SMED30031239

Overview
NameSMED30031239
Smed IDSMED30031239
Length (bp)1560
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30031239 (SMED30031239) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30031239 (SMED30031239) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30031239 (SMED30031239) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30031239 (SMED30031239) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031239

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30031239SMESG000075552.1 dd_Smed_v4_7660_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30031239SMESG000075552.1 dd_Smed_v4_7660_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30031239 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000258:153691..155343 -7598
Homology
BLAST of SMED30031239 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 53.1434 bits (126), Expect = 9.509e-7
Identity = 35/100 (35.00%), Postives = 46/100 (46.00%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNENF-CPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCP 571
            C IC   L  A Q PCG  +CK CI   + +    CP   NE ++EN  F      DN A + +  L VKCP++ C +   L  +  H   C   L  CP
Sbjct:   70 CPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPV-DNEILLENQLF-----PDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of SMED30031239 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 53.1434 bits (126), Expect = 9.509e-7
Identity = 35/100 (35.00%), Postives = 46/100 (46.00%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNENF-CPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCP 571
            C IC   L  A Q PCG  +CK CI   + +    CP   NE ++EN  F      DN A + +  L VKCP++ C +   L  +  H   C   L  CP
Sbjct:   70 CPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPV-DNEILLENQLF-----PDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of SMED30031239 vs. Ensembl Human
Match: RNF151 (ring finger protein 151 [Source:HGNC Symbol;Acc:HGNC:23235])

HSP 1 Score: 51.6026 bits (122), Expect = 1.068e-6
Identity = 39/126 (30.95%), Postives = 55/126 (43.65%), Query Frame = 2
Query:  266 NTSCIICHSLLINAYQGPCGCNYCKICIDNYLNNENFCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDD--CDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLY 637
            N  C +CH +L    + PC   +CK CI  +L  +  CP     C  + V  K  +   N   K + +L VKC + D  C   CPL     H   C   L  CP    GCT  ++ +  +AEH  +
Sbjct:   17 NFVCSVCHGVLKRPARLPCSHIFCKKCILRWLARQKTCP-----CCRKEVKRK-KVVHMNKLRKTIGRLEVKCKNADAGCIVTCPLAHRKGHQDSCPFELTACP--NEGCTS-QVPRGTLAEHRQH 133          
BLAST of SMED30031239 vs. Ensembl Human
Match: RNF151 (ring finger protein 151 [Source:HGNC Symbol;Acc:HGNC:23235])

HSP 1 Score: 51.6026 bits (122), Expect = 1.129e-6
Identity = 39/126 (30.95%), Postives = 55/126 (43.65%), Query Frame = 2
Query:  266 NTSCIICHSLLINAYQGPCGCNYCKICIDNYLNNENFCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDD--CDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLY 637
            N  C +CH +L    + PC   +CK CI  +L  +  CP     C  + V  K  +   N   K + +L VKC + D  C   CPL     H   C   L  CP    GCT  ++ +  +AEH  +
Sbjct:   16 NFVCSVCHGVLKRPARLPCSHIFCKKCILRWLARQKTCP-----CCRKEVKRK-KVVHMNKLRKTIGRLEVKCKNADAGCIVTCPLAHRKGHQDSCPFELTACP--NEGCTS-QVPRGTLAEHRQH 132          
BLAST of SMED30031239 vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 49.2914 bits (116), Expect = 6.551e-6
Identity = 37/158 (23.42%), Postives = 73/158 (46.20%), Query Frame = 2
Query:  251 KESLINT--SCIICHSLLINAYQGPCGCNYCKICIDNYLNNENFCPSQSNECIIEN--VDFKMSITKDNSANKRVSKLSVKCP--SDDCDYMCPLIEMNTHLRVCNHVLK------PCPFLELGCTPL-KMNKDQIAEHMLYEICPHSRMMIESMKHT 685
            +E L+++   C IC   L       CG  +C+ C+  ++   N C      C ++N  +  +  I  DN   + + +L   CP  S  C  +   IE++ HL  C +  +       CPF ++ C  + +   +Q+ EH+  ++  H ++M+++ + T
