ---TSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDN---KLIPKYPSKEMFAEV---DMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAIC 1451
             Q  +CE     MP+V  G    I ECQ QF  H WNC  H  T                             +  +   +T E+AF  +I+SAGV++++ + C QG+ ++CGC          + ++W GC  N+ +G  FSR F+D REK    K+      +L N  NN  GR+ +      KCKCHGVSG+C M+TC   LPS   VG  L+ ++ K I+V   D    +L+    +KE        D+++++DSPD+C  D   GTLGT GR+C              C  LCC RGY+  T     +C+CKF+WCCKV+C+TC       IC
Sbjct:   54 GQAQVCELFKDHMPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTG---------------------------MLGPIHKMATREAAFTYAILSAGVTHEIGRRCKQGLLTSCGCSDETKPKNVPTDWSWGGCGDNVEYGYKFSRDFIDIREKEHDPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMKTCWMQLPSMEQVGKILRNKYDKAIRVQINDRGNLQLLADEATKERKTRALPTDLVFMDDSPDYCRFDRHSGTLGTEGRVCKRGSGGA-----EGCDSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVCQTCNNVTQVDIC 359          
BLAST of wntP-2 vs. Ensembl Celegans
Match: egl-20 (Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05])

HSP 1 Score: 186.422 bits (472), Expect = 1.359e-53
Identity = 114/354 (32.20%), Postives = 176/354 (49.72%), Query Frame = 3
Query:  441 KICKRVL---KNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTV----YDAPKD-----SKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAA-LTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKI-IQVDFFDNKLIPKYPSKEMFAEV---DMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAIC 1451
            ++C+R+     NQ+ LC E+   +P V  G    I EC+ +F    WNC   ++    +    Q                    + + +  +  E+AF+ +I++A + + +TK C+ G  + CGCD       Y A  D      +F+W GCS N+  G  ++++FLD  E  +  K  + A L   HNN VGRE++   +  +C+CHGVSGSCE +TC   +  F  V D LK+R+    +QV     K + +    E    +   +M Y++ SP +C  +   G LGT+GR C    +N+Y     SC  LCC RGY+ +  I+  QC CKF WCC+V C+TC  +V    C
Sbjct:   62 ELCRRLDGLNPNQQALCAENPFSIPFVARGVREAIRECENKFKFERWNCSSRDEVTETRHGKFQ------------------DILGKTLRSANKEAAFLNAIMAASIVHSITKGCNTGNLTECGCDSKPGMQRYQAESDPSMSRDQFSWGGCSDNVPHGIRYAKKFLDDWETAQFDKTKNVAHLVRRHNNFVGREAIAQNIRRQCRCHGVSGSCEFKTCWLQMQKFSQVSDLLKKRYDHFAVQVTRKATKRLRRKERTERKIPLRGNEMAYVHRSPSYCEKNLTAGILGTSGREC---IHNSYS--SESCDLLCCGRGYNTRLEIRQTQCECKFVWCCEVKCKTCTEEVAVHTC 392          
BLAST of wntP-2 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355988:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 167.548 bits (423), Expect = 7.892e-47
Identity = 109/365 (29.86%), Postives = 170/365 (46.58%), Query Frame = 3
Query:  432 STSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDS----------KFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKL-IPKYPS------KEMFA----------EVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            S+  +CK V      QK +C E+  ++  +ISG    ++ C++ F    WNC          ++L  +  + +Q   +                   ESA++ +I +AGVS+ + +ACS+G+  +CGC  T   +   +           F W+GCS N+ FG  F R+F+D  ++    +  S    N+HNN VGR  ++N M  +CKCHGVSGSC  +TC + +P F     +L ++++    V   D KL +   PS       E FA            +++YL+ SP++C  D      G N                  C  +CC RG+     I DE CHC+F WCC+V C+TCK+ V
Sbjct:   40 SSPILCKNVPGLTPQQKRMCHENPNIIKYLISGLRSALHTCEYTFQREAWNCT---------LTLPGVGTSPLQIASR-------------------ESAYVYAISAAGVSHSLARACSKGLIDDCGCGETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQYDRQHATEPRSQ--MNLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWKVMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMRNELIYLDASPNYCAIDVKDRECGEN------------------CPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLV 356          
BLAST of wntP-2 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355953:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 167.548 bits (423), Expect = 7.892e-47
Identity = 109/365 (29.86%), Postives = 170/365 (46.58%), Query Frame = 3
Query:  432 STSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDS----------KFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKL-IPKYPS------KEMFA----------EVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            S+  +CK V      QK +C E+  ++  +ISG    ++ C++ F    WNC          ++L  +  + +Q   +                   ESA++ +I +AGVS+ + +ACS+G+  +CGC  T   +   +           F W+GCS N+ FG  F R+F+D  ++    +  S    N+HNN VGR  ++N M  +CKCHGVSGSC  +TC + +P F     +L ++++    V   D KL +   PS       E FA            +++YL+ SP++C  D      G N                  C  +CC RG+     I DE CHC+F WCC+V C+TCK+ V
Sbjct:   40 SSPILCKNVPGLTPQQKRMCHENPNIIKYLISGLRSALHTCEYTFQREAWNCT---------LTLPGVGTSPLQIASR-------------------ESAYVYAISAAGVSHSLARACSKGLIDDCGCGETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQYDRQHATEPRSQ--MNLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWKVMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMRNELIYLDASPNYCAIDVKDRECGEN------------------CPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLV 356          
BLAST of wntP-2 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0339383)

HSP 1 Score: 174.481 bits (441), Expect = 8.534e-50
Identity = 117/359 (32.59%), Postives = 171/359 (47.63%), Query Frame = 3
Query:  444 ICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAP-----KDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNK---------------LIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAIC 1451
            +C R+      Q+ +C E    + ++  G  LG  ECQ QF  H WNC           S +   N +                  +I  ++ E+A+  +I SAG +Y VT AC++G  S CGCD      P      D  + W GCS ++ FG  ++RRF+DARE  R     S  L N+HNN  GR  V   +   CKCHGVSGSC M+TC ++LP FR+VGD+L  +++K   V     K                  + P  +    ++++YL  SP++C      G+ GT+GR C  T +        SC  LCC RG++ +   +  QC C+F+WCC+V C+ C     +  C
Sbjct:    2 LCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNC-----------SEVWQRNVFA----------------HVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELER----DSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGP-----QSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTC 324          
BLAST of wntP-2 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0088512)

HSP 1 Score: 174.481 bits (441), Expect = 1.770e-49
Identity = 118/364 (32.42%), Postives = 175/364 (48.08%), Query Frame = 3
Query:  429 LSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAP-----KDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNK----LI-----------PKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAIC 1451
             ++  +C R+      Q+ +C E    + ++  G  LG  ECQ QF  H WNC           S +   N +                  +I  ++ E+A+  +I SAG +Y VT AC++G  S CGCD      P      D  + W GCS ++ FG  ++RRF+DARE  R     S  L N+HNN  GR  V   +   CKCHGVSGSC M+TC ++LP FR+VGD+L  +++K   V     K    L+            + P  +    ++++YL  SP++C      G+ GT+GR C  T +        SC  LCC RG++ +   +  QC C+F+WCC+V C+ C     +  C
Sbjct:   24 FTSVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNC-----------SEVWQRNVFA----------------HVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELER----DSRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHG-----PQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTC 351          
BLAST of wntP-2 vs. Ensembl Fly
Match: Wnt6 (gene:FBgn0031902 transcript:FBtr0334800)

HSP 1 Score: 152.525 bits (384), Expect = 1.054e-40
Identity = 74/199 (37.19%), Postives = 114/199 (57.29%), Query Frame = 3
Query:  834 DSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFD--NKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETC 1424
            + ++ W GCS N++FG   SR FLDA++  R ++     L   HNN+ GR ++ + M ++CKCHG+SGSC ++TC   +P FR V  +L++R+    +V   +  N  +P+ P      +  +++ +DSPD C  +   G LGT GR CN T + +     + C RLCC RG+  +   +   C C FKWCC+V CE C
Sbjct:  219 EGQWEWGGCSDNVNFGLRHSRVFLDAKQ--RQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGS-----DRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKC 410          

HSP 2 Score: 61.2326 bits (147), Expect = 1.105e-9
Identity = 39/136 (28.68%), Postives = 62/136 (45.59%), Query Frame = 3
Query:  420 NEYLSTSKICKRVLKNQKPLCE----EHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRT 815
            N  L  + +CK+  + +  L E    +   L   +I+G  LG  EC+FQF N  WNC                  T ++K            M +++ + + E+ F+ +I +AGV+Y VTKAC+ G    C CD+ 
Sbjct:   26 NILLDPNLMCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNC------------------TVLRKS-----------MRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKA 132          
BLAST of wntP-2 vs. Ensembl Fly
Match: Wnt6 (gene:FBgn0031902 transcript:FBtr0303251)

HSP 1 Score: 152.525 bits (384), Expect = 1.054e-40
Identity = 74/199 (37.19%), Postives = 114/199 (57.29%), Query Frame = 3
Query:  834 DSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFD--NKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETC 1424
            + ++ W GCS N++FG   SR FLDA++  R ++     L   HNN+ GR ++ + M ++CKCHG+SGSC ++TC   +P FR V  +L++R+    +V   +  N  +P+ P      +  +++ +DSPD C  +   G LGT GR CN T + +     + C RLCC RG+  +   +   C C FKWCC+V CE C
Sbjct:  219 EGQWEWGGCSDNVNFGLRHSRVFLDAKQ--RQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGS-----DRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKC 410          

HSP 2 Score: 61.2326 bits (147), Expect = 1.105e-9
Identity = 39/136 (28.68%), Postives = 62/136 (45.59%), Query Frame = 3
Query:  420 NEYLSTSKICKRVLKNQKPLCE----EHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRT 815
            N  L  + +CK+  + +  L E    +   L   +I+G  LG  EC+FQF N  WNC                  T ++K            M +++ + + E+ F+ +I +AGV+Y VTKAC+ G    C CD+ 
Sbjct:   26 NILLDPNLMCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNC------------------TVLRKS-----------MRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKA 132          
BLAST of wntP-2 vs. Ensembl Fly
Match: Wnt10 (gene:FBgn0031903 transcript:FBtr0303207)

HSP 1 Score: 139.428 bits (350), Expect = 1.522e-35
Identity = 90/264 (34.09%), Postives = 125/264 (47.35%), Query Frame = 3
Query:  456 VLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTV-------------------------------------YDAPK-DSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD 1133
            + K+Q  LC +   +  + + G  + I ECQ QF  H WNC   +                         K RN +   L+ K   ESAF  +I +AGV++ V +ACSQG   +CGCD T+                                     Y+  K  S++ W GCSHN+ FG  +S+ FLD REK         +  N+HNNH GR +V N M  +CKCHG+SGSC+++TC ++ P F +VG  LK +FRK I VD
Sbjct:   82 LTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLST------------------------KSRNPHASSLLKKGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKA----GDIQSKINLHNNHAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVD 317          

