deleted in lung and esophageal cancer protein 1

Overview
Namedeleted in lung and esophageal cancer protein 1
Smed IDSMED30031219
Length (bp)5047
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of deleted in lung and esophageal cancer protein 1 (SMED30031219) t-SNE clustered cells

Violin plots show distribution of expression levels for deleted in lung and esophageal cancer protein 1 (SMED30031219) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of deleted in lung and esophageal cancer protein 1 (SMED30031219) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for deleted in lung and esophageal cancer protein 1 (SMED30031219) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Human
Match: DLEC1 (DLEC1 cilia and flagella associated protein [Source:HGNC Symbol;Acc:HGNC:2899])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 486/1734 (28.03%), Postives = 846/1734 (48.79%), Query Frame = 1
Query:   55 SQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDE--MTKEKNKDFEYL-NLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNL----QNNRIESLSRESSFSDLNSSPLITNRKDDKVL--SSKKK---------------EYRLPPIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNK-------------DSCS-QKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGS-GKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTN------DTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNE--PKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDIEAG-----------KLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVIIPVSITVVGSPLE----FTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRSTDNFISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDH-NLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIG-NGKNIENREIKIGETIKVPVKFVLDREQILLLKDENLYGH--NESHCLKIERQLLPNEQ-------QRTA---KMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASY--LFLKLVNPTDS--VFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKY 5016
            S   + DISH++   F  L+SA+ +  E+  +L  ++GS ++ H E+V++L  I    +      + L  HI  A+  A+ ++E  M++   +D E L  LP  +S     ID+ LLR + LI+PED +T+        +  SL   S  +       +  ++ +K L  S +KK                + L P  K  T++ +KK    + +N  + +   ++   + +L  M ++N+FLKNPR+  P+     K+ +    K              SC+   +FL  P +  F+DYE+G VY+ +I  +N TT  R +RVLPP T YF+LGLG FPG+ G+VA G++CQY ++F PD LGD++D I+VETQ   +  + +  +RP P+LT S   D  YCLI G+K+  +  KN+G S G+FCI         + KA+         PF I PS FEL     I +E++F P SLGK E+ F I+CDNC   +    G G++  + +  + G  S P+  E TD++AQ  ++F P N  + ++K +I++N +H E+ F W+I+KPNL+   +  E   ++ +K    D E+AF I P+ GV  P+    F ++F+P E++  HSV  +VL+ + +    + +S+                                    +++DV  LEIEVKG+  P +V     ++I+PGE  I   V+K  ++ N S  P+  +W K  S+  I EVEP  G+I+  E+G  ++      PG     LLC ++    P+ L +EA FKGP L I+ + L FGL+++ +    S+++ N S +  TWR +    +      D S F+   I P  G L  L    V I     H + +   +E  +E+G+  +L V A  Q P V L SS+++V   L++  P+  TI L N + L + F+W   +G  AE   +   P  G++ P+ + ++KL +T   Q EL  + LPC + G+  P+ L ISGK  G  + +TI ++    + E  P     L+ L+FG  + +     R L++ N + I T F +  ++F +  N +              K ++++ +LA R+         DF +SML    G A   + S G L  Y ++ I+++   +MWGEY D +          +   +IPV +  VG P+      + T  + +++P +R G++  G +  +R +R+NN S CDI ++WE Y  + D +++++++++ Y  PFP+     +  +  D+     +  +           +      +  SS      ++ R     IS+ ++ HEG+ S       P+Q+V+P+     + ++F P  +  E  L   E  G     Y LGF+SL+      +  +  R   + V  +KLD+ + +    L V+    D    + F    S L+ +     +L++  + T +L L N  +    F L    PF +  +G + ++R    G+  +   +     +Q++L   EN+  +         +  Q LP +Q       Q++A   + + F   L + Y N +  Q++ +RA +  PE  +S S ++F TCF+ +     + ++N S   SY  + +    P  +   F ++  +GL++    N+  + + +Q+ FT + +  Y +++++ G++GE+  ++ +  +GSYD +Y
Sbjct:   85 SSLRTQDISHLLTGVFRNLYSAEVIGDEVSASLIKARGSENERHEEFVDQLQQIRELYKQRLDEFEMLERHITQAQARAIAENERVMSQAGVQDLESLVRLPPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRNKNWMNHLRVPQRELDRLLLARMESRNHFLKNPRFFPPNTRYGGKSLVFPPKKPAPIGEFQSTEPEQSCADTPVFLAKPPIGFFTDYEIGPVYEMVIALQNTTTTSRYLRVLPPSTPYFALGLGMFPGKGGMVAPGMTCQYIVQFFPDCLGDFDDFILVETQSAHTLLIPLQARRPPPVLTLSPVLDCGYCLIGGVKMTRFICKNVGFSVGRFCIMPKTSWPPLSFKAIATVGFVEQPPFGILPSVFELAPGHAILVEVLFSPKSLGKAEQTFIIMCDNCQIKELVTIGIGQLIALDLIYISGEKSQPDPGELTDLTAQHFIRFEPENLRSTARKQLIIRNATHVELAFYWQIMKPNLQPL-MPGETFSMDSIKCYP-DKETAFSIMPRKGVLSPHTDHEFILSFSPHELRDFHSVLQMVLEEVPEPVSSEAESLGHS-------------------------------SYSVDDVIVLEIEVKGSVEPFQVLLEPYALIIPGENYIGINVKKAFKMWNNSKSPIRYLWGK-ISDCHIIEVEPGTGVIEPSEVGDFELNFTGGVPGPTSQDLLCEIEDSPSPVVLHIEAVFKGPALIINVSALQFGLLRLGQKATNSIQIRNVSQLPATWRMKESPVSLQERPEDVSPFD---IEPSSGQLHSLGECRVDITLEALHCQHLETVLELEVENGAWSYLPVYAEVQKPHVYLQSSQVEVRN-LYLGVPTKTTITLINGTLLPTQFHWGKLLGHQAEFCMVTVSPKHGLLGPSEECQLKLELTAHTQEELTHLALPCHVSGMKKPLVLGISGKPQGLQVAITISKESSDCSTEQWPGHPKELR-LDFGSAVPLRTRVTRQLILTNRSPIRTRFSLKFEYFGSPQNSLSKKTSLPNMPPALLKTVRMQEHLAKRE-------QLDFMESMLSHGKGAAFFPHFSQGMLGPYQQLCIDITGCANMWGEYWDNL----ICTVGDLLPEVIPVHMAAVGCPISSLRTTSYTIDQAQKEPAMRFGTQVSGGDTVTRTLRLNNSSPCDIRLDWETYVPE-DKEDRLVELLVFYGPPFPLRDQAGNELVCPDTPEGGCLLWSPGPS-------SSSEFSHETDSSVEGSSSASNRVAQKLISVILQAHEGVPSGHLYCISPKQVVVPAGGSSTIYISFTPMVLSPEI-LHKVECTG-----YALGFMSLDSKVEREIPGKRHRLQDFAVGPLKLDLHSYVRPAQLSVEL---DYGGSMEFQCQASDLIPEQPCSGVLSELVT-THHLKLTNTTEIPHYFRLMVSRPFSVSQDGASQDHRAPGPGQKQECEEETASADKQLVLQAQENMLVNVSFSLSLELLSYQKLPADQTLPGVDIQQSASGEREMVFTQNLLLEYTN-QTTQVVPLRAVVAVPELQLSTSWVDFGTCFVSQQRVREVYLMNLSGCRSYWTMLMGQQEPAKAAVAFRVSPNSGLLEARSANAPPTSIALQVFFTARSSELYESTMVVEGVLGEKSCTLRLRGQGSYDERY 1749          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Human
Match: DLEC1 (DLEC1 cilia and flagella associated protein [Source:HGNC Symbol;Acc:HGNC:2899])

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 469/1653 (28.37%), Postives = 802/1653 (48.52%), Query Frame = 1
Query:   55 SQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDE--MTKEKNKDFEYL-NLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNL----QNNRIESLSRESSFSDLNSSPLITNRKDDKVL--SSKKK---------------EYRLPPIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNK-------------DSCSQ-KMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGS-GKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTN------DTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNE--PKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDIEAG-----------KLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVIIPVSITVVGSPLE----FTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRSTDNFISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDH-NLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIG-NGKNIENREIKIGETIKVPVKFVLDREQILLLKDENLYGH--NESHCLKIERQLLPNEQ-------QRTA---KMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASY 4785
            S   + DISH++   F  L+SA+ +  E+  +L  ++GS ++ H E+V++L  I    +      + L  HI  A+  A+ ++E  M++   +D E L  LP  +S     ID+ LLR + LI+PED +T+        +  SL   S  +       +  ++ +K L  S +KK                + L P  K  T++ +KK    + +N  + +   ++   + +L  M ++N+FLKNPR+  P+     K+ +    K              SC+   +FL  P +  F+DYE+G VY+ +I  +N TT  R +RVLPP T YF+LGLG FPG+ G+VA G++CQY ++F PD LGD++D I+VETQ   +  + +  +RP P+LT S   D  YCLI G+K+  +  KN+G S G+FCI         + KA+         PF I PS FEL     I +E++F P SLGK E+ F I+CDNC   +    G G++  + +  + G  S P+  E TD++AQ  ++F P N  + ++K +I++N +H E+ F W+I+KPNL+   +  E   ++ +K    D E+AF I P+ GV  P+    F ++F+P E++  HSV  +VL+ + +    + +S+                                    +++DV  LEIEVKG+  P +V     ++I+PGE  I   V+K  ++ N S  P+  +W K  S+  I EVEP  G+I+  E+G  ++      PG     LLC ++    P+ L +EA FKGP L I+ + L FGL+++ +    S+++ N S +  TWR +    +      D S F+   I P  G L  L    V I     H + +   +E  +E+G+  +L V A  Q P V L SS+++V   L++  P+  TI L N + L + F+W   +G  AE   +   P  G++ P+ + ++KL +T   Q EL  + LPC + G+  P+ L ISGK  G  + +TI ++    + E  P     L+ L+FG  + +     R L++ N + I T F +  ++F +  N +              K ++++ +LA R+         DF +SML    G A   + S G L  Y ++ I+++   +MWGEY D +          +   +IPV +  VG P+      + T  + +++P +R G++  G +  +R +R+NN S CDI ++WE Y  + D +++++++++ Y  PFP+     +  +  D+     +  +           +      +  SS      ++ R     IS+ ++ HEG+ S       P+Q+V+P+     + ++F P  V + + L   E  G     Y LGF+SL+      +  +  R   + V  +KLD+ + +    L V+    D    + F    S L+ +     +L++  + T +L L N  +    F L    PF +  +G + ++R    G+  +   +     +Q++L   EN+  +         +  Q LP +Q       Q++A   + + F   L + Y N +  Q++ +RA +  PE  +S S ++F TCF+ +     + ++N S   SY
Sbjct:   85 SSLRTQDISHLLTGVFRNLYSAEVIGDEVSASLIKARGSENERHEEFVDQLQQIRELYKQRLDEFEMLERHITQAQARAIAENERVMSQAGVQDLESLVRLPPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRNKNWMNHLRVPQRELDRLLLARMESRNHFLKNPRFFPPNTRYGGKSLVFPPKKPAPIGEFQSTEPEQSCADTPVFLAKPPIGFFTDYEIGPVYEMVIALQNTTTTSRYLRVLPPSTPYFALGLGMFPGKGGMVAPGMTCQYIVQFFPDCLGDFDDFILVETQSAHTLLIPLQARRPPPVLTLSPVLDCGYCLIGGVKMTRFICKNVGFSVGRFCIMPKTSWPPLSFKAIATVGFVEQPPFGILPSVFELAPGHAILVEVLFSPKSLGKAEQTFIIMCDNCQIKELVTIGIGQLIALDLIYISGEKSQPDPGELTDLTAQHFIRFEPENLRSTARKQLIIRNATHVELAFYWQIMKPNLQPL-MPGETFSMDSIKCYP-DKETAFSIMPRKGVLSPHTDHEFILSFSPHELRDFHSVLQMVLEEVPEPVSSEAESLGHS-------------------------------SYSVDDVIVLEIEVKGSVEPFQVLLEPYALIIPGENYIGINVKKAFKMWNNSKSPIRYLWGK-ISDCHIIEVEPGTGVIEPSEVGDFELNFTGGVPGPTSQDLLCEIEDSPSPVVLHIEAVFKGPALIINVSALQFGLLRLGQKATNSIQIRNVSQLPATWRMKESPVSLQERPEDVSPFD---IEPSSGQLHSLGECRVDITLEALHCQHLETVLELEVENGAWSYLPVYAEVQKPHVYLQSSQVEVRN-LYLGVPTKTTITLINGTLLPTQFHWGKLLGHQAEFCMVTVSPKHGLLGPSEECQLKLELTAHTQEELTHLALPCHVSGMKKPLVLGISGKPQGLQVAITISKESSDCSTEQWPGHPKELR-LDFGSAVPLRTRVTRQLILTNRSPIRTRFSLKFEYFGSPQNSLSKKTSLPNMPPALLKTVRMQEHLAKRE-------QLDFMESMLSHGKGAAFFPHFSQGMLGPYQQLCIDITGCANMWGEYWDNL----ICTVGDLLPEVIPVHMAAVGCPISSLRTTSYTIDQAQKEPAMRFGTQVSGGDTVTRTLRLNNSSPCDIRLDWETYVPE-DKEDRLVELLVFYGPPFPLRDQAGNELVCPDTPEGGCLLWSPGPS-------SSSEFSHETDSSVEGSSSASNRVAQKLISVILQAHEGVPSGHLYCISPKQVVVPAGGSSTIYISFTP-MVLSPEILHKVECTG-----YALGFMSLDSKVEREIPGKRHRLQDFAVGPLKLDLHSYVRPAQLSVEL---DYGGSMEFQCQASDLIPEQPCSGVLSELVT-THHLKLTNTTEIPHYFRLMVSRPFSVSQDGASQDHRAPGPGQKQECEEETASADKQLVLQAQENMLVNVSFSLSLELLSYQKLPADQTLPGVDIQQSASGEREMVFTQNLLLEYTN-QTTQVVPLRAVVAVPELQLSTSWVDFGTCFVSQQRVREVYLMNLSGCRSY 1668          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Human
Match: DLEC1 (DLEC1 cilia and flagella associated protein [Source:HGNC Symbol;Acc:HGNC:2899])