Sbjct:   94 EEELLDSRYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQC------CPMDNKRLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLMLQAFQQT 245          
BLAST of SMED30031239 vs. Ensembl Zebrafish
Match: lnx1 (ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9439])

HSP 1 Score: 50.8322 bits (120), Expect = 3.717e-6
Identity = 31/90 (34.44%), Postives = 44/90 (48.89%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNENFCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCP-SDDCDYMCPLIEMNTHLR 541
            C IC   LI     PCG  YC+ C+ N+L   +FCP      +++    K S+      +K + KL V CP +D C  + P  EM  H+R
Sbjct:   57 CHICLQPLIRPLDTPCGHTYCQECLTNFLLESDFCPVDRTPLMLQKCR-KSSLL----VHKLLDKLMVSCPFADHCTEVMPRGEMEGHIR 141          
BLAST of SMED30031239 vs. Ensembl Zebrafish
Match: lnx1 (ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9439])

HSP 1 Score: 50.8322 bits (120), Expect = 3.896e-6
Identity = 31/90 (34.44%), Postives = 44/90 (48.89%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNENFCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCP-SDDCDYMCPLIEMNTHLR 541
            C IC   LI     PCG  YC+ C+ N+L   +FCP      +++    K S+      +K + KL V CP +D C  + P  EM  H+R
Sbjct:   46 CHICLQPLIRPLDTPCGHTYCQECLTNFLLESDFCPVDRTPLMLQKCR-KSSLL----VHKLLDKLMVSCPFADHCTEVMPRGEMEGHIR 130          
BLAST of SMED30031239 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 50.0618 bits (118), Expect = 5.515e-6
Identity = 39/128 (30.47%), Postives = 56/128 (43.75%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNEN-FCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEI--CP 649
            C IC   L +A Q PCG  +C  CI   + +    CP   NE ++E   F      DN A + +  L+VKC +  C     L ++  HL  C     PCP  +    P+    +  ++H L  I  CP
Sbjct:   71 CPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPV-DNEVLLEEQLFP-----DNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQES-VPISHLDEHKSQHCLQRIMTCP 191          
BLAST of SMED30031239 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 50.0618 bits (118), Expect = 5.515e-6
Identity = 39/128 (30.47%), Postives = 56/128 (43.75%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNEN-FCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEI--CP 649
            C IC   L +A Q PCG  +C  CI   + +    CP   NE ++E   F      DN A + +  L+VKC +  C     L ++  HL  C     PCP  +    P+    +  ++H L  I  CP
Sbjct:   71 CPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPV-DNEVLLEEQLFP-----DNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQES-VPISHLDEHKSQHCLQRIMTCP 191          
BLAST of SMED30031239 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 50.0618 bits (118), Expect = 5.515e-6
Identity = 39/128 (30.47%), Postives = 56/128 (43.75%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNEN-FCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEI--CP 649
            C IC   L +A Q PCG  +C  CI   + +    CP   NE ++E   F      DN A + +  L+VKC +  C     L ++  HL  C     PCP  +    P+    +  ++H L  I  CP
Sbjct:   71 CPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPV-DNEVLLEEQLFP-----DNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQES-VPISHLDEHKSQHCLQRIMTCP 191          
BLAST of SMED30031239 vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 51.6026 bits (122), Expect = 2.792e-6
Identity = 35/99 (35.35%), Postives = 44/99 (44.44%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNENF-CPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPC 568
            C IC   L  A Q PCG  +CK CI   + +    CP   NE ++EN  F      DN A + +  L VKCPS  C     L  +  HL  C+     C
Sbjct:   72 CPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPV-DNESLMENQLF-----PDNFAKREILSLRVKCPSQGCTETMELRHLERHLVRCDFAGVEC 164          
BLAST of SMED30031239 vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 50.8322 bits (120), Expect = 3.148e-6