HSP 2 Score: 61.2326 bits (147), Expect = 1.329e-9
Identity = 35/90 (38.89%), Postives = 45/90 (50.00%), Query Frame = 3
Query: 1185 EVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            E  + Y   SP+ C  D G    GT GR CN     +     + C  LCC RG+      + E+CHCKF+WCC V CE C  +   +ICN
Sbjct:  399 ETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTS-----DGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVECEECHVEEWISICN 483          
BLAST of wntP-2 vs. Ensembl Zebrafish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 233.417 bits (594), Expect = 9.881e-72
Identity = 127/345 (36.81%), Postives = 193/345 (55.94%), Query Frame = 3
Query:  429 LSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTS-AALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDF----FDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHD-FGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            +S  + C+++   ++ Q  +C+ +  +M +V  G  L I+ECQ+QF N  WNC                  + ++  P            +++ + T E+AF+ +I +A V++ VT+ACS G    CGCDR V+    +  F WSGCS NI +G AFS+ F+D RE  R K Q+S  AL N+HNN  GR++++N M V+CKCHGVSGSCE++TC + +P FR VG+ +KE+F    +V+         L+P+    +   + D++YL+ SPD C HD    G +GT GR CN T         + C  +CC RG+H +     ++C CKF WCC V C+ C++ V
Sbjct:   37 ISDEETCEKLRGLIQRQVQICKRNVEVMDAVRRGAQLAIDECQYQFRNRRWNC------------------STLESVP---------VFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELDKCGCDRNVHGVSPEG-FQWSGCSDNIAYGVAFSQSFVDIRE--RSKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVELRKVGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCEHDPRTPGIMGTAGRFCNKTSKAI-----DGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMV 346          
BLAST of wntP-2 vs. Ensembl Zebrafish
Match: wnt3a (wingless-type MMTV integration site family, member 3A [Source:ZFIN;Acc:ZDB-GENE-001106-1])

HSP 1 Score: 225.713 bits (574), Expect = 1.273e-68
Identity = 121/333 (36.34%), Postives = 180/333 (54.05%), Query Frame = 3
Query:  456 VLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDF--------FDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKR 1430
            ++  Q   C  +  +MPSV  G  +GI ECQ QF    WNC     T N ++++       + K+ +R    +        AK+T ESAF+ +I SAGV++ VT+AC++G  + CGCD +    P    + W GCS ++ FG+  SR F DARE     +  + +  N HNN  GR S+ + M +KCKCHG+SGSCE++TC  + P FRV+GD +K+++    ++          +   L PKYP  +   E D++Y   SP+ C  +   G+ GT  R CN T +       + C  LCC RG++ +T  + E+CHC F WCC V C+ C R
Sbjct:   49 LVPKQLRFCRNYVEIMPSVAEGVKIGIQECQHQFRGRRWNCT----TINDKLAIF---GPVLDKEKERKIGFKQ-------AKATRESAFVHAIASAGVAFAVTRACAEGSATICGCD-SRRKGPPGEGWKWGGCSEDVEFGSMVSREFADAREN----RPDARSAMNRHNNEAGRSSITDHMYLKCKCHGLSGSCEVKTCWWSQPDFRVIGDYMKDKYDSASEMVVEKHRESRGWVETLRPKYPYYKPPTETDLVYYESSPNFCEPNPETGSFGTRDRTCNLTSHGI-----DGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECTR 357          
BLAST of wntP-2 vs. Ensembl Zebrafish
Match: wnt7aa (wingless-type MMTV integration site family, member 7Aa [Source:ZFIN;Acc:ZDB-GENE-051129-1])

HSP 1 Score: 219.164 bits (557), Expect = 2.719e-66
Identity = 134/377 (35.54%), Postives = 193/377 (51.19%), Query Frame = 3
Query:  348 GLVYTMIQIHKIGTRHQGFQNTYANEYLSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRT---VYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFF---DNKLIPKYPSKEMFA-----EVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            G++Y      KIG    GF +  A   L  S IC ++      Q+ +C+     +  +  G  +GINECQFQF N  WNC    +                            T   + +   + E+AF  +II+AGV++ +T AC+QG  S CGCD+     Y+  ++  + W GCS +I +G +FS+ FLDARE     KQ +  L N+HNN VGR+ +   M ++CKCHGVSGSC  +TC   LP FR +G  LKER+   + V+      NK       K+ ++     + D++Y+  SP++C  D   G++GT GRICN T  +T     N C  +CC RGY+   Y +  QC+CKF WCC V C TC  + 
Sbjct:   17 GIIYL-----KIG----GFSSVVA---LGASIICNKIPGLAPRQRTICQSRPDAIIVIGEGAQMGINECQFQFKNGRWNCSALGE---------------------------RTVFGKELKVGSKEAAFTYAIIAAGVAHAITAACTQGTLSGCGCDKEKQGFYN--QEEGWKWGGCSADIRYGLSFSKVFLDAREI----KQNARTLMNLHNNEVGRKILEKNMRLECKCHGVSGSCTTKTCWTTLPKFRQLGYILKERYNHAVHVEPVRASRNKRPAFLKVKKPYSYRKPMDTDLVYIEKSPNYCEADPVTGSMGTQGRICNKTAQHT-----NGCDLMCCGRGYNTHQYSRVWQCNCKFLWCCYVKCNTCSERT 343          
BLAST of wntP-2 vs. Ensembl Zebrafish
Match: wnt7bb (wingless-type MMTV integration site family, member 7Bb [Source:ZFIN;Acc:ZDB-GENE-081006-1])

HSP 1 Score: 218.394 bits (555), Expect = 6.149e-66
Identity = 124/349 (35.53%), Postives = 181/349 (51.86%), Query Frame = 3
Query:  429 LSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRT---VYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNK-------LIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            L  + IC ++      Q+ +C+     +  +  G  LGINECQ+QF    WNC    +                            T   Q +   + E+AF  +I +AGV++ VT ACSQG  S+CGCDR     Y+  ++  + W GCS +I +G  FSR+F+DARE     K+ +  L N+HNN  GR+ +  +M ++CKCHGVSGSC  +TC   LP FR +G  LK+++ K +QV+            L  K    +   E D++Y+  SP++C  D   G++GT GR+CN T  +T     + C  +CC RGY+   Y K  QC+CKF+WCC V C TC  + 
Sbjct:   36 LGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQLGINECQYQFRYGRWNCSALGE---------------------------RTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQGYYN--QEEGWKWGGCSADIKYGIEFSRKFVDARE----IKKNARRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYVLKDKYNKAVQVEVVRASRLRQPTFLKVKRTRHQKPLETDLVYIERSPNYCEEDAKTGSVGTQGRLCNRTSPHT-----DGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERT 346          
BLAST of wntP-2 vs. Ensembl Zebrafish
Match: wnt7bb (wingless-type MMTV integration site family, member 7Bb [Source:ZFIN;Acc:ZDB-GENE-081006-1])

HSP 1 Score: 218.009 bits (554), Expect = 7.542e-66
Identity = 124/349 (35.53%), Postives = 181/349 (51.86%), Query Frame = 3
Query:  429 LSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRT---VYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNK-------LIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            L  + IC ++      Q+ +C+     +  +  G  LGINECQ+QF    WNC    +                            T   Q +   + E+AF  +I +AGV++ VT ACSQG  S+CGCDR     Y+  ++  + W GCS +I +G  FSR+F+DARE     K+ +  L N+HNN  GR+ +  +M ++CKCHGVSGSC  +TC   LP FR +G  LK+++ K +QV+            L  K    +   E D++Y+  SP++C  D   G++GT GR+CN T  +T     + C  +CC RGY+   Y K  QC+CKF+WCC V C TC  + 
Sbjct:   32 LGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQLGINECQYQFRYGRWNCSALGE---------------------------RTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNMSHCGCDREKQGYYN--QEEGWKWGGCSADIKYGIEFSRKFVDARE----IKKNARRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYVLKDKYNKAVQVEVVRASRLRQPTFLKVKRTRHQKPLETDLVYIERSPNYCEEDAKTGSVGTQGRLCNRTSPHT-----DGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERT 342          
BLAST of wntP-2 vs. Ensembl Xenopus
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100491282])

HSP 1 Score: 247.284 bits (630), Expect = 6.954e-77
Identity = 131/333 (39.34%), Postives = 187/333 (56.16%), Query Frame = 3
Query:  450 KRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            K +++ Q  +C+ +  +M SV  G  L I ECQ+QF N  WNC                  + +   P            +++ + T E+AF+ +I SAGV++ VT+ACS G    CGCDRTV+       F WSGCS NI +G AFS+ F+D RE+ +    +S AL N+HNN  GR++++N M V+CKCHGVSGSCE++TC + +P+FR VG+ LKE+F    +V+         L+PK    +   + D++YL+ SPD C HD   G LGT GR CN T      +  + C  +CC RG+H +     E+C CKF WCC V C+ C + V
Sbjct:   45 KGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNC------------------STLDSLP---------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQG-FQWSGCSDNIAYGVAFSQSFVDVRERSK-GGSSSRALMNLHNNDAGRKAILNNMRVECKCHGVSGSCEVKTCWKAMPTFRKVGNVLKEKFDGATEVEQKKIGSTKVLVPKNSQFKPHTDEDLVYLDSSPDFCDHDLKNGVLGTTGRQCNKT-----SKAIDGCELMCCGRGFHTEEVEIIERCSCKFHWCCFVKCKQCHKVV 343          
BLAST of wntP-2 vs. Ensembl Xenopus
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100491282])

HSP 1 Score: 246.514 bits (628), Expect = 1.108e-76
Identity = 131/333 (39.34%), Postives = 187/333 (56.16%), Query Frame = 3
Query:  450 KRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            K +++ Q  +C+ +  +M SV  G  L I ECQ+QF N  WNC                  + +   P            +++ + T E+AF+ +I SAGV++ VT+ACS G    CGCDRTV+       F WSGCS NI +G AFS+ F+D RE+ +    +S AL N+HNN  GR++++N M V+CKCHGVSGSCE++TC + +P+FR VG+ LKE+F    +V+         L+PK    +   + D++YL+ SPD C HD   G LGT GR CN T      +  + C  +CC RG+H +     E+C CKF WCC V C+ C + V
Sbjct:   47 KGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNC------------------STLDSLP---------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQG-FQWSGCSDNIAYGVAFSQSFVDVRERSK-GGSSSRALMNLHNNDAGRKAILNNMRVECKCHGVSGSCEVKTCWKAMPTFRKVGNVLKEKFDGATEVEQKKIGSTKVLVPKNSQFKPHTDEDLVYLDSSPDFCDHDLKNGVLGTTGRQCNKT-----SKAIDGCELMCCGRGFHTEEVEIIERCSCKFHWCCFVKCKQCHKVV 345          
BLAST of wntP-2 vs. Ensembl Xenopus
Match: ska1 (spindle and kinetochore associated complex subunit 1 [Source:Xenbase;Acc:XB-GENE-5759531])