HSP 1 Score: 61.2326 bits (147), Expect = 8.919e-11
Identity = 29/60 (48.33%), Postives = 40/60 (66.67%), Query Frame = 1
Query:  778 KDSCSQK-MFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQ 954
            + SC+   +FL  P +  F+DYE+G VY+ +I  +N TT  R +RVLPP T YF+LGLG 
Sbjct:   17 EQSCADTPVFLAKPPIGFFTDYEIGPVYEMVIALQNTTTTSRYLRVLPPSTPYFALGLGH 76          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Human
Match: CFAP221 (cilia and flagella associated protein 221 [Source:HGNC Symbol;Acc:HGNC:33720])

HSP 1 Score: 59.3066 bits (142), Expect = 3.454e-9
Identity = 38/122 (31.15%), Postives = 62/122 (50.82%), Query Frame = 1
Query:  733 PDCSNESKNWLIQSNKDS--CSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKI 1092
            P    E  N L++S   +   + K+    P ++ F  Y+V K +Q++++  N++    R+ +LPP+TKYF +   +   E  LV  G+S    + FSPD    Y D I V  +GD +  V I
Sbjct:   23 PKKRKEVPNHLLESKVYAKLVNNKVIQARPGIIHFGGYQVEKQHQQILHLVNVSNEDTRVHILPPQTKYFEINYVR--KEHHLV-PGLSLTVTVTFSPDEWRYYYDCIRVHCKGDDTLLVPI 141          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Human
Match: CFAP221 (cilia and flagella associated protein 221 [Source:HGNC Symbol;Acc:HGNC:33720])

HSP 1 Score: 58.9214 bits (141), Expect = 6.435e-9
Identity = 38/122 (31.15%), Postives = 62/122 (50.82%), Query Frame = 1
Query:  733 PDCSNESKNWLIQSNKDS--CSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKI 1092
            P    E  N L++S   +   + K+    P ++ F  Y+V K +Q++++  N++    R+ +LPP+TKYF +   +   E  LV  G+S    + FSPD    Y D I V  +GD +  V I
Sbjct:   33 PKKRKEVPNHLLESKVYAKLVNNKVIQARPGIIHFGGYQVEKQHQQILHLVNVSNEDTRVHILPPQTKYFEINYVR--KEHHLV-PGLSLTVTVTFSPDEWRYYYDCIRVHCKGDDTLLVPI 151          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Zebrafish
Match: dlec1 (DLEC1 cilia and flagella associated protein [Source:ZFIN;Acc:ZDB-GENE-091204-65])

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 482/1744 (27.64%), Postives = 821/1744 (47.08%), Query Frame = 1
Query:   73 DISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEK-----NKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNLQNNRIESLSRESS--FSDLNSS---PLITNRKDDKVLSSKKKEYRLPP--------IEKPATQDQIKKRKSEKKRNPTDMML-----------ASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLI----------QSNKDSCSQKM------FLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIG-GSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKFENGLKTLNFGKN--IAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDIEAGKLIKLRPNLADRQSKP-QKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGR---KEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDIN-----LDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRS--------TDNFISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVK---NEKELQFDENEGASFDNYLLGFLSLEDH-NLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLT----LRNLKDAEMKFTLKTRSPFEI-----------------------GNGKNIENREIKIGETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASYLFLKLVNPTDSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKY 5016
            DISH++   F  L+S + +  + + NL  S+   +  H +YVEEL  + +E     +N+  L  HI+ A+ +A   +E  + K      + ++ L LP  +S F   +D+ LLR N LI P D +T + N  ++S    SS  F+    S    + T  +DD           LPP        +E       +         N T++ L           A    + +A L+    ++ FL NPR+L+P+  +  K+ +I          +S K++  + +      F   P V+ FSDY VG+VY+  +  +N+T   R IR++PP + +FS+GLG+FPGE G+VA G+SCQY +RF+PDSL DYED +VVETQ      + I   R  PILT     D  +CL+ G+K +    +N G  +G FC+         + ++ + S  T   PF I PS F L   +   +E++F PT+     ++F I+CDNC      + G G++  + + +V GG   PE  E  DI+A   ++F   NP++  QKT+++KN +H E+P+ W+I+KP+L+   +  E  D + +++  LD +SAF I P  G+  P +   F +T+AP ++K +HSV HLV+  +    P   K  D+G                    +LH            N+VT LE+EVKG++ P K+     ++++PGE  I+  + K  ++ N S   +   W +   +  + EVEP  G+I+  E   +++ +    PG F  TL CH+      I L +EA FKGP   ++   LDFGL+++      ++++ N S ++  W   V       +  ++ INP  G+L  L+S +V + F   H ++    ++ S+ +G+   +++ A  QSP V L + +L  +  L+V    T ++ L NQ+ L + F W    G  A L S  F P  G + PN KT+V ++ T     +L ++   C ++G+++P+ L I  K     L V+ +  + +  N    ++    L+F ++    I ++ KR LLI N T+I   F +  ++F         G   +        Q+K  Q+ A  +F   +L    G      P SG L  ++   I ++ + +MWG+Y D +      +N +     I + ++V G P+ F M   +   + Q P++R GS   G +  SR +R+ N S  DI ++W  Y  +   D K++D++L+  +PF    PLKD+D N     LDS         +S+        +      D+F    +E      S             S+ ++PHEG +S+ P    P+Q V+P+     + ++F P  +    N++ L            Y LGF+SL+    L+   ++ R   YE++ ++LD+ A +    L V   +  E  E S           A +D L   S++  S +T    L+N  D  + F L T  PF +                       G G  +    ++    I+V V F        LL   N  G  E    ++   LL ++     K +QF++ LT+ Y+N  + Q + + A++  P   +S + ++F TC++ +T    I + N+  S SY     +   + VF ++  +GL++     +   +L +QI FTP++  ++     + G++GE  + + +S RGS+D  +
Sbjct:   31 DISHLLASIFNDLYSTEVIGKDTVSNLSKSRRRGNSYHEKYVEELQQVHSEYNRRIQNADMLETHIIQARLQAAAKEEHDRNKILEEVGEAYQQLGLPPVKSAFKWCVDSGLLRSNSLICPLD-YTTVHNPVVKSPKARSSPGFAKPTFSYNMHISTELQDDGYTP-------LPPHAHSAHSLLEYSEETITLSSSPESSSINDTELGLVAKASWMEKTSAKSHAEDRASLKKHKDRHKFLHNPRFLLPNTQHGGKSLIIPGKKKLENVGKSRKNNGRESLEGHAPIFTANPPVIFFSDYRVGQVYETSVELKNMTASSRHIRMIPPTSPHFSVGLGRFPGEGGIVAPGMSCQYMVRFAPDSLADYEDALVVETQMLYPLIIPIEACRSPPILTLPAVMDCGFCLVGGVKFMEVLCRNEGLSAGTFCVMPKKQWPASSLRSAVKSTFTEQPPFAISPSIFGLHPGQATVIEVVFFPTTPELSTQDFTIVCDNCQVKDITLQGTGQLITVELLSVSGGEDQPEFAELCDITADHYVRFNTTNPHSTLQKTLVVKNNTHLELPYHWQIMKPSLQ-CLLPGETPDPSSIQH-LLDTDSAFSISPVIGILNPAQEHEFLLTYAPKDIKDYHSVCHLVIMDV----PSPPKVCDDGTCP---------------DTALHA-----------NNVTILEVEVKGSTEPYKILLEPYAVLIPGETYIHNTICKRFKMWNHSKSVIHFEWER-VIDSHVIEVEPSSGVIEMNECFDMELYLTGRSPGHFTSTLQCHILHHPKTIGLAIEATFKGPHCSLNVPSLDFGLLQMGNERILTIEVTNNSLLDAHWSLEVLSQTQKLIDGQVHINPNKGVLAALESCSVDVAFRAMHCQVFESVLQLSVLNGTGCHVSIHAVVQSPQVCLLNCELLFAD-LYVGVSQTGSVTLFNQTLLPAHFTWGRLQGSQAHLCSAVFSPSAGSLGPNAKTEVSVSFTAHTVEDLTEVNGVCEVKGMENPLVLGIFSK--AKPLRVS-YSLLCNGINSGDGDHQPILLDFTEHEPAVIGKSVKRQLLITNNTAITAPFTVDTEYFTGDCPSQSEGNSERSSAPFHSIQAKKIQQKAYDEFVSRLLSHGRGATFYVEPKSGMLGPFESQTINITTFTNMWGDYQDNLICKVGDLNPT----HIHMKMSVRGCPVYFQMIGPQPDNQNQGPVIRFGSHVSGGDTVSRSLRLINTSPYDIRMDWVTYNLEA-GDGKLIDLLLACGEPF----PLKDADGNEVVGGLDSSVMFPSTWDDSHTPSREGTSSTFMTQSDDFVENGEECDGEDGSGASESLAPVKKLFSVFLKPHEGTLSDYPYCITPQQTVVPAGGSSTIHLSFTPLILSCSTNQRCL-----------GYALGFMSLDSKLALVTPGKVERVRGYELQPLRLDMQANVKPAILSVQMAEDTEVLEFS----------AAASDTLDGASQTQESRITRTFRLKNDTDMALSFKLSTNPPFSVLLPRQSLKLISSSPAYRHTQGLSGPGDEMRLFLLQPKNIIQVKVAF---HNSASLLACVN--GACEESDSQLSASLLCSDD--GGKTLQFQENLTIQYSNNSI-QTVSLYARLALPTLHLSSATVDFGTCYVGQTTVKEIYLHNRGGSCSY--WTTLTDGNEVFRVSPDSGLLKPLGDPASCRQL-LQISFTPREQKEFQTIFTVQGLLGETPLVLKVSGRGSFDESF 1688          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Zebrafish
Match: dlec1 (DLEC1 cilia and flagella associated protein [Source:ZFIN;Acc:ZDB-GENE-091204-65])