Identity = 35/100 (35.00%), Postives = 45/100 (45.00%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNENF-CPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCP 571
            C IC   L  A Q PCG  +CK CI   + +    CP   NE ++EN  F      DN A + +  L+VKCP+  C     L  +  H   C   L  CP
Sbjct:   70 CPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPV-DNEILLENQLF-----PDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCP 163          
BLAST of SMED30031239 vs. UniProt/SwissProt
Match: sp|Q3ZCC3|TRAF6_BOVIN (TNF receptor-associated factor 6 OS=Bos taurus OX=9913 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.327e-6
Identity = 35/100 (35.00%), Postives = 46/100 (46.00%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNENF-CPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCP 571
            C IC   L  A Q PCG  +CK CI   + +    CP   NE ++EN  F      DN A + +  L VKCP++ C +   L  +  H   C   L  CP
Sbjct:   71 CPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPV-DNEILLENQLF-----PDNFAKREILSLMVKCPNEGCLHKMELRHLEEHQAHCEFALMSCP 164          
BLAST of SMED30031239 vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.714e-6
Identity = 42/123 (34.15%), Postives = 54/123 (43.90%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNENF-CPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYE 640
            C IC   L  A Q PCG  +CK CI   L +    CP   NE ++EN  F      DN A + +  L VKCPS  C     L  +  HL  C      C   + G  P    K ++ +HM +E
Sbjct:   72 CPICLMALREAVQTPCGHRFCKACIVKSLRDAGHKCPV-DNEILMENQLF-----PDNFAKREILSLKVKCPSQGCTETMELRHLERHLGQCQFASVECSQCQ-GSFP----KSRLEKHMEHE 183          
BLAST of SMED30031239 vs. UniProt/SwissProt
Match: sp|Q9Y4K3|TRAF6_HUMAN (TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 4.567e-6
Identity = 35/100 (35.00%), Postives = 46/100 (46.00%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNENF-CPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCP 571
            C IC   L  A Q PCG  +CK CI   + +    CP   NE ++EN  F      DN A + +  L VKCP++ C +   L  +  H   C   L  CP
Sbjct:   70 CPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPV-DNEILLENQLF-----PDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCP 163          
BLAST of SMED30031239 vs. UniProt/SwissProt
Match: sp|Q2KHN1|RN151_HUMAN (RING finger protein 151 OS=Homo sapiens OX=9606 GN=RNF151 PE=1 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 5.131e-6
Identity = 39/126 (30.95%), Postives = 55/126 (43.65%), Query Frame = 2
Query:  266 NTSCIICHSLLINAYQGPCGCNYCKICIDNYLNNENFCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDD--CDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLY 637
            N  C +CH +L    + PC   +CK CI  +L  +  CP     C  + V  K  +   N   K + +L VKC + D  C   CPL     H   C   L  CP    GCT  ++ +  +AEH  +
Sbjct:   17 NFVCSVCHGVLKRPARLPCSHIFCKKCILRWLARQKTCP-----CCRKEVKRK-KVVHMNKLRKTIGRLEVKCKNADAGCIVTCPLAHRKGHQDSCPFELTACP--NEGCTS-QVPRGTLAEHRQH 133          
BLAST of SMED30031239 vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 7.497e-6
Identity = 35/100 (35.00%), Postives = 46/100 (46.00%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNENF-CPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCP 571
            C IC   L  A Q PCG  +CK CI   + +    CP   NE ++EN  F      DN A + +  L VKCP++ C +   L  +  H   C   L  CP
Sbjct:   70 CPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPV-DNEILLENQLF-----PDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCP 163          
BLAST of SMED30031239 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 2.351e-24
Identity = 62/190 (32.63%), Postives = 100/190 (52.63%), Query Frame = 2
Query:  206 EEMWTILETFNFRINKESLINTSCIICHSLLINAYQGPCGCNYCKICIDNYLNNEN-FCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSRMMIESMKHTKNEILSNISNQVIPVPLPNLENMIDLKLI 772