HSP 1 Score: 217.238 bits (552), Expect = 2.208e-65
Identity = 127/355 (35.77%), Postives = 182/355 (51.27%), Query Frame = 3
Query:  429 LSTSKICKR---VLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDR--TVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNK--LIPKY------PSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            L  S IC++   +   Q+ +CE     M +V +G  LG  ECQ+QF +  WNC           SL + S                    Q +   + E+AF  +I+SAG+++ +T ACSQG  + C CDR    Y  P+   + W GCS ++ +G  FSR F+DARE     K+ +  L N+HNN VGR+ +   + ++CKCHGVSGSC ++TC   LP FR VG  + +++++ + V+    +  L+P +       S    AE D++Y++ SP  C  D   G++GT GR CN T         +SC  LCC RGY    Y    QCHCKF WCC V C TC  +     CN
Sbjct:   31 LGASIICRKMPGLSPRQRTICEARPDAMIAVGTGARLGTEECQYQFQHSRWNC----------TSLGEPS-----------------VFGQELKVGSRETAFYYAILSAGIAHSITNACSQGNLTYCSCDREKNGYQDPEKG-WRWGGCSADVKYGIRFSREFVDAREV----KRNARTLMNLHNNMVGRKLLEKNIHLECKCHGVSGSCTLKTCWLTLPHFREVGYAIMDKYKQAVMVEAVRGRRQLLPTFLKLKNPQSYSKPAETDLVYVDRSPSFCEKDNATGSIGTYGRFCNRTSTQA-----DSCELLCCGRGYKTFQYTHTWQCHCKFHWCCHVTCSTCSERTQAYTCN 348          
BLAST of wntP-2 vs. Ensembl Xenopus
Match: ska1 (spindle and kinetochore associated complex subunit 1 [Source:Xenbase;Acc:XB-GENE-5759531])

HSP 1 Score: 216.083 bits (549), Expect = 3.885e-65
Identity = 127/355 (35.77%), Postives = 182/355 (51.27%), Query Frame = 3
Query:  429 LSTSKICKR---VLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDR--TVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNK--LIPKY------PSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            L  S IC++   +   Q+ +CE     M +V +G  LG  ECQ+QF +  WNC           SL + S                    Q +   + E+AF  +I+SAG+++ +T ACSQG  + C CDR    Y  P+   + W GCS ++ +G  FSR F+DARE     K+ +  L N+HNN VGR+ +   + ++CKCHGVSGSC ++TC   LP FR VG  + +++++ + V+    +  L+P +       S    AE D++Y++ SP  C  D   G++GT GR CN T         +SC  LCC RGY    Y    QCHCKF WCC V C TC  +     CN
Sbjct:   20 LGASIICRKMPGLSPRQRTICEARPDAMIAVGTGARLGTEECQYQFQHSRWNC----------TSLGEPS-----------------VFGQELKVGSRETAFYYAILSAGIAHSITNACSQGNLTYCSCDREKNGYQDPEKG-WRWGGCSADVKYGIRFSREFVDAREV----KRNARTLMNLHNNMVGRKLLEKNIHLECKCHGVSGSCTLKTCWLTLPHFREVGYAIMDKYKQAVMVEAVRGRRQLLPTFLKLKNPQSYSKPAETDLVYVDRSPSFCEKDNATGSIGTYGRFCNRTSTQA-----DSCELLCCGRGYKTFQYTHTWQCHCKFHWCCHVTCSTCSERTQAYTCN 337          
BLAST of wntP-2 vs. Ensembl Xenopus
Match: ska1 (spindle and kinetochore associated complex subunit 1 [Source:Xenbase;Acc:XB-GENE-5759531])

HSP 1 Score: 216.083 bits (549), Expect = 4.084e-65
Identity = 127/355 (35.77%), Postives = 182/355 (51.27%), Query Frame = 3
Query:  429 LSTSKICKR---VLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDR--TVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNK--LIPKY------PSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            L  S IC++   +   Q+ +CE     M +V +G  LG  ECQ+QF +  WNC           SL + S                    Q +   + E+AF  +I+SAG+++ +T ACSQG  + C CDR    Y  P+   + W GCS ++ +G  FSR F+DARE     K+ +  L N+HNN VGR+ +   + ++CKCHGVSGSC ++TC   LP FR VG  + +++++ + V+    +  L+P +       S    AE D++Y++ SP  C  D   G++GT GR CN T         +SC  LCC RGY    Y    QCHCKF WCC V C TC  +     CN
Sbjct:   21 LGASIICRKMPGLSPRQRTICEARPDAMIAVGTGARLGTEECQYQFQHSRWNC----------TSLGEPS-----------------VFGQELKVGSRETAFYYAILSAGIAHSITNACSQGNLTYCSCDREKNGYQDPEKG-WRWGGCSADVKYGIRFSREFVDAREV----KRNARTLMNLHNNMVGRKLLEKNIHLECKCHGVSGSCTLKTCWLTLPHFREVGYAIMDKYKQAVMVEAVRGRRQLLPTFLKLKNPQSYSKPAETDLVYVDRSPSFCEKDNATGSIGTYGRFCNRTSTQA-----DSCELLCCGRGYKTFQYTHTWQCHCKFHWCCHVTCSTCSERTQAYTCN 338          
BLAST of wntP-2 vs. Ensembl Mouse
Match: Wnt4 (wingless-type MMTV integration site family, member 4 [Source:MGI Symbol;Acc:MGI:98957])

HSP 1 Score: 244.588 bits (623), Expect = 6.374e-76
Identity = 130/333 (39.04%), Postives = 180/333 (54.05%), Query Frame = 3
Query:  450 KRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            K +++ Q  +C+ +  +M SV  G  L I ECQ+QF N  WNC                  + +   P            +++ + T E+AF+ +I SAGV++ VT+ACS G    CGCDRTV+       F WSGCS NI +G AFS+ F+D RE+ +    +S AL N+HNN  GR++++  M V+CKCHGVSGSCE++TC R +P FR VG  LKE+F    +V+         L+P+    +   + D++YL  SPD C  D   G LGT GR CN T         + C  LCC RG+H       E+C C+F WCC V C  C+R V
Sbjct:   47 KGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNC------------------STLDSLP---------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQG-FQWSGCSDNIAYGVAFSQSFVDVRERSK-GASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDIRSGVLGTRGRTCNKTSKAI-----DGCELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQRLV 345          
BLAST of wntP-2 vs. Ensembl Mouse
Match: Wnt7b (wingless-type MMTV integration site family, member 7B [Source:MGI Symbol;Acc:MGI:98962])

HSP 1 Score: 216.468 bits (550), Expect = 3.134e-65
Identity = 125/350 (35.71%), Postives = 180/350 (51.43%), Query Frame = 3
Query:  429 LSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRT---VYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFF-DNKL-------IPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            L  + IC ++      Q+ +C+     +  +  G  +GI+ECQ QF    WNC    +                            T   Q +   + E+AF  +I +AGV++ VT ACSQG  SNCGCDR     Y+  +  K  W GCS ++ +G  FSRRF+DARE     K+ +  L N+HNN  GR+ + ++M ++CKCHGVSGSC  +TC   LP FR VG  LKE++   +QV+    ++L       I +  S +   E D++Y+  SP++C  D   G++GT GR+CN T         + C  +CC RGY+   Y K  QC+CKF WCC V C TC  + 
Sbjct:   36 LGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALGE---------------------------KTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWK--WGGCSADVRYGIDFSRRFVDARE----IKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGA-----DGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERT 347          
BLAST of wntP-2 vs. Ensembl Mouse
Match: Wnt2b (wingless-type MMTV integration site family, member 2B [Source:MGI Symbol;Acc:MGI:1261834])

HSP 1 Score: 217.624 bits (553), Expect = 3.907e-65
Identity = 122/331 (36.86%), Postives = 172/331 (51.96%), Query Frame = 3
Query:  456 VLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSK--FTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDN--KLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            ++  Q+ LC+ +  +M SV  G    I ECQ QF +H WNC   ++ +                          T   + + +S+ E+AF+ +I SAGV + +T+ACSQG  S C CD        D +  F W GCS NIH+G  F++ F+DA+EK RLK   + AL N+HNN  GR +V   + ++CKCHGVSGSC +RTC R L  FR  GD L+ R+   +QV    +                 D++Y ++SPD+C  D   G+LGT GR+C+ T   T     + C  +CC RGY      +  QC CKF WCC V C+ C+  V
Sbjct:   76 LVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDH--------------------------TVFGRAMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEK-RLKD--ARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRHATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGT-----DGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTV 372          
BLAST of wntP-2 vs. Ensembl Mouse
Match: Wnt7b (wingless-type MMTV integration site family, member 7B [Source:MGI Symbol;Acc:MGI:98962])

HSP 1 Score: 215.698 bits (548), Expect = 6.125e-65
Identity = 124/350 (35.43%), Postives = 177/350 (50.57%), Query Frame = 3
Query:  429 LSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRT---VYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNK--------LIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            L  + IC ++      Q+ +C+     +  +  G  +GI+ECQ QF    WNC    +                            T   Q +   + E+AF  +I +AGV++ VT ACSQG  SNCGCDR     Y+  +  K  W GCS ++ +G  FSRRF+DARE     K+ +  L N+HNN  GR+ + ++M ++CKCHGVSGSC  +TC   LP FR VG  LKE++   +QV+              I +  S +   E D++Y+  SP++C  D   G++GT GR+CN T         + C  +CC RGY+   Y K  QC+CKF WCC V C TC  + 
Sbjct:   32 LGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALGE---------------------------KTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWK--WGGCSADVRYGIDFSRRFVDARE----IKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRT-----SPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERT 343          
BLAST of wntP-2 vs. Ensembl Mouse
Match: Wnt7b (wingless-type MMTV integration site family, member 7B [Source:MGI Symbol;Acc:MGI:98962])

HSP 1 Score: 209.149 bits (531), Expect = 3.166e-63
Identity = 118/314 (37.58%), Postives = 163/314 (51.91%), Query Frame = 3
Query:  528 LGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRT---VYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNK--------LIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            +GI+ECQ QF    WNC    +                            T   Q +   + E+AF  +I +AGV++ VT ACSQG  SNCGCDR     Y+  +  K  W GCS ++ +G  FSRRF+DARE     K+ +  L N+HNN  GR+ + ++M ++CKCHGVSGSC  +TC   LP FR VG  LKE++   +QV+              I +  S +   E D++Y+  SP++C  D   G++GT GR+CN T         + C  +CC RGY+   Y K  QC+CKF WCC V C TC  + 
Sbjct:    1 MGIDECQHQFRFGRWNCSALGE---------------------------KTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWK--WGGCSADVRYGIDFSRRFVDARE----IKKNARRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRT-----SPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERT 276          
BLAST of wntP-2 vs. UniProt/SwissProt
Match: sp|P49337|WNT4_CHICK (Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 3.953e-76
Identity = 131/333 (39.34%), Postives = 185/333 (55.56%), Query Frame = 3
Query:  450 KRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFD----NKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            K +++ Q  +C+ +  +M SV  G  L I ECQ+QF N  WNC                  + +   P            +++ + T E+AF+ +I SAGV++ VT+ACS G    CGCDRTV        F WSGCS NI +G AFS+ F+D RE+ +    ++ AL N+HNN  GR++++N M V+CKCHGVSGSCE +TC + +P FR VG+ LKE+F    +V+  +      L+PK    +   + D++YL+ SPD C HD   G LGT+GR CN T      +  + C  +CC RG+H       E+C CKF WCC V C+ C R V
Sbjct:   47 KGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNC------------------STLDTLP---------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELDKCGCDRTVQGGSPQG-FQWSGCSDNIAYGVAFSQSFVDVRERSK-GASSNRALMNLHNNEAGRKAILNNMRVECKCHGVSGSCEFKTCWKAMPPFRKVGNVLKEKFDGATEVEQSEIGSTKVLVPKNSQFKPHTDEDLVYLDSSPDFCDHDLKNGVLGTSGRQCNKT-----SKAIDGCELMCCGRGFHTDEVEVVERCSCKFHWCCSVKCKPCHRVV 345          
BLAST of wntP-2 vs. UniProt/SwissProt
Match: sp|P56705|WNT4_HUMAN (Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1 SV=4)