HSP 1 Score: 492.271 bits (1266), Expect = 2.554e-148
Identity = 381/1394 (27.33%), Postives = 655/1394 (46.99%), Query Frame = 1
Query:  988 ISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIG-GSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKFENGLKTLNFGKN--IAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDIEAGKLIKLRPNLADRQSKP-QKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGR---KEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDIN-----LDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRS--------TDNFISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVK---NEKELQFDENEGASFDNYLLGFLSLEDH-NLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLT----LRNLKDAEMKFTLKTRSPFEI-----------------------GNGKNIENREIKIGETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASYLFLKLVNPTDSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKY 5016
            +SCQY +RF+PDSL DYED +VVETQ      + I   R  PILT     D  +CL+ G+K +    +N G  +G FC+         + ++ + S  T   PF I PS F L   +   +E++F PT+     ++F I+CDNC      + G G++  + + +V GG   PE  E  DI+A   ++F   NP++  QKT+++KN +H E+P+ W+I+KP+L+   +  E  D + +++  LD +SAF I P  G+  P +   F +T+AP ++K +HSV HLV+  +    P   K  D+G                    +LH            N+VT LE+EVKG++ P K+     ++++PGE  I+  + K  ++ N S   +   W +   +  + EVEP  G+I+  E   +++ +    PG F  TL CH+      I L +EA FKGP   ++   LDFGL+++      ++++ N S ++  W   V       +  ++ INP  G+L  L+S +V + F   H ++    ++ S+ +G+   +++ A  QSP V L + +L  +  L+V    T ++ L NQ+ L + F W    G  A L S  F P  G + PN KT+V ++ T     +L ++   C ++G+++P+ L I  K     L V+ +  + +  N    ++    L+F ++    I ++ KR LLI N T+I   F +  ++F         G   +        Q+K  Q+ A  +F   +L    G      P SG L  ++   I ++ + +MWG+Y D +      +N +     I + ++V G P+ F M   +   + Q P++R GS   G +  SR +R+ N S  DI ++W  Y  +   D K++D++L+  +PF    PLKD+D N     LDS         +S+        +      D+F    +E      S             S+ ++PHEG +S+ P    P+Q V+P+     + ++F P  +    N++ L            Y LGF+SL+    L+   ++ R   YE++ ++LD+ A +    L V   +  E  E S           A +D L   S++  S +T    L+N  D  + F L T  PF +                       G G  +    ++    I+V V F        LL   N  G  E    ++   LL ++     K +QF++ LT+ Y+N  + Q + + A++  P   +S + ++F TC++ +T    I + N+  S SY     +   + VF ++  +GL++     +   +L +QI FTP++  ++     + G++GE  + + +S RGS+D  +
Sbjct:    1 MSCQYMVRFAPDSLADYEDALVVETQMLYPLIIPIEACRSPPILTLPAVMDCGFCLVGGVKFMEVLCRNEGLSAGTFCVMPKKQWPASSLRSAVKSTFTEQPPFAISPSIFGLHPGQATVIEVVFFPTTPELSTQDFTIVCDNCQVKDITLQGTGQLITVELLSVSGGEDQPEFAELCDITADHYVRFNTTNPHSTLQKTLVVKNNTHLELPYHWQIMKPSLQ-CLLPGETPDPSSIQH-LLDTDSAFSISPVIGILNPAQEHEFLLTYAPKDIKDYHSVCHLVIMDV----PSPPKVCDDGTCP---------------DTALHA-----------NNVTILEVEVKGSTEPYKILLEPYAVLIPGETYIHNTICKRFKMWNHSKSVIHFEWER-VIDSHVIEVEPSSGVIEMNECFDMELYLTGRSPGHFTSTLQCHILHHPKTIGLAIEATFKGPHCSLNVPSLDFGLLQMGNERILTIEVTNNSLLDAHWSLEVLSQTQKLIDGQVHINPNKGVLAALESCSVDVAFRAMHCQVFESVLQLSVLNGTGCHVSIHAVVQSPQVCLLNCELLFAD-LYVGVSQTGSVTLFNQTLLPAHFTWGRLQGSQAHLCSAVFSPSAGSLGPNAKTEVSVSFTAHTVEDLTEVNGVCEVKGMENPLVLGIFSK--AKPLRVS-YSLLCNGINSGDGDHQPILLDFTEHEPAVIGKSVKRQLLITNNTAITAPFTVDTEYFTGDCPSQSEGNSERSSAPFHSIQAKKIQQKAYDEFVSRLLSHGRGATFYVEPKSGMLGPFESQTINITTFTNMWGDYQDNLICKVGDLNPT----HIHMKMSVRGCPVYFQMIGPQPDNQNQGPVIRFGSHVSGGDTVSRSLRLINTSPYDIRMDWVTYNLEA-GDGKLIDLLLACGEPF----PLKDADGNEVVGGLDSSVMFPSTWDDSHTPSREGTSSTFMTQSDDFVENGEECDGEDGSGASESLAPVKKLFSVFLKPHEGTLSDYPYCITPQQTVVPAGGSSTIHLSFTPLILSCSTNQRCL-----------GYALGFMSLDSKLALVTPGKVERVRGYELQPLRLDMQANVKPAILSVQMAEDTEVLEFS----------AAASDTLDGASQTQESRITRTFRLKNDTDMALSFKLSTNPPFSVLLPRQSLKLISSSPAYRHTQGLSGPGDEMRLFLLQPKNIIQVKVAF---HNSASLLACVN--GACEESDSQLSASLLCSDD--GGKTLQFQENLTIQYSNNSI-QTVSLYARLALPTLHLSSATVDFGTCYVGQTTVKEIYLHNRGGSCSY--WTTLTDGNEVFRVSPDSGLLKPLGDPASCRQL-LQISFTPREQKEFQTIFTVQGLLGETPLVLKVSGRGSFDESF 1316          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Zebrafish
Match: dlec1 (DLEC1 cilia and flagella associated protein [Source:ZFIN;Acc:ZDB-GENE-091204-65])

HSP 1 Score: 183.341 bits (464), Expect = 2.151e-49
Identity = 128/396 (32.32%), Postives = 201/396 (50.76%), Query Frame = 1
Query:   73 DISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEK-----NKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNLQNNRIESLSRESS--FSDLNSS---PLITNRKDDKVLSSKKKEYRLPPIEKPA------TQDQIKKRKSEKKR--NPTDMML-----------ASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLI----------QSNKDSCSQK-------MFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILT 1122
            DISH++   F  L+S + +  + + NL  S+   +  H +YVEEL  + +E     +N+  L  HI+ A+ +A   +E  + K      + ++ L LP  +S F   +D+ LLR N LI P D +T + N  ++S    SS  F+    S    + T  +DD           LPP    A      +++ I    S +    N T++ L           A    + +A L+    ++ FL NPR+L+P+  +  K+ +I          +S K++  ++       +F   P V+ FSDY VG+VY+  +  +N+T   R IR++PP + +FS+GLG+FPGE G+VA G+SCQY +RF+PDSL DYED +VVETQ      + I   R  PILT
Sbjct:   31 DISHLLASIFNDLYSTEVIGKDTVSNLSKSRRRGNSYHEKYVEELQQVHSEYNRRIQNADMLETHIIQARLQAAAKEEHDRNKILEEVGEAYQQLGLPPVKSAFKWCVDSGLLRSNSLICPLD-YTTVHNPVVKSPKARSSPGFAKPTFSYNMHISTELQDDGYTP-------LPPHAHSAHSLLEYSEETITLSSSPESSSINDTELGLVAKASWMEKTSAKSHAEDRASLKKHKDRHKFLHNPRFLLPNTQHGGKSLIIPGKKKLENVGKSRKNNGRERSLEGHAPIFTANPPVIFFSDYRVGQVYETSVELKNMTASSRHIRMIPPTSPHFSVGLGRFPGEGGIVAPGMSCQYMVRFAPDSLADYEDALVVETQMLYPLIIPIEACRSPPILT 418          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Xenopus
Match: DLEC1 (DLEC1, cilia and flagella associated protein [Source:NCBI gene;Acc:100488518])