            E++  +L T+NF +      N  C +C +LL+NA Q  CGC +C  CI  Y++  N +CP  ++EC  EN+    +I  D   N++++K+ VKCP + C   C L+++  HLR+C    + CPF  LGC   KM    +  H+      HS+++I        +I+SN+ N    +    +E   D+ LI
Sbjct:    4 EKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLII--------DIISNMRNDFFGLTTKEVELREDINLI 185          
BLAST of SMED30031239 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.562e-17
Identity = 49/161 (30.43%), Postives = 91/161 (56.52%), Query Frame = 2
Query:  221 ILETFNFRINKESLINTS-CIICHSLLINAYQGPCGCNYCKICIDNYLN-NENFCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSRMMIESMKHTKNEI 697
            +L  +N +   ES+ N   CI+C+ L+ +A +  CGC+YC  CI  YL+ N N+CP    EC  + ++ +  + ++   + R+S++ VKCP+  C+Y   L+ +  HL  C      CP + +GC    + KD++A+H+  ++  H+++++      K+EI
Sbjct:   12 LLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEI 172          
BLAST of SMED30031239 vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.992e-10
Identity = 98/385 (25.45%), Postives = 153/385 (39.74%), Query Frame = 2
Query:  266 NTSCIICHSLLINAYQGPCGCNYCKICIDNYLNNENFCPSQSNECIIENVDFKMSITK---DNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVC--------------------NHVLKPCPFLEL---GCTPLKMNKDQIAEHMLYE----------ICPH---SRMMIESMKHTKNEILSNISNQVIPVPLPNLENMIDLKLIDFVKTFQNHQLSDQNKFSXXXXXXXXXXXXXXXXXXXINEITKDFETNISVLKEENISLNXXXXXXXXXXXXXXRPKHSSFQEISNQSDLTRMXXXXXXXXXKIEIGYLKWSV----KVNGNAIASESPWGTLSEKFYSPQQRYEMRLRMWMGGCQGSHKQSHICVEFTITTKDISD 1291
            N  C++C  +L++A Q  CGC YCK CIDNYL N         EC+ E  D +  IT    D + NK +S L VKC  + C +   L  +  HL  C                    NH+   C   E+    C  L   K+    H+ +E          ICP+       +  + H K       S +  P+  P       L + D  +     Q+++    S       E    +    +K+ +  K  E  +++L EEN  L   +++MK +      PK+S    IS  + L R +            G   W +    K+  NA+  ++P   LSE FY+    Y+M ++++  G  G  K +H+ + F I   D  D
Sbjct:   28 NLKCVMCQDILLDAIQTDCGCRYCKECIDNYLEN------GEKECVAEYEDCRSVITSYIYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYRNEMCSLCGMEYIIKEESNHLANECLLREVLCQYCRTLLTFKEYNESHLCFESRDLCGKYEAICPYGCTGESKVNLLHHRK-------SCENKPLECP-------LHVFDCKQLIPKDQMTEHLNTS-----SYEHTLTIVTELRKLEKQNKHMEERMNILIEENQLLKATLEVMKLDL-----PKNSG--SISRDTSLKRANKTI------FRNGKYMWKIKSFSKLRENAMRGKNP-TILSEAFYTSDFGYKMCMKIYPCG-DGVGKGTHLSIFFVIMKGDYDD 372          
BLAST of SMED30031239 vs. TrEMBL
Match: A0A4Z2GDW5 (TNF receptor-associated factor OS=Liparis tanakae OX=230148 GN=traf6 PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.081e-7
Identity = 36/102 (35.29%), Postives = 52/102 (50.98%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNENFCPSQSNECIIENVD-FKMSITKDNSANKRVSKLSVKCPSDDCDYMCPL--IEMNTHLRVCNHVLKPCP 571
            C IC   L NA Q PCG  +CK CI+  + +          C ++NV   +  +  DN A + +  L+V+CP+DDC+    L  +E +THL  C     PCP
Sbjct:   81 CPICLMALRNAIQTPCGHRFCKNCIEKSIRDAG------QRCPVDNVRLLEKQLFSDNFAKREILSLTVRCPNDDCEEKMELRQLEASTHLARCQFATAPCP 176          
BLAST of SMED30031239 vs. TrEMBL
Match: A0A0A1X2C8 (TNF receptor-associated factor 6 OS=Zeugodacus cucurbitae OX=28588 GN=Traf6 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 2.707e-7
Identity = 49/191 (25.65%), Postives = 81/191 (42.41%), Query Frame = 2
Query:  254 ESLINTSCIICHSLLINAYQGPCGCNYCKICIDNYLNNENFCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSD--DCDYMCPLIEMNTHLRVCNH-----VLKPCPFLELGCTPL-KMNKDQIAEHMLYEICPHSRMMIESMKHTK----------NEILSNISNQVIPVPLPNLENMIDLKLI 772
            ES     C IC   L       CG  +CK C+  +LNN N CP  + E  +E+      I  DN   + + ++  KCP+    C  +   IE++ HL  C +       + CPF  + C  + +   + + EH+  ++  H ++M+++ + T                   N V+P P P   N  D +LI
Sbjct:   68 ESEARYECAICIHWLNEPVITTCGHRFCKSCLTKWLNNHNQCPLDNTELSLEH-----DIFPDNFTRREIEQIKHKCPNSPLGCAVVASPIEVDRHLPTCPYRRLENAEEKCPFASIKCDFVGRPETNALEEHLKEDMPHHMQLMLQAFQQTAISTWNPQKPTTTASGGKVNGVLPPPPPQYANEADEQLI 253          