HSP 1 Score: 245.743 bits (626), Expect = 1.252e-75
Identity = 131/333 (39.34%), Postives = 180/333 (54.05%), Query Frame = 3
Query:  450 KRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            K +++ Q  +C+ +  +M SV  G  L I ECQ+QF N  WNC                  + +   P            +++ + T E+AF+ +I SAGV++ VT+ACS G    CGCDRTV+       F WSGCS NI +G AFS+ F+D RE+ +    +S AL N+HNN  GR++++  M V+CKCHGVSGSCE++TC R +P FR VG  LKE+F    +V+         L+P+    +   + D++YL  SPD C  D   G LGT GR CN T         + C  LCC RG+H       E+C CKF WCC V C  C+R V
Sbjct:   47 KGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNC------------------STLDSLP---------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQG-FQWSGCSDNIAYGVAFSQSFVDVRERSK-GASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTSKAI-----DGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLV 345          
BLAST of wntP-2 vs. UniProt/SwissProt
Match: sp|P49338|WNT4_XENLA (Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.335e-75
Identity = 132/343 (38.48%), Postives = 192/343 (55.98%), Query Frame = 3
Query:  429 LSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            +S  + C+++   ++ Q  +C+ +  +M SV  G  L I ECQ+QF N  WNC                  + +   P            +++ + T E+AF+ +I SAGV++ VT+ACS G    CGCDRTV+       F WSGCS NI +G AFS+ F+D RE+ +    +S AL N+HNN  GR++++N M V+CKCHGVSGSCE++TC + +P+FR VG+ LKE+F    +V+         L+PK    +   + D++YL+ SPD C HD   G LGT GR CN T      +  + C  +CC RG+H +     E+C CKF WCC V C+ C + V
Sbjct:   37 ISEEETCEKLKGPIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNC------------------STLDTLP---------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQG-FQWSGCSDNILYGVAFSQSFVDVRERSK-GGSSSRALMNLHNNEAGRKAILNNMRVECKCHGVSGSCEVKTCWKAMPTFRKVGNVLKEKFDGATEVEQKKIGSTKVLVPKNSQFKPHTDEDLVYLDSSPDFCDHDLKNGVLGTTGRQCNKT-----SKAIDGCELMCCGRGFHTEEVEIVERCSCKFHWCCFVKCKQCHKVV 345          
BLAST of wntP-2 vs. UniProt/SwissProt
Match: sp|P22724|WNT4_MOUSE (Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 4.458e-75
Identity = 130/333 (39.04%), Postives = 180/333 (54.05%), Query Frame = 3
Query:  450 KRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            K +++ Q  +C+ +  +M SV  G  L I ECQ+QF N  WNC                  + +   P            +++ + T E+AF+ +I SAGV++ VT+ACS G    CGCDRTV+       F WSGCS NI +G AFS+ F+D RE+ +    +S AL N+HNN  GR++++  M V+CKCHGVSGSCE++TC R +P FR VG  LKE+F    +V+         L+P+    +   + D++YL  SPD C  D   G LGT GR CN T         + C  LCC RG+H       E+C C+F WCC V C  C+R V
Sbjct:   47 KGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNC------------------STLDSLP---------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQG-FQWSGCSDNIAYGVAFSQSFVDVRERSK-GASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDIRSGVLGTRGRTCNKTSKAI-----DGCELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQRLV 345          
BLAST of wntP-2 vs. UniProt/SwissProt
Match: sp|Q9QXQ5|WNT4_RAT (Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.352e-74
Identity = 130/333 (39.04%), Postives = 180/333 (54.05%), Query Frame = 3
Query:  450 KRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            K +++ Q  +C+ +  +M SV  G  L I ECQ+QF N  WNC                  + +   P            +++ + T E+AF+ +I SAGV++ VT+ACS G    CGCDRTV+       F WSGCS NI +G AFS+ F+D RE+ +    +S AL N+HNN  GR++++  M V+CKCHGVSGSCE++TC R +P FR VG  LKE+F    +V+         L+P+    +   + D++YL  SPD C  D   G LGT GR CN T         + C  LCC RG+H       E+C C+F WCC V C  C+R V
Sbjct:   47 KGLIQRQVQMCKRNLEVMDSVRHGAQLAIEECQYQFRNRRWNC------------------STLDSLP---------VFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGDLEKCGCDRTVHGVSPQG-FQWSGCSDNIAYGVAFSQSFVDVRERSK-GASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTSKAI-----DGCELLCCGRGFHTAHVELAERCGCRFHWCCFVKCRQCQRLV 345          
BLAST of wntP-2 vs. TrEMBL
Match: B0LMF7 (Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=wntP-2 PE=2 SV=1)

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 401/402 (99.75%), Postives = 401/402 (99.75%), Query Frame = 3
Query:  249 MLNWICFYINKSGSMLILLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            MLNWICFYINKSGSML LLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN
Sbjct:    1 MLNWICFYINKSGSMLTLLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 402          
BLAST of wntP-2 vs. TrEMBL
Match: F8WQT1 (Protein Wnt OS=Dugesia japonica OX=6161 GN=Djwnt11-5 PE=2 SV=1)

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 334/398 (83.92%), Postives = 361/398 (90.70%), Query Frame = 3
Query:  261 ICFYINKSGSMLILLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            ICF I  SG +L+L+++M+ H + CISGRGLVYTMI+IHKIG RHQGFQN + N++LSTSKIC+ VLKNQK LCEEHFPLMPSVISGFMLGINECQFQF NHVWNCQGHNKT++Q+I LLQ +N   +   K+ RK +NTYMDQLI+KSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREK RLK QT+AALTNMHNNHVGRESVINKM +KCKCHGVSGSCEM+TCSRNLPSFRVVGDQLKE F+KI QVDF DNKL PKYPSKEMFAEVDMLYLNDSPDHC+HDF +GTLGTNGRICN TY NT QEPENSCYRLCCQRGYHIKTYIKDEQC CKFKWCCKVICE C+R VIDAICN
Sbjct:    5 ICFPIRTSG-LLLLILIMSFHLEFCISGRGLVYTMIKIHKIGVRHQGFQNPFTNDFLSTSKICRNVLKNQKLLCEEHFPLMPSVISGFMLGINECQFQFLNHVWNCQGHNKTDSQEILLLQRTNINNKVIQKKSRKPKNTYMDQLISKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKKRLKGQTAAALTNMHNNHVGRESVINKMRIKCKCHGVSGSCEMKTCSRNLPSFRVVGDQLKESFQKIFQVDFVDNKLTPKYPSKEMFAEVDMLYLNDSPDHCNHDFQRGTLGTNGRICNATYKNTNQEPENSCYRLCCQRGYHIKTYIKDEQCRCKFKWCCKVICEICQRNVIDAICN 401          
BLAST of wntP-2 vs. TrEMBL
Match: G8DNQ2 (Protein Wnt (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 292/351 (83.19%), Postives = 318/351 (90.60%), Query Frame = 3
Query:  261 ICFYINKSGSMLILLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPEN 1313
            ICF I  SG +L+L+++M+ H K CISGRGLVYTMI+IHKIG RHQGFQN + N++LSTSKIC+ VLKNQK LCEEHFPLMPSVISGFMLGINECQFQF NHVWNCQGHNKT++Q+I LLQ +N   +   K+ RK +NTYMDQLI+KSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREK RLK QT+AALTNMHNNHVGRESVINKM +KCKCHGVSGSCEM+TCSRNLPSFRVVGDQLKE F+KIIQVDF DNKL PKYPSKEMFAEVDMLYLNDSPDHC+HDF +GTLGT+GRICN TY NT QEPEN
Sbjct:    1 ICFPIRTSG-LLLLILIMSFHLKFCISGRGLVYTMIKIHKIGVRHQGFQNPFTNDFLSTSKICRNVLKNQKLLCEEHFPLMPSVISGFMLGINECQFQFLNHVWNCQGHNKTDSQEILLLQRTNINNKVIQKKSRKPKNTYMDQLISKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKKRLKGQTAAALTNMHNNHVGRESVINKMRIKCKCHGVSGSCEMKTCSRNLPSFRVVGDQLKESFQKIIQVDFVDNKLTPKYPSKEMFAEVDMLYLNDSPDHCNHDFQRGTLGTDGRICNATYKNTNQEPEN 350          
BLAST of wntP-2 vs. TrEMBL
Match: T1D114 (Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 273/401 (68.08%), Postives = 340/401 (84.79%), Query Frame = 3
Query:  252 LNWICFYINKSGSMLILLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            +++I  +    G  ++L+I++T++ ++C S +GLV+TM QIHKIG +    QN + N+YL+ +KICK+VLK Q+PLC+EH+PLMPSVISGF+LGI+ECQ QF+N +WNCQGHN+T N +  L + S+  + K  K  R++++TY+D+LIAKSTPESA+IL+IISAGVS+QVTKACSQG+H++CGCDRTVYD P++ KFTWSGCSHNIHFGAAF+R FLDAREK R +KQ   ALTNMHNNHVGR+S+INKM +KCKCHGVSGSCE++TCSRNLPSFR++GD LKERF+ IIQVD+ D KL PKYPSKEMF EV+M+YLNDSPDHC+HDF KGTLGT GRICN T+ N   EP NSC++LCCQRGYHIKTYI++E C CKFKWCCKVICE+CKRKVIDAICN
Sbjct:    1 MHYIWIFNQSFGMFIVLIIILTMNFRMCRSSKGLVFTMSQIHKIGYKDSDNQNQFTNQYLANTKICKKVLKKQRPLCKEHYPLMPSVISGFVLGISECQHQFSNDMWNCQGHNRTVNYR-PLFEKSDETVTKFNKSSRRIKDTYLDRLIAKSTPESAYILAIISAGVSHQVTKACSQGIHNSCGCDRTVYDTPREGKFTWSGCSHNIHFGAAFARTFLDAREKKRSEKQPYTALTNMHNNHVGRQSIINKMKIKCKCHGVSGSCEIKTCSRNLPSFRLIGDFLKERFKNIIQVDYIDGKLAPKYPSKEMFGEVEMIYLNDSPDHCNHDFIKGTLGTTGRICNATFKNNEPEPINSCFKLCCQRGYHIKTYIRNENCRCKFKWCCKVICESCKRKVIDAICN 400          
BLAST of wntP-2 vs. TrEMBL
Match: C3U5B1 (Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 402.134 bits (1032), Expect = 3.006e-133
Identity = 196/406 (48.28%), Postives = 267/406 (65.76%), Query Frame = 3
Query:  288 SMLILLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGF---------------QNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDT--YNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            SML+L++             GLV++M Q+ +I +                    Q    N   S + IC+    +Q+ LC +HF LM SV++GF+LG+NECQFQFA+ +WNC+GHN         L +     + KP++  K   TY+D+L++K TPE+A++ S+ISAGV++QVTKACS+GVH +CGCDRT+YD P+  +F WSGCSHNIHFGAAF+R+FLD  +KIR+ K+   ALT +HNNHVGR++VI KM  KCKCHGVSGSCEM+TC R LP FRVVGD LK RF K +QV F D++LIP+Y    MF + D++YL  SP++C H+   G+LGT GR C +        +E   SC  LCC RG+  +T+ + EQCHCKF WCC V C+ C++ VI+A+C+
Sbjct:   12 SMLVLILRFIAE----TYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHN---------LTIGGHRTKSKPRKKGK---TYLDKLVSKGTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAEMSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 401          
BLAST of wntP-2 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 228.024 bits (580), Expect = 4.980e-70
Identity = 127/325 (39.08%), Postives = 182/325 (56.00%), Query Frame = 3
Query:  480 CEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTS-AALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHD-FGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            C+ +  +M +V  G  L I+ECQ+QF N  WNC           S L+    +                 +++ + T E+AF+ +I +A V++ VT+ACS G    CGCDR V+    D  F WSGCS NI +G AFS+ F+D RE  R K Q+S  AL N+HNN  GR++++N M V+CKCHGVSGSCE++TC + +P FR VG+ +KE+F    +V+         L+P+    +   + D++YL+ SPD C HD    G LGT GR CN T         + C  +CC RG+H +     ++C CKF WCC V C+ C++ V
Sbjct:   31 CKRNVEVMDAVRRGAQLAIDECQYQFRNRRWNC-----------STLETVPVF----------------GKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRNVHGVSPDG-FQWSGCSDNIAYGVAFSQSFVDIRE--RGKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYCNKTSKAI-----DGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMV 320          
BLAST of wntP-2 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 228.409 bits (581), Expect = 6.063e-70
Identity = 127/325 (39.08%), Postives = 183/325 (56.31%), Query Frame = 3
Query:  480 CEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTS-AALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHD-FGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            C+ +  +M +V  G  L I+ECQ+QF N  WNC           S L+    +                 +++ + T E+AF+ +I +A V++ VT+ACS G    CGCDR V+    D  F WSGCS NI +G AFS+ F+D RE  R K Q+S  AL N+HNN  GR++++N M V+CKCHGVSGSCE++TC + +P FR VG+ +KE+F    +V+         L+P+    +   + D++YL+ SPD C HD    G LGT GR CN T      +  + C  +CC RG+H +     ++C CKF WCC V C+ C++ V
Sbjct:   54 CKRNVEVMDAVRRGAQLAIDECQYQFRNRRWNC-----------STLETVPVF----------------GKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRNVHGVSPDG-FQWSGCSDNIAYGVAFSQSFVDIRE--RGKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYCNKT-----SKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMV 343          
BLAST of wntP-2 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 226.483 bits (576), Expect = 1.875e-69
Identity = 126/319 (39.50%), Postives = 180/319 (56.43%), Query Frame = 3
Query:  498 LMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTS-AALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHD-FGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            +M +V  G  L I+ECQ+QF N  WNC           S L+    +                 +++ + T E+AF+ +I +A V++ VT+ACS G    CGCDR V+    D  F WSGCS NI +G AFS+ F+D RE  R K Q+S  AL N+HNN  GR++++N M V+CKCHGVSGSCE++TC + +P FR VG+ +KE+F    +V+         L+P+    +   + D++YL+ SPD C HD    G LGT GR CN T      +  + C  +CC RG+H +     ++C CKF WCC V C+ C++ V
Sbjct:   34 VMDAVRRGAQLAIDECQYQFRNRRWNC-----------STLETVPVF----------------GKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRNVHGVSPDG-FQWSGCSDNIAYGVAFSQSFVDIRE--RGKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYCNKT-----SKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMV 317          
BLAST of wntP-2 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 225.713 bits (574), Expect = 2.715e-69
Identity = 126/319 (39.50%), Postives = 179/319 (56.11%), Query Frame = 3
Query:  498 LMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTS-AALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHD-FGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            +M +V  G  L I+ECQ+QF N  WNC           S L+    +                 +++ + T E+AF+ +I +A V++ VT+ACS G    CGCDR V+    D  F WSGCS NI +G AFS+ F+D RE  R K Q+S  AL N+HNN  GR++++N M V+CKCHGVSGSCE++TC + +P FR VG+ +KE+F    +V+         L+P+    +   + D++YL+ SPD C HD    G LGT GR CN T         + C  +CC RG+H +     ++C CKF WCC V C+ C++ V
Sbjct:   30 VMDAVRRGAQLAIDECQYQFRNRRWNC-----------STLETVPVF----------------GKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRNVHGVSPDG-FQWSGCSDNIAYGVAFSQSFVDIRE--RGKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYCNKTSKAI-----DGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMV 313          
BLAST of wntP-2 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 223.016 bits (567), Expect = 2.882e-68
Identity = 126/319 (39.50%), Postives = 178/319 (55.80%), Query Frame = 3
Query:  498 LMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTS-AALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHD-FGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            +M +V  G  L I+ECQ+QF N  WNC           S L+    + +                 +   T E+AF+ +I +A V++ VT+ACS G    CGCDR V+    D  F WSGCS NI +G AFS+ F+D RE  R K Q+S  AL N+HNN  GR++++N M V+CKCHGVSGSCE++TC + +P FR VG+ +KE+F    +V+         L+P+    +   + D++YL+ SPD C HD    G LGT GR CN T      +  + C  +CC RG+H +     ++C CKF WCC V C+ C++ V
Sbjct:   31 VMDAVRRGAQLAIDECQYQFRNRRWNC-----------STLETVPVFGK-----------------VVTQTREAAFVYAISAASVAFAVTRACSSGELEKCGCDRNVHGVSPD--FQWSGCSDNIAYGVAFSQSFVDIRE--RGKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKIGTTKVLVPRNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYCNKT-----SKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMV 312          
BLAST of wntP-2 vs. Ensembl Sea Lamprey
Match: wnt3 (wingless-type MMTV integration site family, member 3 [Source:ZFIN;Acc:ZDB-GENE-081003-1])