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 483/1697 (28.46%), Postives = 799/1697 (47.08%), Query Frame = 1
Query:   73 DISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDE--MTKEKNKDFEY-LNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNLQ----NNRIESLSRESSFSDLNSSPLITNRKDDKVLSSKKKEYRLPPIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNKDSCSQK--------MFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGS-GKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKS--SSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTW---RSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDIEAGKLIKLRPNLADRQSKPQKLAD---FDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYND--FVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTA---GRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDR----------NLDIDNFSSRFQEIISTKRST---DNFISLTIRPHEGIISNEPLTFQPEQLV--IPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNL-MLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNIENREI--KIGETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASYLFLKLVNPTDS-VFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQ 5019
            DISH++   F  L++ + +  +   NL  S+G  D  H ++VEEL  I +E E     +  +  HI+ A+      +E  ++  K++  E  L LP  +S+F   +D+ +LR   LI P+D  T+ Q      R ++++ +   S L     +   +     S K   +++        Q   +  K  KK    +          ++ L     +++FLKNPR+L P+     ++ L  + +   S +        +FL  P VV F DYEVG++Y+  I  RN+T   R +R++PP T YFS+GLG+FPGE G+VA G+SC Y +RF PDSL D+ED ++VETQ      V I  +RP P+LT     +   CLI G+KV+ Y ++N G S G+FCI    +    N ++V  S      PF IRP+ FEL   + IN+E+    +    + R F I CDNC   +  +TG+G+   + + +V  G S P   ++TD  A  L+ F P N ++  QK+++++N +H E+P+CW+I+ PN+++       +  DL+            F + P  G+  P++   FT+++ P E+  HH V H+VL+ I + +                       G  E   S             +NDV  L++++KG +   +++    +II PGE  I T +RK  ++ N+S   +   W +  S   + ++EP  G I+  +   +++C+   K GF    ++CH++   +   L VEA FKGP + ID   LD GL+K+         + NKS +   W    S    +       +  I P  G L PL    + + F P   + +   +EF +E+G   +L V A  Q P V L SS L  SGI ++  P   +I++ NQ  L + F W    G  +   +    P  G + PN + ++ +T+T     EL DI   C+++ + +P+ L +  K  G  L +T +   +S   +P+       L+FG  + ++   +R L++ N ++I   F +   +F         G   +  P L    + P  L      DF +++L    G A    PS GTL+ + ++ IEV+AY++MWGEY+D    ++   +  S      IP+ + V GSPL F MT    G + + P++R GS+  G +  SR +RINN S  DI I+WE Y  +  SD K+LD++L Y DPF    PLKD D N                     +V D           N D+   S+  +  + ++ S     N IS+ +RPHEG+ S+ P    P Q+V  +P+     + V+F P  +                D + LGFLSL++     +  R+ R   Y V+ I++++   + +  L       +   +   +V     L +   ++L  +S      L L+N  +  + F L    PF I  G       I  K G T++V V F    E   LL  +NL  +     L+   QLL  + Q   K + F   L + Y+N    Q + + A +  P   +S   ++F TCF+ +  T  +R++N S S SY    L    D  +F ++   G ++    +  +S   + + FT + + +Y  ++ I G++GE+ + + I  +GSYD K++
Sbjct:   30 DISHLLTSLFKSLYTGEVIGKDTGANLIRSKGGDDPHHQKFVEELQQIRSEYEQRMAEADMVEKHIIQARARTTAQEERVLSALKHEGGETSLGLPPVDSHFRWCVDSGVLRKLKLICPDDYITDPQPITKAPRGKAMASKHRISVLLLCKYVLQYQTS--FSKKNSSFQMSNTRSGLLQKATRNNKPLKKGTSLE----------ESELSQAEHRHSFLKNPRFLPPNSVPGGRSLLAPAKRREGSIQGIKHPTVPVFLANPPVVFFPDYEVGQIYEMAIELRNMTASSRHLRIIPPSTPYFSVGLGKFPGEGGIVAPGMSCHYTVRFVPDSLADFEDFLLVETQSPYPVLVPIEARRPPPVLTIPRTLNCGPCLIGGVKVLEYFLRNEGLSRGRFCIMPRRVWPPANFRSVATSGFVEDGPFGIRPAAFELYPGQGINMEV----SESANLGRVFTIACDNCQVREITLTGYGQQVGLELVSVSDGESPPSSGDSTDTMAGHLIHFQPTNLHSTVQKSLLIRNSTHVELPYCWQIMNPNVQTLLPGAPQDVCDLHT--------SLPFSLTPAQGILQPHQDSTFTVSYTPTEMSEHHRVAHMVLREIPEPR-----------------------GLTEFTPS-------------VNDVIVLDLDLKGMAEAFQIQLEPYAIIFPGESYIGTTMRKQFKMWNKSKSAIVYRWEQITS-CHVVQIEPSSGTIEPNKCSELEICLTGGKTGFCSQKVICHIEHSPETAALRVEATFKGPVVSIDIPSLDLGLLKLGSKSVSIFTIENKSPLQAKWSVKESPACLSEQNEQESQFLIEPNNGELLPLGQAKLALMFQPLTCQRLETVLEFQVENGEGSYLPVTADVQLPQVRLLSSTLAFSGI-YMGVPGQSSIKMLNQGRLPARFCWGELTGSHSMQCAATITPANGTLAPNEEAEMNITLTSYTTDELYDIAFLCTVKDMKEPLTLRLMAKAQG--LQIT-YSSDESAPVDPRD----LLLDFGSEVPLYNTVQRKLILTNQSAISAPFSLEAAYF--------CGGDAQQLPILHSPYAPPPYLHSITCLDFRRALLSDGKGAAFVPRPSCGTLEGFQQIAIEVTAYSNMWGEYSDELLCKVGDLTTKS------IPMKMAVRGSPLYFQMTGPKPGLQMEGPVIRFGSQLSGGDTISRCLRINNPSPYDIRIDWETYNME-QSDPKLLDLVLLYGDPF----PLKDIDGN--------------------EIVVDHLDLENETLPVNWDMIPSSAGTRSSVPSRTSAVKEKNLISVILRPHEGVPSDFPYCITPRQMVRLVPAGGSSAIHVSFTPLNLSG-------ATSKTECDGFALGFLSLDNEAATCVPGRVSRLQGYGVQPIRMELQGAVTIRGLGT----MESHTQGEGAVTIWGFLFQILTEFLTTQS------LKLKNCTEMPLSFRLLVPKPFVISLGTRQGPGYIATKQGSTVQVKVSFCTTLE---LLTYQNLPANQ----LQPGVQLL--QSQDGEKKLHFTQQLVIEYSNNS-TQHVPLEAHLSLPALTLSCQTLDFGTCFVGQPRTQEVRLMNSSGSKSYWTALLGTQNDQEIFSISPTCGRLEAYGRHMSDSTEALLVSFTARASTEYEMTVTIHGMLGEQPLHLQIKGQGSYDEKFE 1591          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000018114.1 (cilia and flagella associated protein 221 [Source:NCBI gene;Acc:100493735])

HSP 1 Score: 57.7658 bits (138), Expect = 1.052e-8
Identity = 30/95 (31.58%), Postives = 52/95 (54.74%), Query Frame = 1
Query:  814 PEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIG 1098
            P ++ F  YE+GK +Q+ +   N++  +  I ++PP+TK+FS+    +   Q LV  G++    +RF+PD    Y D I +  QG  +  V + G
Sbjct:   61 PGILHFGGYEIGKCHQQSLKLINVSADVMNIHIIPPQTKHFSIS---YSKAQRLV-PGLAITVTVRFNPDEWRYYYDCIRLHCQGGETLLVPVHG 151          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Mouse
Match: Dlec1 (deleted in lung and esophageal cancer 1 [Source:MGI Symbol;Acc:MGI:2443671])

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 476/1717 (27.72%), Postives = 836/1717 (48.69%), Query Frame = 1
Query:   73 DISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEKNK---DFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTN-------------LQNNRIESLSRESSFSDLNSSPLITNRKDD--KVLSSKKKEYRLPPI-----EKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNKD------------SCSQK-MFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGS-GKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGT------NDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGI-LFVNTPSTFTIELTNQSHLISSFNWQMPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDI-EAGKLIKLRPNL---ADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVIIPVSITVVGSPLE------FTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRSTDNFISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLE-DHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIG-NGKNIENREI-KIGETIKVPVKFVLDREQILLLKDENLYGHNESHCLK--IERQLLPN----EQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASY--LFLKLVNPT--DSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQK 5022
            +ISH++ + F  L++A  +  ++ ++L  ++GS D  H E++++L       +     +  L  HI+ A+   + + E T ++++       + LP  ++ F   +D+ L+R + LI+ ED +T+             L  +++ + S E  F  L  S L    ++   ++      EY +  +      K  T D +KK    K +   + +   ++   + +L  M  +N+FLKNPR+  P+  +  K+ ++  +K             SC+   +FL  P V  F+DYE+G VY+ +I  +N T+  R +RVLPP + YF+LGLG FPG+ G+VA G++CQY ++F PD LGD++D I+VETQ   +  + +  +RP P+LT S   D  +CLI G+K+  +  KN+G S GKFCI        P+ +AV  +      PF + PS FEL     I LE++F PT LG+ E  F I+CDNC   +  + G G++  + +  + GG + P+  E  D++AQ  ++F P N  + ++K +I++N +H E+ F W+I+KPNL+   +  E    + +K    D E+AF I P+ G+   +    F ++F+P ++K  HSV  +VL+ +    P+   S  E L          D  +                  +++D+  LEIEVKG + P +V     ++I+PGE  I   V+K  ++ N S  P+  +W K  S   I EVEP  G+I+  E+G  ++ +    PG     L C +     P+ L +EA+FKGP L ID   L FGL+++ +    S+++ N S ++  W  +           D S F+   I P  G L PL    V I    S  + +   +E  +E+GS  +L V A  Q P V L +S L+ S + L V+T S  T  L N + L + F+W   +G  A+L ++   P +G++ P+ + ++ L +T   + +L ++ L C + G++ P+ L ISGK LG  + ++I E   S T+  + E     L+FG  + +     R +++ N + I T F +++++F +S + + +   +  + P L   A  Q    K    DF +SML  + G A   + S G L +Y ++ I+++   +MWGEY D +      +   +   +IPV + VVG P+       +++   +KE  PI R G++  G +  +R +R+ N S CDI ++WE Y  +  +D ++L++++ Y  PF    PL+D D +              +   S   V+   +      S         R+ +  +S+ ++ HE + +       P+QLVIP+  +  + ++F P        L         +  Y LGF+SL+ + +  +  RM R   + V  ++LD+   +    L V+    D    + F    S L+ +     +L+  +  T +L L N  +    F  +   PF I   G + ++R   +  E      ++++ R Q  +L D +     E    +     Q+LP     E +   + + F   L + + N  + Q + +RA +  P   +S S ++F TC + +  T  I ++N S   SY  + L    P   D  F ++  +GL++    N+  +   +Q+ F P+ +I Y ++L++ G++ E+   + +   GSYD +Y K
Sbjct:   91 EISHLLARVFRNLYTAQVIGDDLSDSLIKARGSEDARHEEFLDQLQQARAIYKQRLDEAAMLERHIMQARARDIAETEHTTKQSRLQVVETPVKLPPVKTAFRWCLDSKLMRKHHLISTEDYYTDPVPFCPAPKDKSTLGCSKL-TFSCEQRF--LRKSELDREAEEHCRQLTECDDFEYTVDSLGSISKAKERTTDSVKKTSRPKNKKWMEHLQVPQRALDRRLLASMENRNHFLKNPRFFPPNTPHGGKSLIVPLSKPERRASLNAEPEWSCTDAPVFLAKPSVGFFTDYEIGPVYEMVIALQNTTSTSRFLRVLPPSSPYFALGLGMFPGKGGIVAPGMTCQYIVQFIPDCLGDFDDFILVETQSPHTLVIPLQARRPPPVLTLSPVLDCGHCLIGGVKITKFICKNVGFSVGKFCIMPQKSWPPPSFRAVATTGFVEQPPFGVMPSVFELAPGYAILLEVLFLPTGLGQAEETFIIVCDNCQIKEVVVVGTGQLVALDLIHISGGKNEPDPGELKDLTAQYFIRFEPENVQSTAKKQLIIRNATHVELAFHWQIMKPNLQ-PLMPGETHSSDSIKCHP-DRETAFSIIPEKGILESHSDQEFILSFSPYKLKCFHSVLQMVLEAV----PEPLSSGLENL---------GDYSY------------------SVDDMIVLEIEVKGLAEPFQVLLEPYALIIPGENYIGITVKKDFKMWNNSKSPIRYMWGK-ISHCHIIEVEPCTGVIEPNEVGDFELNLTGGVPGPTSQDLECEIKDSPCPVVLHIEASFKGPALTIDVPALQFGLLRLGKKASISIQIRNVSQLSAVWHLKESPVCLAERDEDVSPFD---IEPFCGQLLPLGECRVTITLEASQCQRLQTVLELEVENGSGSYLPVYAEVQQPHVYLKNSHLEFSNLYLGVSTKSRTT--LVNGTLLPTRFHWGKLLGPQADLCTMTVSPTQGLLGPSEELQLTLELTTHTEEKLTNLVLLCHVSGMEKPLVLGISGKPLGLQVTISIVESDGSTTSTTQEE---LRLDFGSKVPLRTPVIRHIILTNCSPIQTPFTLTLEYFGSSQDSLYKKTSVPDVPPALLKTARIQQHVAKKERLDFVESMLSHRKGAAFLPHISQGMLGAYQELCIDITGCANMWGEYWDEL----LCVVGDLPVTVIPVYMAVVGCPISSLRNTCYSVAPFQKE--PITRFGTQISGGDTVTRSLRLYNSSHCDIRLDWETYIPEEKAD-RLLELLVFYGPPF----PLRDQDGSEIVCPETSEASLPGSPCPSNVSVSSHTVPSTGSCS---GGGGGTRAEEQIMSVILQRHEAVPAGHIYRISPKQLVIPAGDHRTIYISFTPTV------LDPGVMHKVGYTGYALGFMSLDKETDRQIPGRMRRLQDFAVSPLRLDLNGHVRHAQLHVEL---DSSGYLEFWCQASDLIPQNPCSGVLS-DRITTRHLKLTNTTEILYDFQARVSRPFFISQGGASWDSRAPHQCEEGTASTGQWLMIRPQDNMLVDVSFSLSLELLSYQKLSADQMLPGVDIQESENGERKMVFTQNLLLGFTNQTV-QEVPLRAFVTLPAPQLSTSWVDFGTCLVNQQHTRQIYLMNLSCCLSYWTVLLGQEEPAREDHAFGVSPGSGLLEARATNAPPTSSPLQVFFNPRSSILYESTLVVEGVLSEKPCVLRLRGLGSYDERYVK 1737          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Mouse
Match: Dlec1 (deleted in lung and esophageal cancer 1 [Source:MGI Symbol;Acc:MGI:2443671])