BLAST of SMED30031239 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 50.8322 bits (120), Expect = 2.594e-6
Identity = 39/134 (29.10%), Postives = 65/134 (48.51%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYL-NNENFCPSQSNECIIENVDFKMSIT-----KDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSR 658
            C  C+++L  A+Q  CG  YC+ C+   L NN++   ++  E      D  M +T      DN+ NK + +L V C +  C +   L +   H   C + L PC    +GC  + + K  +A H L + CP+++
Sbjct:   29 CSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGCGLMVLRK-TLATH-LEKGCPNNK 157          
BLAST of SMED30031239 vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 50.8322 bits (120), Expect = 2.847e-6
Identity = 39/134 (29.10%), Postives = 65/134 (48.51%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYL-NNENFCPSQSNECIIENVDFKMSIT-----KDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSR 658
            C  C+++L  A+Q  CG  YC+ C+   L NN++   ++  E      D  M +T      DN+ NK + +L V C +  C +   L +   H   C + L PC    +GC  + + K  +A H L + CP+++
Sbjct:   29 CSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGCGLMVLRK-TLATH-LEKGCPNNK 157          
BLAST of SMED30031239 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 47.7506 bits (112), Expect = 5.200e-6
Identity = 28/99 (28.28%), Postives = 46/99 (46.46%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNENFCPSQSNECIIEN-VDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPC 568
            C IC   L    Q PCG  +C+ CI + +   +  P    +C ++N V  +  +  DN A + +  L+V+CP+  C +   L  +  H   C +   PC
Sbjct:   65 CPICLMALREPVQTPCGHRFCRACILHSMRLRDAGP----KCPVDNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPC 159          
BLAST of SMED30031239 vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 50.0618 bits (118), Expect = 1.501e-6
Identity = 36/125 (28.80%), Postives = 54/125 (43.20%), Query Frame = 2
Query:  272 SCIICHSLLINAYQGPCGCNYCKICIDNYLNNENF--CPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYE 640
            +C ICH  L    Q  CG  +CK C+D     ++   CP        E +D K  +  D +A + +    VKCP   C +   L ++  H R C++ L  C          +M+ D   EH+L E
Sbjct:   24 TCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDR-----EPLDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCDYELVTCSNPMCSAQLPRMDVD---EHLLVE 140          
BLAST of SMED30031239 vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 50.0618 bits (118), Expect = 1.740e-6
Identity = 30/99 (30.30%), Postives = 47/99 (47.47%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNENFCPSQSNECIIENVDFKMS-ITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPC 568
            C ICH ++       CG +YCK CI+ + N +         C ++N   K S I  D   ++ V  L VKC ++ C +   L +   HL++C+H    C
Sbjct:   30 CAICHMVVNEPVLTSCGHSYCKYCIEKWCNGKEVVT-----CPVDNEQLKPSQIFPDKKTDRIVLSLEVKCTNNPCRWKGELRQKQKHLKICSHKAVKC 123          
BLAST of SMED30031239 vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 53.5286 bits (127), Expect = 4.383e-7
Identity = 42/130 (32.31%), Postives = 58/130 (44.62%), Query Frame = 2
Query:  275 CIICHSLLINAYQGPCGCNYCKICIDNYLNNEN-FCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSRM 661
            C IC   L NA Q  CG  +CK CI+  + +    CP   NE + E+  F      DN A + +  L+V+CP+ DC     L  +  HL  C     PC   +    P++  K  + EH   E CP   M
Sbjct:   78 CPICLMALRNAIQTRCGHRFCKSCIEKSIRDTGQRCPV-DNEMLSEDQLFP-----DNFAKREILSLTVRCPNSDCGEKMELRHLEKHLAQCQFATVPCSQCQ---QPVR--KSYLEEHATVE-CPRRPM 195          
BLAST of SMED30031239 vs. Planmine SMEST
Match: SMESG000075552.1 (SMESG000075552.1)

HSP 1 Score: 805.823 bits (2080), Expect = 0.000e+0
Identity = 440/446 (98.65%), Postives = 442/446 (99.10%), Query Frame = 2