HSP 1 Score: 213.001 bits (541), Expect = 1.399e-64
Identity = 121/333 (36.34%), Postives = 168/333 (50.45%), Query Frame = 3
Query:  456 VLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQV--------DFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKR 1430
            ++  Q   C  +  LMPSV  G  LGI ECQ QF    WNC                  T + + P             ++ ++T E++F+ ++ SAGV + VT+AC+ G  + CGCD      P    + W GCS +  FG   SR F DARE     +  + +  N HNN  GR S+++ M  KCKCHG+SGSCE++TC    PSFR VGD LK+++    ++          +   L PKYP  +  AE D++Y   SP+ C      G+LGT+GR CN T +       + C  LCC RGY+  T  + E+C C F WCC V C+ C R
Sbjct:   51 LVPKQLRFCRNYQELMPSVAEGVRLGIQECQHQFRGRRWNC------------------TTMTEGP--------AIFGPVLERATREASFVHAVSSAGVGFAVTRACADGTSTICGCDNKHRGEPSGG-WKWGGCSEDADFGVMVSREFADAREN----RPDARSAMNRHNNEAGRVSILDFMQRKCKCHGLSGSCEVKTCWWAQPSFRTVGDHLKDKYDSASEMLVERHRESRGWVETLRPKYPLFKPPAERDLVYYETSPNFCEPSAETGSLGTHGRPCNLTSHGI-----DGCDLLCCSRGYNTHTERRREKCKCVFHWCCYVSCQECAR 347          
BLAST of wntP-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010914.1 (pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 gene:ENSPMAG00000009890.1 transcript:ENSPMAT00000010914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 184.882 bits (468), Expect = 8.381e-54
Identity = 118/363 (32.51%), Postives = 165/363 (45.45%), Query Frame = 3
Query:  429 LSTSKICKRV--LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREK------------------IRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERF-RKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGY-HIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAIC 1451
            LS   +C+ V     Q+ LC  +   +P +  G  L + ECQ QF    WNC                                ++   +L    + E+AF  +I +AGV++ V++AC +G  + CGC R          + W GC  N+ +G  F+R F+DARE+                   R   + S  L N+HNN  GR +V     V CKCHGVSGSC ++TC   L  FR VG  LKE++            KL P        +  D++YL+ SPD+C  +   G+LGT GR CN T      E  + C  +CC RGY H K  +  E+C+CKF WCC V C+ C   V   +C
Sbjct:   43 LSAQPLCQLVGLSPGQRKLCHLYQDHVPHIADGARLAVRECQHQFRTRRWNCSAGEG---------------------------DSVFGRLTHIGSRETAFAHAISAAGVAHAVSRACREGELATCGCSRAPRPRELQRDWLWGGCGDNLEYGYRFAREFVDAREREQGGQQQQQQQQQQQQLAARHSVEHSRTLMNLHNNEAGRRAVYGLADVACKCHGVSGSCSLKTCWLQLADFRKVGKFLKEKYDSASAARAGRRAKLEPANRKFSPPSAGDLVYLDASPDYCVRNETTGSLGTIGRSCNKT-----SEGMDGCELMCCGRGYDHFKATVV-ERCNCKFHWCCYVKCKKCTSVVDRFVC 372          
BLAST of wntP-2 vs. Ensembl Sea Lamprey
Match: wnt1 (wingless-type MMTV integration site family, member 1 [Source:NCBI gene;Acc:30128])

HSP 1 Score: 156.762 bits (395), Expect = 1.668e-44
Identity = 91/263 (34.60%), Postives = 131/263 (49.81%), Query Frame = 3
Query:  714 ESAFILSIISAGVSYQVTKACSQGVHSNCGCD--RTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNK---------------------LIPKYPSKEMFAEVDMLYLNDSPDHCHHD-FGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKR 1430
            E+AFI +++SA +++ V +ACS+G  ++C CD  R     P    + W GCS N+ FG  F+R    A        + + AL + HN   G  +V ++M  +CKCHG+SGSC ++TC   LP FR VGD+LKERF    QV  +  +                     L P  P+ +     D++Y+++SP+ CH D  G    GT GR+C              C  LCC RG+  +     E+C C F WCC V C+ C R
Sbjct:    7 ETAFIHAVMSAALAHGVARACSEGSIASCTCDYGRRGRGGPD---WEWGGCSDNLPFGTRFAREL--AAGAGERGGRDARALMDRHNEEAGMRTVDSEMRRECKCHGMSGSCALKTCWLRLPPFRAVGDRLKERFDGATQVADYGREGNRASKDSDRGGGGSGGGGGHLRPADPAHKPPGGRDLVYVDESPEFCHADTAGLSWPGTRGRVCVRGSPGL-----GGCELLCCGRGWTSREARVSERCLCTFHWCCTVTCQNCTR 259          
BLAST of wntP-2 vs. Ensembl Sea Lamprey
Match: wnt10a (wingless-type MMTV integration site family, member 10a [Source:NCBI gene;Acc:30171])