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 475/1717 (27.66%), Postives = 837/1717 (48.75%), Query Frame = 1
Query:   73 DISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEKNK---DFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTN-------------LQNNRIESLSRESSFSDLNSSPLITNRKDD--KVLSSKKKEYRLPPI-----EKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNKD------------SCSQK-MFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGS-GKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGT------NDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGI-LFVNTPSTFTIELTNQSHLISSFNWQMPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDI-EAGKLIKLRPNL---ADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVIIPVSITVVGSPLE------FTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRSTDNFISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLE-DHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIG-NGKNIENREI-KIGETIKVPVKFVLDREQILLLKDENLYGHNESHCLK--IERQLLPN----EQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASY--LFLKLVNPT--DSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQK 5022
            +ISH++ + F  L++A  +  ++ ++L  ++GS D  H E++++L       +     +  L  HI+ A+   + + E T ++++       + LP  ++ F   +D+ L+R + LI+ ED +T+             L  +++ + S E  F  L  S L    ++   ++      EY +  +      K  T D +KK    K +   + +   ++   + +L  M  +N+FLKNPR+  P+  +  K+ ++  +K             SC+   +FL  P V  F+DYE+G VY+ +I  +N T+  R +RVLPP + YF+LGLG FPG+ G+VA G++CQY ++F PD LGD++D I+VETQ   +  + +  +RP P+LT S   D  +CLI G+K+  +  KN+G S GKFCI        P+ +AV  +      PF + PS FEL     I LE++F PT LG+ E  F I+CDNC   +  + G G++  + +  + GG + P+  E  D++AQ  ++F P N  + ++K +I++N +H E+ F W+I+KPNL+   +  E    + +K    D E+AF I P+ G+   +    F ++F+P ++K  HSV  +VL+ +    P+   S  E L          D  +                  +++D+  LEIEVKG + P +V     ++I+PGE  I   V+K  ++ N S  P+  +W K  S   I EVEP  G+I+  E+G  ++ +    PG     L C +     P+ L +EA+FKGP L ID   L FGL+++ +    S+++ N S ++  W  +           D S F+   I P  G L PL    V I    S  + +   +E  +E+GS  +L V A  Q P V L +S L+ S + L V+T S  T  L N + L + F+W   +G  A+L ++   P +G++ P+ + ++ L +T   + +L ++ L C + G++ P+ L ISGK LG  + ++I E  D  +     +  L+ L+FG  + +     R +++ N + I T F +++++F +S + + +   +  + P L   A  Q    K    DF +SML  + G A   + S G L +Y ++ I+++   +MWGEY D +      +   +   +IPV + VVG P+       +++   +KE  PI R G++  G +  +R +R+ N S CDI ++WE Y  +  +D ++L++++ Y  PF    PL+D D +              +   S   V+   +     S+         R+ +  +S+ ++ HE + +       P+QLVIP+  +  + ++F P        L         +  Y LGF+SL+ + +  +  RM R   + V  ++LD+   +    L V+    D    + F    S L+ +     +L+  +  T +L L N  +    F  +   PF I   G + ++R   +  E      ++++ R Q  +L D +     E    +     Q+LP     E +   + + F   L + + N  + Q + +RA +  P   +S S ++F TC + +  T  I ++N S   SY  + L    P   D  F ++  +GL++    N+  +   +Q+ F P+ +I Y ++L++ G++ E+   + +   GSYD +Y K
Sbjct:   91 EISHLLARVFRNLYTAQVIGDDLSDSLIKARGSEDARHEEFLDQLQQARAIYKQRLDEAAMLERHIMQARARDIAETEHTTKQSRLQVVETPVKLPPVKTAFRWCLDSKLMRKHHLISTEDYYTDPVPFCPAPKDKSTLGCSKL-TFSCEQRF--LRKSELDREAEEHCRQLTECDDFEYTVDSLGSISKAKERTTDSVKKTSRPKNKKWMEHLQVPQRALDRRLLASMENRNHFLKNPRFFPPNTPHGGKSLIVPLSKPERRASLNAEPEWSCTDAPVFLAKPSVGFFTDYEIGPVYEMVIALQNTTSTSRFLRVLPPSSPYFALGLGMFPGKGGIVAPGMTCQYIVQFIPDCLGDFDDFILVETQSPHTLVIPLQARRPPPVLTLSPVLDCGHCLIGGVKITKFICKNVGFSVGKFCIMPQKSWPPPSFRAVATTGFVEQPPFGVMPSVFELAPGYAILLEVLFLPTGLGQAEETFIIVCDNCQIKEVVVVGTGQLVALDLIHISGGKNEPDPGELKDLTAQYFIRFEPENVQSTAKKQLIIRNATHVELAFHWQIMKPNLQ-PLMPGETHSSDSIKCHP-DRETAFSIIPEKGILESHSDQEFILSFSPYKLKCFHSVLQMVLEAV----PEPLSSGLENL---------GDYSY------------------SVDDMIVLEIEVKGLAEPFQVLLEPYALIIPGENYIGITVKKDFKMWNNSKSPIRYMWGK-ISHCHIIEVEPCTGVIEPNEVGDFELNLTGGVPGPTSQDLECEIKDSPCPVVLHIEASFKGPALTIDVPALQFGLLRLGKKASISIQIRNVSQLSAVWHLKESPVCLAERDEDVSPFD---IEPFCGQLLPLGECRVTITLEASQCQRLQTVLELEVENGSGSYLPVYAEVQQPHVYLKNSHLEFSNLYLGVSTKSRTT--LVNGTLLPTRFHWGKLLGPQADLCTMTVSPTQGLLGPSEELQLTLELTTHTEEKLTNLVLLCHVSGMEKPLVLGISGKPLGLQVTISIVES-DGSSTTSTTQEELR-LDFGSKVPLRTPVIRHIILTNCSPIQTPFTLTLEYFGSSQDSLYKKTSVPDVPPALLKTARIQQHVAKKERLDFVESMLSHRKGAAFLPHISQGMLGAYQELCIDITGCANMWGEYWDEL----LCVVGDLPVTVIPVYMAVVGCPISSLRNTCYSVAPFQKE--PITRFGTQISGGDTVTRSLRLYNSSHCDIRLDWETYIPEEKAD-RLLELLVFYGPPF----PLRDQDGSEIVCPETSEASLPGSPCPSNVSVSSHTVP----STVSSGGGGGTRAEEQIMSVILQRHEAVPAGHIYRISPKQLVIPAGDHRTIYISFTPTV------LDPGVMHKVGYTGYALGFMSLDKETDRQIPGRMRRLQDFAVSPLRLDLNGHVRHAQLHVEL---DSSGYLEFWCQASDLIPQNPCSGVLS-DRITTRHLKLTNTTEILYDFQARVSRPFFISQGGASWDSRAPHQCEEGTASTGQWLMIRPQDNMLVDVSFSLSLELLSYQKLSADQMLPGVDIQESENGERKMVFTQNLLLGFTNQTV-QEVPLRAFVTLPAPQLSTSWVDFGTCLVNQQHTRQIYLMNLSCCLSYWTVLLGQEEPAREDHAFGVSPGSGLLEARATNAPPTSSPLQVFFNPRSSILYESTLVVEGVLSEKPCVLRLRGLGSYDERYVK 1737          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Mouse
Match: Dlec1 (deleted in lung and esophageal cancer 1 [Source:MGI Symbol;Acc:MGI:2443671])