Query:  194 MPNYEEMWTILETFNFRINKESLINTSCIICHSLLINAYQGPCGCNYCKICIDNYLNNENFCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSRMMIESMKHTKNEILSNISNQVIPVPLPNLENMIDLKLIDFVKTFQNHQLSDQNKFSXXXXXXXXXXXXXXXXXXXINEITKDFETNISVLKEENISLNXXXXXXXXXXXXXXRPKHSSFQEISNQSDLTRMXXXXXXXXXKIEIGYLKWSVKVNGNAIASESPWGTLSEKFYSPQQRYEMRLRMWMGGCQGSHKQSHICVEFTITTKDISDKVLLQTNWPITCSVSMTFRSVDEENDKNITEKRTLTFKEPDNFDLFSPWSSQFHFPISDLRKHSLITNNSILVQCYVYIN 1531
            MPNYEEMWTILETFNFRINKESLINTSCIICHSLLINAYQGPCGCNYCK CIDNYLNNENFCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSRMMIESMKHTKNEILSNISNQVIPVPLPNLENMIDLKLIDFVKTFQNHQLSDQNKFSKLKFEFDETKKELEKFEKKINEITKDFET+ISVLKEENISLNEK KIMKEEKEKCERPKHSSFQEISNQSDLTRMSSFESVSSSKIEIGYLKWSVKVNGNAIASESPWGTLSEKFYSPQQRYEMRLRMW+GGCQGSHKQSHICVEFTITTKDISDKVLLQTNWPITCSVSMTFRSVDEENDK ITEKRTLTFKEPDNFDLFSPWSSQFHFPISDL KHSLITNNSILVQCYVYIN
Sbjct:    1 MPNYEEMWTILETFNFRINKESLINTSCIICHSLLINAYQGPCGCNYCKNCIDNYLNNENFCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSRMMIESMKHTKNEILSNISNQVIPVPLPNLENMIDLKLIDFVKTFQNHQLSDQNKFSKLKFEFDETKKELEKFEKKINEITKDFETDISVLKEENISLNEKRKIMKEEKEKCERPKHSSFQEISNQSDLTRMSSFESVSSSKIEIGYLKWSVKVNGNAIASESPWGTLSEKFYSPQQRYEMRLRMWIGGCQGSHKQSHICVEFTITTKDISDKVLLQTNWPITCSVSMTFRSVDEENDKKITEKRTLTFKEPDNFDLFSPWSSQFHFPISDLMKHSLITNNSILVQCYVYIN 446          
BLAST of SMED30031239 vs. Planmine SMEST
Match: SMESG000075552.1 (SMESG000075552.1)

HSP 1 Score: 644.81 bits (1662), Expect = 0.000e+0
Identity = 360/366 (98.36%), Postives = 362/366 (98.91%), Query Frame = 2
Query:  434 TKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSRMMIESMKHTKNEILSNISNQVIPVPLPNLENMIDLKLIDFVKTFQNHQLSDQNKFSXXXXXXXXXXXXXXXXXXXINEITKDFETNISVLKEENISLNXXXXXXXXXXXXXXRPKHSSFQEISNQSDLTRMXXXXXXXXXKIEIGYLKWSVKVNGNAIASESPWGTLSEKFYSPQQRYEMRLRMWMGGCQGSHKQSHICVEFTITTKDISDKVLLQTNWPITCSVSMTFRSVDEENDKNITEKRTLTFKEPDNFDLFSPWSSQFHFPISDLRKHSLITNNSILVQCYVYIN 1531
             KDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSRMMIESMKHTKNEILSNISNQVIPVPLPNLENMIDLKLIDFVKTFQNHQLSDQNKFSKLKFEFDETKKELEKFEKKINEITKDFET+ISVLKEENISLNEK KIMKEEKEKCERPKHSSFQEISNQSDLTRMSSFESVSSSKIEIGYLKWSVKVNGNAIASESPWGTLSEKFYSPQQRYEMRLRMW+GGCQGSHKQSHICVEFTITTKDISDKVLLQTNWPITCSVSMTFRSVDEENDK ITEKRTLTFKEPDNFDLFSPWSSQFHFPISDL KHSLITNNSILVQCYVYIN
Sbjct:    7 VKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSRMMIESMKHTKNEILSNISNQVIPVPLPNLENMIDLKLIDFVKTFQNHQLSDQNKFSKLKFEFDETKKELEKFEKKINEITKDFETDISVLKEENISLNEKRKIMKEEKEKCERPKHSSFQEISNQSDLTRMSSFESVSSSKIEIGYLKWSVKVNGNAIASESPWGTLSEKFYSPQQRYEMRLRMWIGGCQGSHKQSHICVEFTITTKDISDKVLLQTNWPITCSVSMTFRSVDEENDKKITEKRTLTFKEPDNFDLFSPWSSQFHFPISDLMKHSLITNNSILVQCYVYIN 372          
BLAST of SMED30031239 vs. Planmine SMEST
Match: SMESG000009561.1 (SMESG000009561.1)

HSP 1 Score: 145.591 bits (366), Expect = 3.002e-38
Identity = 74/171 (43.27%), Postives = 100/171 (58.48%), Query Frame = 2
Query:  194 MPNYEEMWTILETFNFRINKESLINTSCIICHSLLINAYQGPCGCNYCKICIDNYLNNEN-FCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSRMMIESMKHTKNEILS 703
            M    +MWTIL+ + F I+ + LI   C IC+ LL NAYQGPC CNYCK CI+ YL ++   CP  S EC  E +  +  I KD  A+ RVS+L V+CP + C +   L+ M+ HLR CN     CPF ELGC  +      I +H+L  IC HS+++   +   KNE L+
Sbjct:    1 MEKLVKMWTILDKYPFEIDPKVLIYVKCSICNGLLRNAYQGPCCCNYCKTCIEIYLGDDRKHCPGDSIECRQEQISMRNHIIKDRGADYRVSQLDVRCPWNSCRFQGKLLNMDDHLRTCNKSPIECPFTELGCQTILTENINIKDHLLDNICQHSKLISNWITILKNETLN 171          
BLAST of SMED30031239 vs. Planmine SMEST
Match: SMESG000009561.1 (SMESG000009561.1)

HSP 1 Score: 144.821 bits (364), Expect = 5.230e-38
Identity = 73/165 (44.24%), Postives = 98/165 (59.39%), Query Frame = 2
Query:  212 MWTILETFNFRINKESLINTSCIICHSLLINAYQGPCGCNYCKICIDNYLNNEN-FCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSRMMIESMKHTKNEILS 703
            MWTIL+ + F I+ + LI   C IC+ LL NAYQGPC CNYCK CI+ YL ++   CP  S EC  E +  +  I KD  A+ RVS+L V+CP + C +   L+ M+ HLR CN     CPF ELGC  +      I +H+L  IC HS+++   +   KNE L+