HSP 1 Score: 147.517 bits (371), Expect = 1.241e-40
Identity = 94/292 (32.19%), Postives = 126/292 (43.15%), Query Frame = 3
Query:  747 GVSYQVTKACSQGVHSNCGCDRTV----------------------------------YDAP-KDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYP-----------SKEMFAEV-----------DMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAIC 1451
            GV + V  ACS G    CGCD  +                                   DAP     + W GCSH++ FG  FSR FLD+RE  R       A T +HNN VGR  V+     KCKCHG SGSC+++TC +  P FR VGD L++RF     +   +   +P                   A+V           ++LY   SP  C    G    GT GR+CN T +       + C  +CC RG++  +  + E+C+CKF WCC V+CE C       +C
Sbjct:   15 GVMHAVASACSLGKLKTCGCDEKLKGDEEAFRVKLIKLKMQMLSQGKAAANGVLPHVPADAPGSPDTWEWGGCSHDLEFGEKFSRDFLDSRETSR----DIHARTRLHNNRVGRRVVLEHKRRKCKCHGTSGSCQLKTCWQVSPDFRTVGDTLRDRFHLAAFLAPHNRHGVPALALVSGGGHHHHHQGSSSAQVTGRRYRPPDDGELLYFERSPTFCERGAGSEWPGTQGRVCNRTSSGA-----DGCESMCCGRGHNQISESRMERCNCKFHWCCYVVCEECHSSAWVNVC 297          
BLAST of wntP-2 vs. Ensembl Sea Lamprey
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 122.094 bits (305), Expect = 4.375e-33
Identity = 63/155 (40.65%), Postives = 88/155 (56.77%), Query Frame = 3
Query:  984 ESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDF----FDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            ++V++ M V+CKCHGVSGSCE+RTC R LP FR +G  LKE+F    +V+        +L+P+    +   + D++Y+  SPD C  D   G  GT GR CN T         + C  +CC RG+H       E+C+CKF WCC V C  C++ V
Sbjct:    1 QAVVSHMRVECKCHGVSGSCEVRTCWRALPPFRKIGSVLKEKFDGATEVELRKIGTRRQLVPRNAQFKPHTDEDLVYVAPSPDFCDADPKAGVAGTAGRECNRTSRAL-----DGCELMCCGRGFHTTRAELVERCYCKFHWCCFVKCRQCRKHV 150          
BLAST of wntP-2 vs. Ensembl Nematostella
Match: EDO31000 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54])

HSP 1 Score: 230.335 bits (586), Expect = 5.253e-71
Identity = 130/333 (39.04%), Postives = 183/333 (54.95%), Query Frame = 3
Query:  468 QKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQG-VHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDF----FDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAIC 1451
            Q  +C+ +  +M SV  G  + + ECQ QF    WNC           + +Q S              R+      I   T E+AF+ +I SAGV+Y VT+ACS G +   CGCDR      +   F W+GCS +I FG  F+ RF+DARE+       +  L N+HNN  GR +V   M ++CKCHGVSGSC ++TC R LP+FR+VGD +KE+F    +V++      + L+PK    +   ++D++YL  SPD C  +   G+LGT GRICN T      +  + C  +CC RGY  +T ++ EQC CKF WCC V C+TC R+V  + C
Sbjct:   53 QVQVCKRNIQVMDSVKDGASVALFECQHQFRYRPWNC-----------TTVQFS--------------RSPVFGNSINGGTREAAFVHAISSAGVAYAVTQACSSGRLGQKCGCDRKTRG--QADGFNWAGCSDDIDFGMTFATRFVDARERGSGIGSPARVLMNLHNNRGGRLAVKKFMDLQCKCHGVSGSCNIKTCWRALPNFRIVGDYIKEKFDGATEVEYKLIGGKHVLVPKNRKYKPHTQMDLVYLVQSPDFCEPNPKTGSLGTQGRICNRT-----SQAIDGCDLMCCGRGYVSRTEVRQEQCACKFFWCCHVRCQTCMRRVEVSYC 353          
BLAST of wntP-2 vs. Ensembl Nematostella
Match: WNT2 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5])

HSP 1 Score: 220.32 bits (560), Expect = 4.041e-67
Identity = 119/331 (35.95%), Postives = 185/331 (55.89%), Query Frame = 3
Query:  468 QKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQV-------DFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVI 1439
            Q+ +C ++  +M S+  G  LG+ ECQ QF +  WNC   N                             T   +++ +++ E+AF+ +I SAGV ++VT++CS G   +C C      + K   F W GCS NI +G  F++ F+D+RE     ++ + AL N+HNNHVGR  V   M + CKCHGVSGSC +RTC +++ SFR+VG  L+E++   +QV       +  + ++  K PS++     D++YL DSP++C  D   G+LGT+GR CN + ++T      +C  LCC RG++     ++ +CHCKF WCC V C+TC+R  +
Sbjct:   52 QRQMCLDNPDVMVSIGKGAKLGVEECQHQFRDQRWNCSTVNGDA--------------------------TVFGKVMRRASRETAFVYAISSAGVVHEVTRSCSLGELKDCSCRNKKGRSRKG--FEWGGCSDNIQYGLNFAKAFVDSREV----EKDARALMNLHNNHVGRRVVKTNMSLDCKCHGVSGSCSVRTCWKSISSFRIVGQHLREKYTTAVQVTVGQSGGELTNAEVSYKKPSRD-----DLVYLEDSPNYCMVDSNTGSLGTSGRECNGSASDT----TGACSLLCCGRGFNTIQIEEEYKCHCKFHWCCYVKCQTCRRTTL 341          
BLAST of wntP-2 vs. Ensembl Nematostella
Match: EDO49431 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9])

HSP 1 Score: 211.846 bits (538), Expect = 7.549e-64
Identity = 131/403 (32.51%), Postives = 193/403 (47.89%), Query Frame = 3
Query:  288 SMLILLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNK---------------LIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAIC 1451
            S  ILL+ M     +CIS     + +     +G   +  +N Y N  LS     + + + Q  +   +  L+  +  G    I+ECQ QF N  WNC  H+  N                              +++ ++  E+AF  +I +AGVS+ + +AC +G  S C CD+  Y       + W GCS NIHF   FS+RF+DA+EK R  +    A  N+HNN  GR +V N MIV+CKCHG+S +C ++TC + LP FR+VGD LK +F     V++  N                 IP  P        D++Y   SP+ C  +   G+LGT GR CN T   T     + C  +CC RG+   +  + E C+C+F WCC+V C+ CK + I + C
Sbjct:    5 SAAILLVFMV---SVCISN----HEVQGWWNLGFGFEDLKNDY-NIQLSPPNQIRALTQKQIRISRRYPELIQYIAGGARTAIHECQHQFRNRKWNCSAHSPEN---------------------------VFGKILKRACRETAFTYAITAAGVSHAIARACGEGKLSACSCDQR-YRGVSKQGWQWGGCSDNIHFADNFSKRFVDAQEKGRDFR----AQINLHNNEAGRAAVRNNMIVECKCHGLSEACTVKTCWKRLPDFRLVGDDLKRKFDNASMVEYQQNNNNRNSNRNRNEDPALFIPSKPYLRRPTVYDLVYYEHSPNFCERNPSAGSLGTQGRECNTTSMGT-----DGCELMCCGRGFTTSSQERVENCNCRFFWCCEVKCQKCKTRRIISNC 362          
BLAST of wntP-2 vs. Ensembl Nematostella
Match: EDO37901 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:Q5IRC2])

HSP 1 Score: 202.601 bits (514), Expect = 1.790e-60
Identity = 121/373 (32.44%), Postives = 189/373 (50.67%), Query Frame = 3
Query:  363 MIQIHKIGTRHQGFQNTYANEYLSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTS--AALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDN-----KLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAIC 1451
            ++ I  +G RH   Q+T+        K C R+      Q  +C  + P M  V +   +   ECQ QF N  WNC                  + I K P+        ++  L  + TPE+AF+ ++ +A ++Y +T+AC       C C         D +  W GC  NI  G  FS+ F DA E  R++K  S   AL N+HNN VGR++V +++   C+CHGVSG C  +TC R L  FR+V D LK R+ +I+ V+         +++     +  +   D++ L  SP++CH +  +GT GT+GR+C+     T +  E SC  LCC RG+  +  + +E+C CK+ WCC V C+TC+++V ++ C
Sbjct:   19 VVTIRWLGIRHTS-QHTW------DKKDCNRIHGFSGKQYKICRRNLPAMLYVTAAVEMTREECQHQFQNKRWNC------------------STIVKAPQ--------FLPDL-KRGTPEAAFVYALSAAALTYSITQACGMKRLKPCKCGTNPKFKHPDGE--WGGCHDNIARGMRFSKDFTDAVEAQRMRKHKSMAVALMNLHNNGVGRKAVHSRLEFHCRCHGVSGGCTAKTCIRRLGDFRLVADLLKNRYARIVYVESKTKSKRKARVLKSKRGRRRYTSSDLVALQGSPNYCHKNRKRGTAGTHGRLCDP----TKRRGEGSCAYLCCGRGHRTEEVVHEERCECKYIWCCYVKCQTCRKRVRESRC 351          
BLAST of wntP-2 vs. Ensembl Nematostella
Match: EDO37387 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SFU2])

HSP 1 Score: 201.445 bits (511), Expect = 4.724e-60
Identity = 118/381 (30.97%), Postives = 194/381 (50.92%), Query Frame = 3
Query:  345 RGLVYTMI---QIHKIGTRHQGFQNT--YANEYLSTSKICKR---VLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKL---IPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            RG V  ++   QIH  G  +   + +  + +  ++++ +CK    + K Q  +C     ++ S + G    I+EC  QF    WNC           S L+M N             RN   + L+++   E+AF+ +I+SAG++  V +ACS G  + CGCD ++    + + + W GC  NI +G   S +FLD+REK R       ++ NMHNN VGR ++      KCKCHG+ GSC ++TC + +P  R +GD+L E++     +   + +L   + +  ++       ++Y  DSP++C  +   G  GT GRIC+    +T     ++C  LCC+RGY  K     ++C C F WCC +IC+TC+     +IC+
Sbjct:    4 RGFVKVLLIFFQIHSKGFGYGILKTSIPFEDPVINSNTVCKNTPSLSKEQLKMCRRLPDVVASALQGMQYAIHECLAQFRYRRWNC-----------SSLEMKN-------------RNPLANPLLSRGFRETAFVHAILSAGMTSSVARACSMGKLAKCGCDESLRG--RGTGWEWGGCGDNIDYGIETSAKFLDSREKGR----DLHSMMNMHNNMVGRTTLSENAKTKCKCHGMCGSCSVKTCWKTVPDIREIGDRLMEKYDHATTIGMGNGRLRLHLTRRKARRSSVGRALVYYEDSPNYCIENKELGIFGTRGRICSPESLDT-----DNCQNLCCERGYTTKKLQVTKRCRCHFSWCCYLICDTCRETSTVSICS 349          
BLAST of wntP-2 vs. Ensembl Medaka
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100301590])

HSP 1 Score: 225.713 bits (574), Expect = 9.255e-69
Identity = 122/334 (36.53%), Postives = 183/334 (54.79%), Query Frame = 3
Query:  456 VLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHD-FGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVID 1442
            +++ Q  +C+    +M +V  G  L I+ECQFQF N  WNC                  + ++  P            + I + T E+AF+ +I +A V++ VT+ACS G    CGCD  V+    +  F WSGCS NI +G AFS+ F+D RE+ +  + +S AL N+HNN  GR+++++ M V+CKCHGVSGSCE++TC + +P FR VG+ +KE+F    +V+         L+P+    +   + D++YL  SPD C  D    G LGT GR CN T         + C  +CC RG+  +     ++C CKF WCC V C+ C RK+++
Sbjct:   51 LIQRQVQICKRSVEVMDAVRRGAQLAIDECQFQFRNRRWNC------------------STLETLP---------VFSKAITQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDHNVHGVSPEG-FQWSGCSDNIAYGVAFSQSFVDVRERSKGGQSSSQALMNLHNNEAGRKAILSNMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKVGSTKVLVPRNSQFKPHTDEDLVYLQPSPDFCDFDPRTPGMLGTVGRQCNRTSKAI-----DGCELMCCGRGFQTQEVEVVDRCSCKFHWCCYVKCKQC-RKIVE 350          
BLAST of wntP-2 vs. Ensembl Medaka
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100301590])