HSP 1 Score: 273.863 bits (699), Expect = 4.883e-78
Identity = 168/548 (30.66%), Postives = 290/548 (52.92%), Query Frame = 1
Query:   73 DISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEKNKDFEY---LNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTN-------------LQNNRIESLSRESSFSDLNSSPLITNRKDD--KVLSSKKKEYRLPPI-----EKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNKD------------SCSQK-MFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGS-GKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNES 1605
            +ISH++ + F  L++A  +  ++ ++L  ++GS D  H E++++L       +     +  L  HI+ A+   + + E T ++++       + LP  ++ F   +D+ L+R + LI+ ED +T+             L  +++ + S E  F  L  S L    ++   ++      EY +  +      K  T D +KK    K +   + +   ++   + +L  M  +N+FLKNPR+  P+  +  K+ ++  +K             SC+   +FL  P V  F+DYE+G VY+ +I  +N T+  R +RVLPP + YF+LGLG FPG+ G+VA G++CQY ++F PD LGD++D I+VETQ   +  + +  +RP P+LT S   D  +CLI G+K+  +  KN+G S GKFCI        P+ +AV  +      PF + PS FEL     I LE++F PT LG+ E  F I+CDNC   +  + G G++  + +  + GG + P+  E  D++AQ  ++F P N  + ++K +I++N +
Sbjct:   91 EISHLLARVFRNLYTAQVIGDDLSDSLIKARGSEDARHEEFLDQLQQARAIYKQRLDEAAMLERHIMQARARDIAETEHTTKQSRLQVVETPVKLPPVKTAFRWCLDSKLMRKHHLISTEDYYTDPVPFCPAPKDKSTLGCSKL-TFSCEQRF--LRKSELDREAEEHCRQLTECDDFEYTVDSLGSISKAKERTTDSVKKTSRPKNKKWMEHLQVPQRALDRRLLASMENRNHFLKNPRFFPPNTPHGGKSLIVPLSKPERRASLNAEPEWSCTDAPVFLAKPSVGFFTDYEIGPVYEMVIALQNTTSTSRFLRVLPPSSPYFALGLGMFPGKGGIVAPGMTCQYIVQFIPDCLGDFDDFILVETQSPHTLVIPLQARRPPPVLTLSPVLDCGHCLIGGVKITKFICKNVGFSVGKFCIMPQKSWPPPSFRAVATTGFVEQPPFGVMPSVFELAPGYAILLEVLFLPTGLGQAEETFIIVCDNCQIKEVVVVGTGQLVALDLIHISGGKNEPDPGELKDLTAQYFIRFEPENVQSTAKKQLIIRNAT 635          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Mouse
Match: Cfap221 (cilia and flagella associated protein 221 [Source:MGI Symbol;Acc:MGI:2684947])

HSP 1 Score: 58.5362 bits (140), Expect = 6.052e-9
Identity = 43/147 (29.25%), Postives = 68/147 (46.26%), Query Frame = 1
Query:  676 MLELMTAKNNFLKNPRYLI------PDCSNESKNWLIQSNKDS--CSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKI 1092
            M EL  AK  F      L+      P    E  N L++S   +   + K+    P +V F  YE+   +Q+++N  N++     + +LPP+TKYF +    F  ++  +  G+S    I FSPD    Y D I +  +GD +  V I
Sbjct:    8 MQELQQAKEPFDTMSPLLLKSLVEEPKKRTEVPNHLLESRVYAKLLNNKVIQARPGIVHFGGYEIESKHQQILNIANISDEDTHLHILPPQTKYFQIN---FEKKEHRLIPGLSLTVTITFSPDEWRYYYDCIRIHCKGDDTLLVPI 151          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Mouse
Match: Hydin (HYDIN, axonemal central pair apparatus protein [Source:MGI Symbol;Acc:MGI:2389007])

HSP 1 Score: 61.6178 bits (148), Expect = 1.223e-8
Identity = 82/390 (21.03%), Postives = 150/390 (38.46%), Query Frame = 1
Query:  793 QKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLI-YGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWK----------------------------------IVKPNLKSS----SVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQG 1845
            Q +F P P  + F +Y   +VY+  +  RN   + R ++V+   + YF +   +  G +  VA G+   + I F+P+   DY   +   T+ +  F V +  +  R IL      + + C + Y  + V   ++NIG        DS+      S            P+ + P+   L   E++ LE+ F P ++G  + +  +  D            GEM F+ +  V   +++  +D+ + I  +  +          +Q++I + N ++    F WK                                  ++ P+L+      S   EN    +  +  L  +  F IEP  G   PN S   T+ F PLE K +    +  + G
Sbjct:  141 QALFQPFPSEIIFQNYSPCEVYEVPLVLRNNDKIPRMVKVVEESSPYFKIISPKDIGHK--VAPGVPSVFRILFTPEENKDYAHMLTCITERE-KFIVPVKARGARAILDFPDELNFSTCPVKYNTQKVLL-VRNIGNK------DSMFHLKTRS------------PYSVEPTGGILNVGESMQLEVDFEPQTVGSHDGKLIVTYDT-----------GEMVFVCLYGVAIDVNI-RLDKNSLIMEKTYISLA-------NQRSITIHNRTNIIAHFQWKVFATEEEEDKEKYKICDGLNKEEKQETSMILEDSVLDPSLRERLSIISRTFENQRKLVQGDSMLFLDHVFTIEPPEGDVWPNSSAEITVYFNPLEAKLYQQTVYCDISG 489          
BLAST of deleted in lung and esophageal cancer protein 1 vs. UniProt/SwissProt
Match: sp|Q9Y238|DLEC1_HUMAN (Deleted in lung and esophageal cancer protein 1 OS=Homo sapiens OX=9606 GN=DLEC1 PE=2 SV=2)

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 486/1734 (28.03%), Postives = 846/1734 (48.79%), Query Frame = 1
Query:   55 SQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDE--MTKEKNKDFEYL-NLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNL----QNNRIESLSRESSFSDLNSSPLITNRKDDKVL--SSKKK---------------EYRLPPIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNK-------------DSCS-QKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGS-GKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTN------DTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNE--PKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDIEAG-----------KLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVIIPVSITVVGSPLE----FTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRSTDNFISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDH-NLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIG-NGKNIENREIKIGETIKVPVKFVLDREQILLLKDENLYGH--NESHCLKIERQLLPNEQ-------QRTA---KMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASY--LFLKLVNPTDS--VFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKY 5016
            S   + DISH++   F  L+SA+ +  E+  +L  ++GS ++ H E+V++L  I    +      + L  HI  A+  A+ ++E  M++   +D E L  LP  +S     ID+ LLR + LI+PED +T+        +  SL   S  +       +  ++ +K L  S +KK                + L P  K  T++ +KK    + +N  + +   ++   + +L  M ++N+FLKNPR+  P+     K+ +    K              SC+   +FL  P +  F+DYE+G VY+ +I  +N TT  R +RVLPP T YF+LGLG FPG+ G+VA G++CQY ++F PD LGD++D I+VETQ   +  + +  +RP P+LT S   D  YCLI G+K+  +  KN+G S G+FCI         + KA+         PF I PS FEL     I +E++F P SLGK E+ F I+CDNC   +    G G++  + +  + G  S P+  E TD++AQ  ++F P N  + ++K +I++N +H E+ F W+I+KPNL+   +  E   ++ +K    D E+AF I P+ GV  P+    F ++F+P E++  HSV  +VL+ + +    + +S+                                    +++DV  LEIEVKG+  P +V     ++I+PGE  I   V+K  ++ N S  P+  +W K  S+  I EVEP  G+I+  E+G  ++      PG     LLC ++    P+ L +EA FKGP L I+ + L FGL+++ +    S+++ N S +  TWR +    +      D S F+   I P  G L  L    V I     H + +   +E  +E+G+  +L V A  Q P V L SS+++V   L++  P+  TI L N + L + F+W   +G  AE   +   P  G++ P+ + ++KL +T   Q EL  + LPC + G+  P+ L ISGK  G  + +TI ++    + E  P     L+ L+FG  + +     R L++ N + I T F +  ++F +  N +              K ++++ +LA R+         DF +SML    G A   + S G L  Y ++ I+++   +MWGEY D +          +   +IPV +  VG P+      + T  + +++P +R G++  G +  +R +R+NN S CDI ++WE Y  + D +++++++++ Y  PFP+     +  +  D+     +  +           +      +  SS      ++ R     IS+ ++ HEG+ S       P+Q+V+P+     + ++F P  +  E  L   E  G     Y LGF+SL+      +  +  R   + V  +KLD+ + +    L V+    D    + F    S L+ +     +L++  + T +L L N  +    F L    PF +  +G + ++R    G+  +   +     +Q++L   EN+  +         +  Q LP +Q       Q++A   + + F   L + Y N +  Q++ +RA +  PE  +S S ++F TCF+ +     + ++N S   SY  + +    P  +   F ++  +GL++    N+  + + +Q+ FT + +  Y +++++ G++GE+  ++ +  +GSYD +Y
Sbjct:   85 SSLRTQDISHLLTGVFRNLYSAEVIGDEVSASLIKARGSENERHEEFVDQLQQIRELYKQRLDEFEMLERHITQAQARAIAENERVMSQAGVQDLESLVRLPPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRNKNWMNHLRVPQRELDRLLLARMESRNHFLKNPRFFPPNTRYGGKSLVFPPKKPAPIGEFQSTEPEQSCADTPVFLAKPPIGFFTDYEIGPVYEMVIALQNTTTTSRYLRVLPPSTPYFALGLGMFPGKGGMVAPGMTCQYIVQFFPDCLGDFDDFILVETQSAHTLLIPLQARRPPPVLTLSPVLDCGYCLIGGVKMTRFICKNVGFSVGRFCIMPKTSWPPLSFKAIATVGFVEQPPFGILPSVFELAPGHAILVEVLFSPKSLGKAEQTFIIMCDNCQIKELVTIGIGQLIALDLIYISGEKSQPDPGELTDLTAQHFIRFEPENLRSTARKQLIIRNATHVELAFYWQIMKPNLQPL-MPGETFSMDSIKCYP-DKETAFSIMPRKGVLSPHTDHEFILSFSPHELRDFHSVLQMVLEEVPEPVSSEAESLGHS-------------------------------SYSVDDVIVLEIEVKGSVEPFQVLLEPYALIIPGENYIGINVKKAFKMWNNSKSPIRYLWGK-ISDCHIIEVEPGTGVIEPSEVGDFELNFTGGVPGPTSQDLLCEIEDSPSPVVLHIEAVFKGPALIINVSALQFGLLRLGQKATNSIQIRNVSQLPATWRMKESPVSLQERPEDVSPFD---IEPSSGQLHSLGECRVDITLEALHCQHLETVLELEVENGAWSYLPVYAEVQKPHVYLQSSQVEVRN-LYLGVPTKTTITLINGTLLPTQFHWGKLLGHQAEFCMVTVSPKHGLLGPSEECQLKLELTAHTQEELTHLALPCHVSGMKKPLVLGISGKPQGLQVAITISKESSDCSTEQWPGHPKELR-LDFGSAVPLRTRVTRQLILTNRSPIRTRFSLKFEYFGSPQNSLSKKTSLPNMPPALLKTVRMQEHLAKRE-------QLDFMESMLSHGKGAAFFPHFSQGMLGPYQQLCIDITGCANMWGEYWDNL----ICTVGDLLPEVIPVHMAAVGCPISSLRTTSYTIDQAQKEPAMRFGTQVSGGDTVTRTLRLNNSSPCDIRLDWETYVPE-DKEDRLVELLVFYGPPFPLRDQAGNELVCPDTPEGGCLLWSPGPS-------SSSEFSHETDSSVEGSSSASNRVAQKLISVILQAHEGVPSGHLYCISPKQVVVPAGGSSTIYISFTPMVLSPEI-LHKVECTG-----YALGFMSLDSKVEREIPGKRHRLQDFAVGPLKLDLHSYVRPAQLSVEL---DYGGSMEFQCQASDLIPEQPCSGVLSELVT-THHLKLTNTTEIPHYFRLMVSRPFSVSQDGASQDHRAPGPGQKQECEEETASADKQLVLQAQENMLVNVSFSLSLELLSYQKLPADQTLPGVDIQQSASGEREMVFTQNLLLEYTN-QTTQVVPLRAVVAVPELQLSTSWVDFGTCFVSQQRVREVYLMNLSGCRSYWTMLMGQQEPAKAAVAFRVSPNSGLLEARSANAPPTSIALQVFFTARSSELYESTMVVEGVLGEKSCTLRLRGQGSYDERY 1749          
BLAST of deleted in lung and esophageal cancer protein 1 vs. UniProt/SwissProt
Match: sp|Q8BLA1|DLEC1_MOUSE (Deleted in lung and esophageal cancer protein 1 homolog OS=Mus musculus OX=10090 GN=Dlec1 PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 3.111e-77
Identity = 168/548 (30.66%), Postives = 289/548 (52.74%), Query Frame = 1
Query:   73 DISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEKNKDFEY---LNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTN-------------LQNNRIESLSRESSFSDLNSSPLITNRKDD--KVLSSKKKEYRLPPI-----EKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNKD------------SCSQK-MFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGS-GKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNES 1605
            +ISH++ + F  L++A  +  ++ ++L  ++GS D  H E++++L       +     +  L  HI+ A+   + + E T ++++       + LP  ++ F   +D+ L+R + LI+ ED +T+             L  +++ + S E  F  L  S L    ++   ++      EY +  +      K  T D +KK    K +   + +   ++   + +L  M  +N+FLKNPR+  P+  +  K+ ++  +K             SC+   +FL  P V  F+DYE+G VY+ +I  +N T+  R +RVLPP + YF+LGLG FPG+ G+VA G++CQY ++F PD LGD++D I+VETQ   +  + +  +RP P+LT S   D  +CLI G+K+  +  KN+G S GKFCI        P+ +AV  +      PF + PS FEL     I LE++F PT LG+ E  F I+CDNC   +  + G G++  + +  + GG + P+  E  D++AQ  ++F P N  +  +K +I++N +
Sbjct:   91 EISHLLARVFRNLYTAQVIGDDLSDSLIKARGSEDARHEEFLDQLQQARAIYKQRLDEAAMLERHIMQARARDIAETEHTTKQSRLQVVETPVKLPPVKTAFRWCLDSKLMRKHHLISTEDYYTDPVPFCPAPKDKSTLGCSKL-TFSCEQRF--LRKSELDREAEEHCRQLTECDDFEYTVDSLGSISKAKERTTDSVKKTSRPKNKKWMEHLQVPQRALDRRLLASMENRNHFLKNPRFFPPNTPHGGKSLIVPLSKPERRASLNAEPEWSCTDAPVFLAKPSVGFFTDYEIGPVYEMVIALQNTTSTSRFLRVLPPSSPYFALGLGMFPGKGGIVAPGMTCQYIVQFIPDCLGDFDDFILVETQSPHTLVIPLQARRPPPVLTLSPVLDCGHCLIGGVKITKFICKNVGFSVGKFCIMPQKSWPPPSFRAVATTGFVEQPPFGVMPSVFELAPGYAILLEVLFLPTGLGQAEETFIIVCDNCQIKEVVVVGTGQLVALDLIHISGGKNEPDPGELKDLTAQYFIRFEPENVQSTPKKQLIIRNAT 635          
BLAST of deleted in lung and esophageal cancer protein 1 vs. UniProt/SwissProt
Match: sp|Q80W93|HYDIN_MOUSE (Hydrocephalus-inducing protein OS=Mus musculus OX=10090 GN=Hydin PE=1 SV=2)