Sbjct:    1 MWTILDKYPFEIDPKVLIYVKCSICNGLLRNAYQGPCCCNYCKTCIEIYLGDDRKHCPGDSIECRQEQISMRNHIIKDRGADYRVSQLDVRCPWNSCRFQGKLLNMDDHLRTCNKSPIECPFTELGCQTILTENINIKDHLLDNICQHSKLISNWITILKNETLN 165          
BLAST of SMED30031239 vs. Planmine SMEST
Match: SMESG000012339.1 (SMESG000012339.1)

HSP 1 Score: 142.124 bits (357), Expect = 7.209e-37
Identity = 69/160 (43.12%), Postives = 100/160 (62.50%), Query Frame = 2
Query:  194 MPNYEEMWTILETFNFRINKESLINTSCIICHSLLINAYQGPCGCNYCKICIDNYLNNE-NFCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSDDCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEICPHSRMMIE 670
            M +Y  MW ++E + F I+ +  I   CIIC++LL +A QGPCGC YCK CID YL N   FCP    +C    +D   +I KDNSAN +VSKL V CP + C++   LIEM+ HL+ C+ +   CP+ E+GCT   M  D++ +H+  EI  H+ ++++
Sbjct:    1 MAHYLFMWKMMEQYQFDIDPQLSIYVKCIICNNLLNDACQGPCGCLYCKKCIDKYLANSMKFCPGNHKDCKSSKLDIFSNIVKDNSANNKVSKLIVICPGEGCNFQSTLIEMSNHLQNCDKLPFWCPYAEIGCTTNTMLTDELVDHLQTEIVAHNNLLVK 160          
The following BLAST results are available for this feature:
BLAST of SMED30031239 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TRAF69.509e-735.00TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF69.509e-735.00TNF receptor associated factor 6 [Source:HGNC Symb... [more]
RNF1511.068e-630.95ring finger protein 151 [Source:HGNC Symbol;Acc:HG... [more]
RNF1511.129e-630.95ring finger protein 151 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of SMED30031239 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031239 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf66.551e-623.42gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of SMED30031239 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lnx13.717e-634.44ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GE... [more]
lnx13.896e-634.44ligand of numb-protein X 1 [Source:ZFIN;Acc:ZDB-GE... [more]
traf65.515e-630.47TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf65.515e-630.47TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf65.515e-630.47TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of SMED30031239 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
egf2.792e-635.35epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of SMED30031239 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf63.148e-635.00TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
back to top
BLAST of SMED30031239 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3ZCC3|TRAF6_BOVIN3.327e-635.00TNF receptor-associated factor 6 OS=Bos taurus OX=... [more]
sp|Q6DJN2|TRF6B_XENLA3.714e-634.15TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|Q9Y4K3|TRAF6_HUMAN4.567e-635.00TNF receptor-associated factor 6 OS=Homo sapiens O... [more]
sp|Q2KHN1|RN151_HUMAN5.131e-630.95RING finger protein 151 OS=Homo sapiens OX=9606 GN... [more]
sp|B6CJY5|TRAF6_MACMU7.497e-635.00TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
back to top
BLAST of SMED30031239 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID82.351e-2432.63TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1014.562e-1730.43TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T1DBK64.992e-1025.45TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A4Z2GDW51.081e-735.29TNF receptor-associated factor OS=Liparis tanakae ... [more]
A0A0A1X2C82.707e-725.65TNF receptor-associated factor 6 OS=Zeugodacus cuc... [more]
back to top
BLAST of SMED30031239 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
traf12.594e-629.10TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf12.847e-629.10TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of SMED30031239 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf65.200e-628.28TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of SMED30031239 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031239 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO412431.501e-628.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483941.740e-630.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30031239 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf64.383e-732.31TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of SMED30031239 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075552.10.000e+098.65SMESG000075552.1[more]