HSP 1 Score: 225.328 bits (573), Expect = 1.014e-68
Identity = 122/334 (36.53%), Postives = 183/334 (54.79%), Query Frame = 3
Query:  456 VLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVD----FFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHD-FGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVID 1442
            +++ Q  +C+    +M +V  G  L I+ECQFQF N  WNC                  + ++  P            + I + T E+AF+ +I +A V++ VT+ACS G    CGCD  V+    +  F WSGCS NI +G AFS+ F+D RE+ +  + +S AL N+HNN  GR+++++ M V+CKCHGVSGSCE++TC + +P FR VG+ +KE+F    +V+         L+P+    +   + D++YL  SPD C  D    G LGT GR CN T         + C  +CC RG+  +     ++C CKF WCC V C+ C RK+++
Sbjct:   49 LIQRQVQICKRSVEVMDAVRRGAQLAIDECQFQFRNRRWNC------------------STLETLP---------VFSKAITQGTREAAFVYAISAASVAFAVTRACSSGELEKCGCDHNVHGVSPEG-FQWSGCSDNIAYGVAFSQSFVDVRERSKGGQSSSQALMNLHNNEAGRKAILSNMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKVGSTKVLVPRNSQFKPHTDEDLVYLQPSPDFCDFDPRTPGMLGTVGRQCNRTSKAI-----DGCELMCCGRGFQTQEVEVVDRCSCKFHWCCYVKCKQC-RKIVE 348          
BLAST of wntP-2 vs. Ensembl Medaka
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:101155025])

HSP 1 Score: 217.238 bits (552), Expect = 1.552e-65
Identity = 125/353 (35.41%), Postives = 182/353 (51.56%), Query Frame = 3
Query:  429 LSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRT---VYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPS-----------KEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            L  + IC ++      Q+ +C+     +  V  G  +GINECQ+QF    WNC    +                            T   Q +   + E+AF  +I +AGV++ +T ACSQG  S CGCDR     Y+  ++  + W GCS +I +G  FSRRF+DARE     K+T   L N+HNN  GR+ +  +M ++CKCHGVSGSC  +TC   LP FR +G  LKE++ + + V+      + + P+           K M  E D++Y+  SP++C  D   G++GT GR+CN T  +T     + C  +CC RGY+   Y K  QC+CKF+WCC V C TC  + 
Sbjct:   36 LGANIICNKIPGLAPRQRAICQSRPDAIIVVGEGAQMGINECQYQFRYGRWNCSALGE---------------------------RTVFGQELRVGSREAAFTYAITAAGVAHAITAACSQGNLSQCGCDREKQGYYN--QEEGWKWGGCSADIKYGIEFSRRFVDARE----IKKTPRRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYILKEKYNEAVHVEVVRASRL-RQPTHLKVKQTQGYRKPM--ETDLVYIERSPNYCEEDAATGSVGTQGRLCNRTSPHT-----DGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERT 347          
BLAST of wntP-2 vs. Ensembl Medaka
Match: wnt7bb (protein Wnt-7b [Source:NCBI gene;Acc:101155025])

HSP 1 Score: 216.083 bits (549), Expect = 3.097e-65
Identity = 125/353 (35.41%), Postives = 182/353 (51.56%), Query Frame = 3
Query:  429 LSTSKICKRV---LKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRT---VYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPS-----------KEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKV 1436
            L  + IC ++      Q+ +C+     +  V  G  +GINECQ+QF    WNC    +                            T   Q +   + E+AF  +I +AGV++ +T ACSQG  S CGCDR     Y+  ++  + W GCS +I +G  FSRRF+DARE     K+T   L N+HNN  GR+ +  +M ++CKCHGVSGSC  +TC   LP FR +G  LKE++ + + V+      + + P+           K M  E D++Y+  SP++C  D   G++GT GR+CN T  +T     + C  +CC RGY+   Y K  QC+CKF+WCC V C TC  + 
Sbjct:   32 LGANIICNKIPGLAPRQRAICQSRPDAIIVVGEGAQMGINECQYQFRYGRWNCSALGE---------------------------RTVFGQELRVGSREAAFTYAITAAGVAHAITAACSQGNLSQCGCDREKQGYYN--QEEGWKWGGCSADIKYGIEFSRRFVDARE----IKKTPRRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYILKEKYNEAVHVEVVRASRL-RQPTHLKVKQTQGYRKPM--ETDLVYIERSPNYCEEDAATGSVGTQGRLCNRTSPHT-----DGCDLMCCGRGYNTHQYTKVWQCNCKFQWCCFVKCNTCSERT 343          
BLAST of wntP-2 vs. Ensembl Medaka
Match: wnt3a (Wnt family member 3A [Source:NCBI gene;Acc:101155545])

HSP 1 Score: 214.927 bits (546), Expect = 3.987e-65
Identity = 120/333 (36.04%), Postives = 174/333 (52.25%), Query Frame = 3
Query:  456 VLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDF--------FDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKR 1430
            ++  Q   C  +  +MPSV  G  +GI ECQ QF    WNC   N  NN  I                           ++ K+T ESAF+ +I SAGV++ VT+AC+ G  + CGCD T +  P    + W GCS ++ FG+  SR F DARE     +  + +  N HNN  GR S+ + M ++CKCHG+SGSCE++TC  + P FRV+GD +K+++    ++          +   L PKY + +   E D++Y   SP+ C  +   G+ GT  RICN T +       + C  LCC RG++ +T  + E+CHC F WCC V C+ C R
Sbjct:   14 LVPKQLRFCRNYVEIMPSVAEGVKIGIQECQHQFRGRRWNCTTLN--NNLAI------------------------FGPVLDKATRESAFVHAIASAGVAFAVTRACADGSATICGCD-TRHKGPPGEGWKWGGCSEDVDFGSMVSREFADAREN----RPDARSAMNRHNNEAGRTSLNSNMFLRCKCHGLSGSCEVKTCWWSQPDFRVIGDYMKDKYDSASEMVVEKHRESRGWVETLRPKYNNFKPPTERDLVYYESSPNFCEPNPETGSFGTRDRICNLTSHGI-----DGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECVR 310          
BLAST of wntP-2 vs. Planmine SMEST
Match: SMESG000066476.1 (SMESG000066476.1)

HSP 1 Score: 839.336 bits (2167), Expect = 0.000e+0
Identity = 400/402 (99.50%), Postives = 401/402 (99.75%), Query Frame = 3
Query:  249 MLNWICFYINKSGSMLILLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            MLNWICFYINKSGSML LLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSV+SGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN
Sbjct:    1 MLNWICFYINKSGSMLTLLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVVSGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 402          
BLAST of wntP-2 vs. Planmine SMEST
Match: SMESG000051375.1 (SMESG000051375.1)

HSP 1 Score: 404.06 bits (1037), Expect = 1.183e-137
Identity = 197/406 (48.52%), Postives = 269/406 (66.26%), Query Frame = 3
Query:  288 SMLILLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGF---------------QNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDT--YNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            SML+L++             GLV++M Q+ +I +                    Q    N   S + IC+    +Q+ LC +HF LM SV++GF+LG+NECQFQFA+ +WNC+GHN         L +     + KP++  K   TY+D+L++KSTPE+A++ S+ISAGV++QVTKACS+GVH +CGCDRT+YD P+  +F WSGCSHNIHFGAAF+R+FLD  +KIR+ K+   ALT +HNNHVGR++VI KM  KCKCHGVSGSCEM+TC R LP FRVVGD LK RF K +QV F D++LIP+Y    MF + D++YL  SP++C H+   G+LGT GR C ++       +E   SC  LCC RG+  +T+ + EQCHCKF WCC V C+ C++ VI+A+C+
Sbjct:   12 SMLVLILRFIAE----TYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHN---------LTIGGHRTKSKPRKKGK---TYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 401          
BLAST of wntP-2 vs. Planmine SMEST
Match: SMESG000051375.1 (SMESG000051375.1)