HSP 1 Score: 61.6178 bits (148), Expect = 8.557e-8
Identity = 82/390 (21.03%), Postives = 150/390 (38.46%), Query Frame = 1
Query:  793 QKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLI-YGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWK----------------------------------IVKPNLKSS----SVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQG 1845
            Q +F P P  + F +Y   +VY+  +  RN   + R ++V+   + YF +   +  G +  VA G+   + I F+P+   DY   +   T+ +  F V +  +  R IL      + + C + Y  + V   ++NIG        DS+      S            P+ + P+   L   E++ LE+ F P ++G  + +  +  D            GEM F+ +  V   +++  +D+ + I  +  +          +Q++I + N ++    F WK                                  ++ P+L+      S   EN    +  +  L  +  F IEP  G   PN S   T+ F PLE K +    +  + G
Sbjct:  141 QALFQPFPSEIIFQNYSPCEVYEVPLVLRNNDKIPRMVKVVEESSPYFKIISPKDIGHK--VAPGVPSVFRILFTPEENKDYAHMLTCITERE-KFIVPVKARGARAILDFPDELNFSTCPVKYNTQKVLL-VRNIGNK------DSMFHLKTRS------------PYSVEPTGGILNVGESMQLEVDFEPQTVGSHDGKLIVTYDT-----------GEMVFVCLYGVAIDVNI-RLDKNSLIMEKTYISLA-------NQRSITIHNRTNIIAHFQWKVFATEEEEDKEKYKICDGLNKEEKQETSMILEDSVLDPSLRERLSIISRTFENQRKLVQGDSMLFLDHVFTIEPPEGDVWPNSSAEITVYFNPLEAKLYQQTVYCDISG 489          
BLAST of deleted in lung and esophageal cancer protein 1 vs. UniProt/SwissProt
Match: sp|Q4G0P3|HYDIN_HUMAN (Hydrocephalus-inducing protein homolog OS=Homo sapiens OX=9606 GN=HYDIN PE=1 SV=3)

HSP 1 Score: 60.8474 bits (146), Expect = 1.675e-7
Identity = 82/389 (21.08%), Postives = 146/389 (37.53%), Query Frame = 1
Query:  793 QKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKI--------------------------------------VKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQG 1845
            Q +F P P  + F +Y   +VY+  +  RN   + R ++V+   + YF +   +  G +  VA G+   + I F+P+   DY   +   T+ +  F V I  +  R IL      + + C +         ++NIG                 +K  ++  +T   PF I P+   L   E++ LE+ F P S+G       I+C +           GE  F+S+      +++  +D+ +    +  +          +Q+TI + N S+    F WK+                                      ++ +L   S    N    +  +  L F + F +EP  G   PN S   T+ F PLE K +    +  + G
Sbjct:   95 QALFQPFPSEIIFQNYTPCEVYEVPLILRNNDKIPRLVKVVEESSPYFKVISPKDIGHK--VAPGVPSIFRILFTPEENKDYAHTLTCVTERE-KFIVPIKARGARAILDFPDKLNFSTCPVKYSTQKILLVRNIG-----------------NKNAVFHIKTC-RPFSIEPAIGTLNVGESMQLEVEFEPQSVGDHSGRL-IVCYDT----------GEKVFVSLYGAAIDMNI-RLDKNSLTIEKTYISLA-------NQRTITIHNRSNIIAHFLWKVFATQQEEDREKYRACDDLIKEEKDETDEFFEECITDPLLREHLSVLSRTFANQRRLVQGDSKLFFNNVFTVEPLEGDVWPNSSAEITVYFNPLEAKLYQQTIYCDILG 443          
BLAST of deleted in lung and esophageal cancer protein 1 vs. UniProt/SwissProt
Match: sp|Q4G0U5|PCDP1_HUMAN (Cilia- and flagella-associated protein 221 OS=Homo sapiens OX=9606 GN=CFAP221 PE=1 SV=2)

HSP 1 Score: 58.151 bits (139), Expect = 6.784e-7
Identity = 38/122 (31.15%), Postives = 62/122 (50.82%), Query Frame = 1
Query:  733 PDCSNESKNWLIQSNKDS--CSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKI 1092
            P    E  N L++S   +   + K+    P ++ F  Y+V K +Q++++  N++    R+ +LPP+TKYF +   +   E  LV  G+S    + FSPD    Y D I V  +GD +  V I
Sbjct:   33 PKKRKEVPNHLLESKVYAKLVNNKVIQARPGIIHFGGYQVEKQHQQILHLVNVSNEDTRVHILPPQTKYFEINYVR--KEHHLV-PGLSLTVTVTFSPDEWRYYYDCIRVHCKGDDTLLVPI 151          
BLAST of deleted in lung and esophageal cancer protein 1 vs. TrEMBL
Match: A0A1S3JXK0 (deleted in lung and esophageal cancer protein 1 OS=Lingula unguis OX=7574 GN=LOC106176793 PE=4 SV=1)