SMESG000075552.10.000e+098.36SMESG000075552.1[more]
SMESG000009561.13.002e-3843.27SMESG000009561.1[more]
SMESG000009561.15.230e-3844.24SMESG000009561.1[more]
SMESG000012339.17.209e-3743.13SMESG000012339.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031239 ID=SMED30031239|Name=SMED30031239|organism=Schmidtea mediterranea sexual|type=transcript|length=1560bp
AAATAGTCTATTAGTTCACAGAGGAATTTCATTCCTGTTCAGTGACCAAA
ATGTAGTCTCGTATTTTATTGAATTCCTATTGGTTGCTTTTTGTAATGCA
TGCATGCATTCATAATGTATGGGATCGTAGCGCTAAATAAATCGATTCCT
TGGAATTTTTATACATAATTTTGTAAATAATCTGACTTATTAAATGCCAA
ATTATGAAGAAATGTGGACAATTTTGGAAACCTTTAATTTCAGAATCAAT
AAGGAGTCATTAATTAATACCTCATGCATTATATGCCACAGCTTACTGAT
AAACGCATATCAAGGCCCATGCGGATGTAACTATTGTAAAATTTGCATTG
ATAATTATTTGAACAATGAAAATTTTTGTCCAAGTCAAAGTAATGAATGT
ATCATTGAAAATGTTGACTTTAAAATGAGTATTACCAAGGATAATAGTGC
AAATAAACGAGTTTCCAAATTATCAGTCAAATGTCCATCAGATGACTGTG
ACTACATGTGTCCATTGATTGAAATGAATACTCATTTGAGAGTTTGCAAT
CACGTTCTGAAGCCATGCCCCTTTCTAGAGCTTGGATGTACTCCACTGAA
AATGAATAAAGACCAAATTGCTGAGCATATGTTATATGAAATATGTCCAC
ATAGTCGAATGATGATAGAGTCGATGAAACATACAAAAAACGAAATCCTA
TCCAACATTTCTAATCAGGTTATTCCTGTTCCTTTGCCAAATTTAGAAAA
TATGATTGATTTAAAACTGATTGATTTCGTTAAAACCTTCCAAAATCATC
AGTTGAGTGATCAAAACAAATTTTCGAAGTTAAAATTTGAATTTGATGAA
ACTAAAAAGGAATTAGAAAAATTCGAGAAAAAGATTAATGAAATTACTAA
AGATTTTGAAACCAATATTTCAGTATTAAAGGAAGAAAACATTAGTTTAA
ATGAAAAAATAAAAATAATGAAAGAAGAAAAAGAAAAATGTGAACGACCA
AAACATTCGAGTTTCCAAGAAATTTCCAACCAATCAGATTTGACTCGTAT
GAGCTCGTTTGAAAGCGTGAGTAGCTCTAAGATAGAAATCGGATACCTTA
AATGGTCAGTGAAGGTTAATGGAAATGCTATTGCTTCGGAGTCTCCGTGG
GGAACGCTTAGTGAAAAGTTCTATTCTCCTCAACAGCGATACGAAATGAG
ATTGCGTATGTGGATGGGTGGATGTCAAGGTAGTCATAAACAATCTCACA
TTTGTGTTGAGTTTACTATCACCACTAAAGATATTAGTGATAAAGTTCTC
CTTCAGACCAACTGGCCAATTACTTGCAGTGTATCAATGACTTTCAGATC
TGTCGATGAGGAAAATGACAAAAATATTACCGAAAAAAGAACTTTAACGT
TCAAAGAACCGGATAATTTCGATTTATTCTCTCCTTGGTCTTCGCAATTC
CATTTCCCCATTTCTGATTTGAGGAAACACTCTTTGATAACCAATAACTC
AATCCTTGTCCAATGCTATGTCTATATTAACTAATAAATTTTTTATTTTT
TAAAAAAAAA
back to top

protein sequence of SMED30031239-orf-1

>SMED30031239-orf-1 ID=SMED30031239-orf-1|Name=SMED30031239-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=447bp
MPNYEEMWTILETFNFRINKESLINTSCIICHSLLINAYQGPCGCNYCKI
CIDNYLNNENFCPSQSNECIIENVDFKMSITKDNSANKRVSKLSVKCPSD
DCDYMCPLIEMNTHLRVCNHVLKPCPFLELGCTPLKMNKDQIAEHMLYEI
CPHSRMMIESMKHTKNEILSNISNQVIPVPLPNLENMIDLKLIDFVKTFQ
NHQLSDQNKFSKLKFEFDETKKELEKFEKKINEITKDFETNISVLKEENI
SLNEKIKIMKEEKEKCERPKHSSFQEISNQSDLTRMSSFESVSSSKIEIG
YLKWSVKVNGNAIASESPWGTLSEKFYSPQQRYEMRLRMWMGGCQGSHKQ
SHICVEFTITTKDISDKVLLQTNWPITCSVSMTFRSVDEENDKNITEKRT
LTFKEPDNFDLFSPWSSQFHFPISDLRKHSLITNNSILVQCYVYIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR008974TRAF-like
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 242..265
NoneNo IPR availableCOILSCoilCoilcoord: 210..237
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 27..444
NoneNo IPR availableCDDcd16449RING-HCcoord: 28..63
e-value: 1.43062E-5
score: 39.7581
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 27..68
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 304..445
e-value: 1.8E-9
score: 39.5
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 301..445
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 92..154
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 14..126
e-value: 1.2E-12
score: 49.9
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 27..444
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 28..63
score: 9.126