HSP 1 Score: 402.905 bits (1034), Expect = 2.660e-137
Identity = 196/405 (48.40%), Postives = 268/405 (66.17%), Query Frame = 3
Query:  291 MLILLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQGF---------------QNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDT--YNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            ML+L++             GLV++M Q+ +I +                    Q    N   S + IC+    +Q+ LC +HF LM SV++GF+LG+NECQFQFA+ +WNC+GHN         L +     + KP++  K   TY+D+L++KSTPE+A++ S+ISAGV++QVTKACS+GVH +CGCDRT+YD P+  +F WSGCSHNIHFGAAF+R+FLD  +KIR+ K+   ALT +HNNHVGR++VI KM  KCKCHGVSGSCEM+TC R LP FRVVGD LK RF K +QV F D++LIP+Y    MF + D++YL  SP++C H+   G+LGT GR C ++       +E   SC  LCC RG+  +T+ + EQCHCKF WCC V C+ C++ VI+A+C+
Sbjct:    1 MLVLILRFIAE----TYSSGLVFSMYQLQQISSNKYNHLSDSDPTSNPESSQNQQMTINNSPSKTVICQTFSLHQRKLCHQHFRLMESVVNGFLLGLNECQFQFADQIWNCKGHN---------LTIGGHRTKSKPRKKGK---TYLDKLVSKSTPEAAYVSSVISAGVAHQVTKACSKGVHDSCGCDRTIYDTPESERFKWSGCSHNIHFGAAFTRQFLDVPDKIRVSKKPEKALTKLHNNHVGRQAVIMKMAKKCKCHGVSGSCEMKTCIRALPDFRVVGDLLKSRFHKAMQVHFVDSRLIPRYWPSRMFTDNDLIYLLKSPNYCVHNPHFGSLGTQGRKCAESSLLEKKPEETRGSCEELCCGRGHKKRTFSRVEQCHCKFHWCCDVKCDQCRKDVIEAVCD 389          
BLAST of wntP-2 vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 350.132 bits (897), Expect = 6.595e-117
Identity = 173/387 (44.70%), Postives = 249/387 (64.34%), Query Frame = 3
Query:  297 ILLIVMTIHCKICI-SGRGLVYTMIQIHKIGTRHQGFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            +LL++  I  K+ + SGRG+ +T++++          Q +   +  +T+  C +++K Q+ +C  H  L+PSVI G  +GI ECQ QF N  WNC GHN         L + + ++ +  K+ RK   TY+D LI K  PESAF+LS+ SA V++QV+KACS G +  CGCDRT+Y+ P+D+ F W+GCS N+HFGAAFS+RFLD+  K ++K+  S  L N+HN+H G + VI+ M++KCKCHGVSGSCE +TC R LP  R VGD LKE+F K I V   D KL+P +  +    E D+ YL  SP+ C+H+   G+LGT GR+CN+T    ++  E SC  LCC+RG+  K ++  E+C CKF WCC V C+TC+   +++ CN
Sbjct:    9 VLLVIDIISIKVYVNSGRGMFFTLMKL----------QESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHN---------LSIPDRFVSQSKKKHRK---TYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDN-FQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 372          
BLAST of wntP-2 vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 338.576 bits (867), Expect = 7.065e-113
Identity = 163/341 (47.80%), Postives = 226/341 (66.28%), Query Frame = 3
Query:  432 STSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFTWSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 1454
            +T+  C +++K Q+ +C  H  L+PSVI G  +GI ECQ QF N  WNC GHN         L + + ++ +  K+ RK   TY+D LI K  PESAF+LS+ SA V++QV+KACS G +  CGCDRT+Y+ P+D+ F W+GCS N+HFGAAFS+RFLD+  K ++K+  S  L N+HN+H G + VI+ M++KCKCHGVSGSCE +TC R LP  R VGD LKE+F K I V   D KL+P +  +    E D+ YL  SP+ C+H+   G+LGT GR+CN+T    ++  E SC  LCC+RG+  K ++  E+C CKF WCC V C+TC+   +++ CN
Sbjct:   13 NTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCAGHN---------LSIPDRFVSQSKKKHRK---TYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPEDN-FQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGLVNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMNDFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 340          
The following BLAST results are available for this feature:
BLAST of wntP-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WNT42.607e-7639.34Wnt family member 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WNT7B1.863e-6635.34Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT7B1.926e-6636.00Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT7B3.422e-6636.00Wnt family member 7B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT2B1.840e-6536.86Wnt family member 2B [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of wntP-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cwn-13.503e-6233.24pep chromosome:WBcel235:II:130983:133598:-1 gene:W... [more]
cwn-21.194e-6034.62pep chromosome:WBcel235:IV:10067824:10070251:1 gen... [more]
egl-201.359e-5332.20Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05][more]
mom-27.892e-4729.86pep chromosome:WBcel235:V:8355988:8358185:1 gene:W... [more]
mom-27.892e-4729.86pep chromosome:WBcel235:V:8355953:8358185:1 gene:W... [more]
back to top
BLAST of wntP-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt28.534e-5032.59gene:FBgn0004360 transcript:FBtr0339383[more]
Wnt21.770e-4932.42gene:FBgn0004360 transcript:FBtr0088512[more]
Wnt61.054e-4037.19gene:FBgn0031902 transcript:FBtr0334800[more]
Wnt61.054e-4037.19gene:FBgn0031902 transcript:FBtr0303251[more]
Wnt101.522e-3534.09gene:FBgn0031903 transcript:FBtr0303207[more]
back to top
BLAST of wntP-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt49.881e-7236.81wingless-type MMTV integration site family, member... [more]
wnt3a1.273e-6836.34wingless-type MMTV integration site family, member... [more]
wnt7aa2.719e-6635.54wingless-type MMTV integration site family, member... [more]
wnt7bb6.149e-6635.53wingless-type MMTV integration site family, member... [more]
wnt7bb7.542e-6635.53wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wntP-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt46.954e-7739.34Wnt family member 4 [Source:NCBI gene;Acc:10049128... [more]
wnt41.108e-7639.34Wnt family member 4 [Source:NCBI gene;Acc:10049128... [more]
ska12.208e-6535.77spindle and kinetochore associated complex subunit... [more]
ska13.885e-6535.77spindle and kinetochore associated complex subunit... [more]
ska14.084e-6535.77spindle and kinetochore associated complex subunit... [more]
back to top
BLAST of wntP-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt46.374e-7639.04wingless-type MMTV integration site family, member... [more]
Wnt7b3.134e-6535.71wingless-type MMTV integration site family, member... [more]
Wnt2b3.907e-6536.86wingless-type MMTV integration site family, member... [more]
Wnt7b6.125e-6535.43wingless-type MMTV integration site family, member... [more]
Wnt7b3.166e-6337.58wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wntP-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P49337|WNT4_CHICK3.953e-7639.34Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=... [more]
sp|P56705|WNT4_HUMAN1.252e-7539.34Protein Wnt-4 OS=Homo sapiens OX=9606 GN=WNT4 PE=1... [more]
sp|P49338|WNT4_XENLA1.335e-7538.48Protein Wnt-4 OS=Xenopus laevis OX=8355 GN=wnt4 PE... [more]
sp|P22724|WNT4_MOUSE4.458e-7539.04Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=... [more]
sp|Q9QXQ5|WNT4_RAT1.352e-7439.04Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt... [more]
back to top
BLAST of wntP-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B0LMF70.000e+099.75Protein Wnt OS=Schmidtea mediterranea OX=79327 GN=... [more]
F8WQT10.000e+083.92Protein Wnt OS=Dugesia japonica OX=6161 GN=Djwnt11... [more]
G8DNQ20.000e+083.19Protein Wnt (Fragment) OS=Dugesia japonica OX=6161... [more]
T1D1140.000e+068.08Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 ... [more]
C3U5B13.006e-13348.28Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=... [more]
back to top
BLAST of wntP-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt44.980e-7039.08wingless-type MMTV integration site family, member... [more]
wnt46.063e-7039.08wingless-type MMTV integration site family, member... [more]
wnt41.875e-6939.50wingless-type MMTV integration site family, member... [more]
wnt42.715e-6939.50wingless-type MMTV integration site family, member... [more]
wnt42.882e-6839.50wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wntP-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt31.399e-6436.34wingless-type MMTV integration site family, member... [more]
ENSPMAT00000010914.18.381e-5432.51pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 g... [more]
wnt11.668e-4434.60wingless-type MMTV integration site family, member... [more]
wnt10a1.241e-4032.19wingless-type MMTV integration site family, member... [more]
wnt44.375e-3340.65wingless-type MMTV integration site family, member... [more]
back to top
BLAST of wntP-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of wntP-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO310005.253e-7139.04Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54][more]
WNT24.041e-6735.95Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5][more]
EDO494317.549e-6432.51Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RGH9][more]
EDO379011.790e-6032.44Protein Wnt [Source:UniProtKB/TrEMBL;Acc:Q5IRC2][more]
EDO373874.724e-6030.97Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SFU2][more]
back to top
BLAST of wntP-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt49.255e-6936.53Wnt family member 4 [Source:NCBI gene;Acc:10030159... [more]
wnt41.014e-6836.53Wnt family member 4 [Source:NCBI gene;Acc:10030159... [more]
wnt7bb1.552e-6535.41protein Wnt-7b [Source:NCBI gene;Acc:101155025][more]
wnt7bb3.097e-6535.41protein Wnt-7b [Source:NCBI gene;Acc:101155025][more]
wnt3a3.987e-6536.04Wnt family member 3A [Source:NCBI gene;Acc:1011555... [more]
back to top
BLAST of wntP-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066476.10.000e+099.50SMESG000066476.1[more]
SMESG000051375.11.183e-13748.52SMESG000051375.1[more]
SMESG000051375.12.660e-13748.40SMESG000051375.1[more]
SMESG000067888.16.595e-11744.70SMESG000067888.1[more]
SMESG000067888.17.065e-11347.80SMESG000067888.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30031256
GenBankABY85208.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031256 ID=SMED30031256|Name=wntP-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1576bp
CTGGAAAATGATAAATTGTCAAATGATAATTAATAGCTGCGAATGCCCAT
AAAATGAATTTTAAAATGCATTAAATGCATAAATGTTCTAAGCCAAAACA
ACAGACAATTCATTAGAATTATTAATGTCTATTTTGGTTGTAACGCATTA
GCATTCATACCGCAGAAATAGTTTGGATAACATTACTCTGTGTTTGGAAT
GATTTATGAATATAATTTATTTTCATAAACAGATCAAAAATCATAATTAT
GTTGAATTGGATTTGTTTTTATATAAATAAATCTGGATCAATGTTAATCT
TATTAATTGTAATGACTATCCATTGCAAAATATGCATATCTGGACGTGGA
TTAGTATACACAATGATTCAAATTCACAAAATTGGAACACGTCATCAAGG
ATTCCAAAATACTTATGCTAATGAATATTTATCAACTTCAAAAATATGTA
AAAGAGTTTTGAAAAATCAAAAACCCTTATGTGAAGAACATTTTCCTTTA
ATGCCAAGCGTAATTTCTGGTTTCATGCTTGGAATAAATGAATGTCAGTT
TCAATTCGCAAATCACGTTTGGAATTGCCAAGGTCATAATAAAACGAACA
ATCAACAAATTTCACTCTTACAAATGAGTAATACTTACATACAAAAGAAA
CCTAAAAGAGATAGAAAATTAAGAAATACATATATGGATCAATTAATTGC
TAAATCAACACCAGAATCAGCTTTTATATTATCAATTATTTCCGCTGGTG
TATCATATCAAGTTACAAAAGCTTGTAGTCAAGGGGTGCATAGTAATTGT
GGATGTGACAGAACAGTTTATGATGCTCCTAAAGATTCCAAATTTACATG
GTCTGGATGTTCTCATAATATTCATTTTGGAGCAGCGTTTTCTAGACGAT
TCTTGGATGCTCGAGAAAAAATAAGACTTAAAAAACAAACATCCGCTGCT
TTGACTAACATGCATAATAACCATGTTGGAAGAGAAAGTGTTATCAATAA
AATGATTGTAAAATGCAAATGTCATGGCGTTAGTGGATCGTGTGAAATGA
GAACTTGCAGCAGGAATTTACCATCATTTAGAGTTGTTGGAGATCAACTA
AAAGAACGTTTTCGAAAAATTATTCAAGTCGATTTTTTCGATAATAAATT
AATTCCTAAATATCCATCAAAAGAAATGTTTGCAGAGGTTGATATGCTTT
ATTTGAATGATTCACCAGATCATTGCCATCACGATTTTGGAAAAGGAACT
TTGGGAACTAATGGCAGAATATGTAATGATACATATAATAACACATACCA
AGAACCAGAAAATAGCTGTTATCGTTTGTGCTGTCAACGTGGATATCATA
TTAAAACTTATATTAAAGATGAGCAATGTCATTGCAAATTCAAATGGTGC
TGTAAAGTAATATGTGAAACTTGCAAGAGAAAAGTTATTGATGCCATTTG
CAATTAATGTTATGTTAAAATGCATGATTATTCATTTCAGATTCCAAAAT
TTGCATTCAGATTGATCATAAAAGTTTTATACTTACTTTTACAAAAAATA
AAATAAAATTCATTTTTCTTACAAAA
back to top

protein sequence of SMED30031256-orf-1

>SMED30031256-orf-1 ID=SMED30031256-orf-1|Name=SMED30031256-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=403bp
MLNWICFYINKSGSMLILLIVMTIHCKICISGRGLVYTMIQIHKIGTRHQ
GFQNTYANEYLSTSKICKRVLKNQKPLCEEHFPLMPSVISGFMLGINECQ
FQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLI
AKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKDSKFT
WSGCSHNIHFGAAFSRRFLDAREKIRLKKQTSAALTNMHNNHVGRESVIN
KMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNK
LIPKYPSKEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTY
QEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAI
CN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000062esophagus
PLANA:0000081pharynx pouch
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000420parapharyngeal region
PLANA:0000421tail
PLANA:0000428musculature system
PLANA:0007525posterior pole
Vocabulary: INTERPRO
TermDefinition
IPR043158Wnt_C
IPR005817Wnt
IPR018161Wnt_CS
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0005102signaling receptor binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005817WntPRINTSPR01349WNTPROTEINcoord: 199..211
score: 48.8
coord: 257..271
score: 73.39
coord: 155..169
score: 48.03
coord: 174..187
score: 51.0
coord: 315..326
score: 48.63
IPR005817WntSMARTSM00097wnt1_3coord: 66..402
e-value: 8.5E-88
score: 307.7
IPR005817WntPFAMPF00110wntcoord: 69..402
e-value: 2.9E-94
score: 316.1
IPR005817WntPANTHERPTHR12027WNT RELATEDcoord: 57..401
IPR043158Wnt, C-terminal domainGENE3DG3DSA:3.30.2460.20coord: 337..402
e-value: 1.4E-14
score: 55.9
IPR018161Wnt protein, conserved sitePROSITEPS00246WNT1coord: 256..265
NoneNo IPR availableTMHMMTMhelixcoord: 15..37