HSP 1 Score: 817.765 bits (2111), Expect = 0.000e+0
Identity = 537/1745 (30.77%), Postives = 873/1745 (50.03%), Query Frame = 1
Query:   40 YLQNHSQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEKNK------DFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTN-------LQNNRIESLSRESSFSDLNS-----------SPLITNRKDDKVLSSKKKEYRLPPIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNKDSCSQK--------------MFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTS--------------SNDIEAGKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYND--FVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTD---RNLDIDNFSSRFQEIISTKRSTD------------NFISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNIENREIKIGETIKVPVKFVLDREQILLLKDENL---YGHNESHCLKIERQLLPNEQQRTA---------KMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASYLFLKLVNPTDSV----FELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQ 5019
            YLQ  S A S D++HI+ K+F   F+ + V PE I NL VS+   D+ H  YVE L  +  ERE     +  L  HI+ A+  A+  DE  +E N+      ++  L LP   S+F   ID+ LLR +GL+ PED  T         Q  +I S +RE++ S L++           SP +   +D+ +LS    E      E+  TQ+  +   S +  +    +   ++   +A L L+ A+ ++LKNPR++ P      +  +    K   SQ+              +F+P P VV FS+Y+VG+VY+  +  +N+TT LR+ RV+PPK+ YFS+GLGQFPGE G+VA G+SC Y IRF PDSLGDY+DE+ V+TQ  +   VK+  +RP P+L+  +N D++ CL+ G K++   + N GGSG+F I         N K V  +    + PF IRPS FEL   +T+ LE+IF P S+ +  +   I+CDNCH   F I G G+ A + + +V+GG S P   E  D++AQ L+KF  LNP+TY+QK +IL+N ++ ++PF WKIVKP+L+  +VD EN D  I  +R +D +SAF IEPQ G+ P  +++PF +TFAP EV   HSVFHL+LQ I +  P+                   ++G  + +N     NT    E  + D+T+LE+EVKG S P KV     +I + G+LLI T +RK  Q+ N S+  V   W +  S+  I +VEP +G +    I   ++ +    PG    TL+CH+D LD P+ L +EA  KGP++ ++  D++FGLV++       + L N   +   W  +           E    P  G L PL++++V + FTPS  R V    E  ++ G+   ++V    QSP   L + +L +  + +V+ P T T++L NQ+ L + F W    G  AEL S+   P  G+++P  +  + +  T   Q ++ D+ +PC I G++  + L +   V G  ++    E+ + + +     +GL +LN+G ++ +    +R++ ++N ++I   + I +D+F                  N  +  +L+    NLAD  SK    A  +F + ML+   G A    PSSG L+ + +++IE++A+NDMWG Y D    ++    I      V IPV++TVVG PL F M + +  Q  ++R G+   G  P +R+ RI N S  DI ++W+++  D ++D +ILD +++  D F    PL+D   N                +   R+ TD      D   + SR  E+ ST                   + +T+R HEG + N P +  P Q++IP+     +   F P F   + E       G S   Y L ++SL++    +  ++ R   YE+  ++LD+++ +    L +   +  E + + +    S LL     D  + K         L N     + F L TR PF + +     +  +  G+        V + E   L    NL    G   S  L     +L  +Q++           + + FR  +   +NN    +L  + A +  P  ++SK  ++F TC + +     + + NK+ SAS+    + + +D+     F +   +G++     +   S++ +++ F  K   DY A  ++ G++GEE   + +  +GSYD +++
Sbjct:   22 YLQRPSSARSQDVTHILAKTFRDFFTRETVRPETIRNLAVSREGGDEYHERYVEALQKVHAERERRMAEATMLERHIMQAQARAMSADE--REMNRLASGHVNYPDLGLPPARSHFRSCIDSQLLRKHGLLCPEDFATEEPPPVPPPQAPKIPSYARETTTSLLHTAQGKEEGVKRLSPNMMESRDN-ILSGSDTE----DAEQINTQNVSQSNGSPRNADWKAQLDPLQREVDRADLALLQARADYLKNPRFVPPSAPGGGRTLIKPKKKKPKSQRPWPRSEEPNLEPSVVFIPSPSVVTFSNYQVGQVYETTLELKNVTTALRQCRVIPPKSSYFSVGLGQFPGENGVVAPGMSCHYNIRFIPDSLGDYDDELTVQTQSSVPLVVKVQARRPPPVLSLPSNIDVDQCLVGGCKIIQMPLHNSGGSGRFSIMKRSSWPTTNFKNVSSTGSVQVPPFEIRPSVFELHHGDTMLLEVIFTPPSVKEYTQSLTIVCDNCHVQHFTIRGEGQTAGVDLVSVDGGKSEPLPGELCDVAAQHLVKFETLNPFTYTQKRVILQNITNVDLPFHWKIVKPHLR--AVDIENPDTVIPVDRVIDLDSAFSIEPQSGILPAAKAVPFILTFAPAEVDKFHSVFHLILQEIPE-PPE------------------MENGEEKKENVREASNTSANEEGKVRDITTLEMEVKGESEPFKVLLQPYAIYISGKLLIGTSIRKQFQLENNSLSSVVFRWER-CSDPHILQVEPPMGELGPGCIMDCELSVTGTAPGKINHTLMCHIDNLDQPVPLHIEAEIKGPEVVLENADVNFGLVRMGMEASCEILLRNTCQVPAKWTLQESPDCLQGKVSEFTFKPCSGELKPLETKSVPVTFTPSSCRSVRTVFELKVQEGNECNISVRGEVQSPQACLLNCQLALDEV-YVDIPITPTVKLLNQTQLATVFEWHEVEGEHAELCSVEVTPKSGVLQPREELDITINFTAHKQGDISDLRIPCVIGGMEQALGLAVKAHVKGLCVSYRTAEEPEDLGDYSTCTDGL-SLNYGDDVQLGDTPRRYVFMKNNSAIAAPYSIHMDYFVARPPTPPTDGKDKGKMPNKSQRRQLLSKTTNLADPSSKSTTKAQAEFCQVMLRDGKGAAFSIQPSSGVLEPFSELMIEITAFNDMWGHYQDKLVCKVDKLDI------VQIPVTMTVVGCPLIFQMASTQPGQDAVVRFGTHVSGVPPINRQCRIMNSSPYDIRVDWQLFNID-ENDRQILDFVVTIGDGF----PLRDEHGN------EIKKKKGPPAALVKRVPTDMIPETPDTSPYPSR--EVSSTDTQATEEKKEAEAEEKEKLVKVTMRMHEGRMGNSPFSIVPAQMIIPAKGTSVITARFTP-FANTDVE------SGISLAGYALAYMSLDEVASNIPGKVKRVAGYEMVPLRLDLSSHVKPALLTI---ECTEDEGMRYRTAASDLL----KDGKVGKESLRVCSCNLSNYTGTPLTFKLLTRRPFTLVDIDPAADGHLGSGQ--------VQESEMCTLRPQHNLLVKVGFRVSLDLINYADILEPDQEKDGITLIVHEGERKLHFRYDMVAEFNNGTTQKL-PLYATLTVPSLMLSKESVDFGTCLVGQQRELELILSNKTGSASFWTAIIESKSDTCTADTFRITPASGVLDAHITHISNSKVLLKLHFIAKHNEDYEAVFLVQGMLGEEPRRLYVKGQGSYDERHE 1693          
BLAST of deleted in lung and esophageal cancer protein 1 vs. TrEMBL
Match: A0A267GA63 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031628g2 PE=4 SV=1)

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 521/1799 (28.96%), Postives = 863/1799 (47.97%), Query Frame = 1
Query:   25 MESIEYLQNHSQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQ-GSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEK----NKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNL------------------QNNRIESLS-----------RESSFSDLNSSPLITNR-----------------KDDKVLSSKKKEYRLP--PIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQS-NKDSCSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQG-DMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEG-GISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENI--DLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXX-GILFVNTPSTFTIELTNQSHLISSFNWQ----MPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKF----ENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDIEA------------------GKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYND--FVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFP--------ILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRSTDNF--ISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLK--AENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNI--------------ENREIKIG----------------ETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASYLFLKLVNPTDSV-----FELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQ 5019
            +E   +L   + A + D+ HI++K FG  F  + +DP++++NL+VSQ GSSD  H E++ +L+++   R+        L   I+ AK  A+  DE    +       +  L LP+  S+F   +D  LLR NGLI P D+ + +                  Q  R  + +           R S      S P    R                 KDD+V    +  YR+P  P ++   Q +I+K   +K  N  +      + +++ +L  M ++  FL NP++L+P     + N L     +D    ++F+  PE + FSDY++G+VYQ+ +  RN++  +R IRV+PP+++YFSL LGQFPGE G VA G+  ++ + F+PDSL D+EDEI VETQ    +F+V+I  +RPRPILT  +  D+  CL+YG K V  ++ N GG G F I  +      N K  +         F +RPS F L    T  LE+ F    +   + EF I+CDNC   +  + G G+   +++  V+  G++ P+  E+TD  A+ LL+F   +PYTY Q+++ LKN ++ E+PF WKIVKP  +    D + +    ++  +RTLD +S F IEP+FG+   + S  F++TFAP  V   HS  HL+L  +     +Q +             +   +G L+                      +LE+E K    P  VR    ++ +PG++L+ T +R+ L++ N S  PVS  W        I E+EP+ G I+      +D+C+   +PG    +L C V  LD+ + L V A+ +G  +++ + D++FGL++V +   + L+LLN   + C W    G         E+   P    LGPL+ Q V + + PS  + +N      + +G + F++  A  QSP+V +   +  +    L+++  S +T++L NQ+ L   F WQ     P      L     +P  G +EP     V + +T +A   L  + +PC I+G D P+ + +SG + G  ++VT     + +  + KF     + +K ++FG  + I   +KR+L I N TSI   F + ++ FK    + E                     L+   PNLAD +SKP K A +D  K  L+   G AV  +P SGTL++Y    IE++A+NDMWG Y D   V +    I S      +P+++ V G P+ FTMTAGR +Q PILR GS T G +  +R +R+NN+S   + ++W ++      D+++LD++  +  PFP        IL  +   D   D D +     T               LD    ++        +        + L +RPHEG  +  P T +P+QL +  +SY +V VTFD + +++         E   F+ Y+L F+SL++    +  ++ R   +E +Q++LD+T  I+ P L +DY   +  D+ +F+   S LLL     +    A   + T++ TLRNL+D  + F L   SPF I   K+               E++E  +                 +T  + + F  D   + L+++      +E+       QL  NE     + ++F+  L + + N    Q + + A +  P   +S+++++F  C + +       + N + S S    KLV  +D+      F  +  +G +  S      +++ +++ FTPK +  YSA L   G + EE  ++ +S  GSYD +Y+
Sbjct:   19 LEPSNHLHRPTSAKTQDVGHILSKQFGEQFIREAIDPQVVQNLRVSQRGSSDPYHEEFLGKLLSVVDSRQRRLDKLAQLERSIMAAKARAMLADERLANRLHSGRAGYPELGLPAPSSHFRACLDAELLRSNGLIGPTDLVSRVPPPVPPPSGVARSDLSEPQRKRTAASAGSAASSGAAGKRSSRLWSAASQPQQRTRGDSKSELLEADADEADVKDDEVSRVSEGSYRVPSAPRQQSPRQKKIEKLAKKKNLNWQEECSTEGRGEARKLLANMESRVGFLPNPKFLLPMDQGGNGNLLSSKLTRDPADTRIFVSNPEKIVFSDYQIGQVYQQSVELRNISCAMRYIRVIPPRSQYFSLSLGQFPGEFGQVAPGLCARFDVSFAPDSLRDFEDEIAVETQATGATFTVRIEARRPRPILTIPSELDVGQCLVYGSKTVYLRLSNKGGDGSFAIVRADQWPATNLKRAVQGDSATDGIFELRPSCFNLPRGATSTLEVTFTAREVKIFKSEFVIVCDNCQAKELMLIGEGQRPAVAIVAVDSPGVAEPQPGESTDAGAEALLRFEAAHPYTYCQRSVTLKNLANVELPFEWKIVKPFCRPPVPDEDEVAEARDLPGHRTLDADSPFTIEPEFGLLGASASQEFSLTFAPSFVSDFHSALHLLLMEVPLGPAEQQR-------------QASPNGALQ----------------------ALELECKAACEPFSVRLEPAAVQIPGDILVGTTIRQRLRLCNSSRAPVSFAWDSVADLASIVELEPRTGSIEAGSFISIDLCLTGTRPGQLDYSLSCRVQHLDEQLVLRVLASVRGVQIQLQQPDVNFGLLEVGKLAEQQLRLLNPCQLECHWSVHAGPDC------ELRFEPPSSRLGPLEEQQVTVRYRPSQAQTLNEVFRIDVANGESTFVSAFAEVQSPAVCVLEVEKLLEIADLYLDVKSAYTVQLYNQTRLRCQFEWQEAALAPSDEAGRLCETSVEPKSGWLEPRQCLPVTVYVTPRAIARLESLLIPCRIDGQDSPVVIELSGNMKG--ISVTYHCSEEPLPTQDKFPHEEADAIKRIDFG-TVPIHAVSKRYLHIRNNTSIRAGFSMDVEFFKAVPPETEVILPVERSQAAAQRTKSDRNSLLSKTPNLADPKSKPYKHAFYDMCKLYLRQNKGAAVHCSPYSGTLEAYSVTTIELTAFNDMWGCYTDNLLVSVEALPIQS------VPMALKVEGCPVIFTMTAGRPDQSPILRFGSHTHGSKSVTRPVRLNNRSPFALRLDWRVFNVQ-PDDDQLLDLLCDFGKPFPPLDANGEEILPAIPGDDGEADGDSSTRRLGTGVLPDTPDTSAAPSRLDSAAEAAAAAAARDAEAELPPLRPVVLNVRPHEGRPAVAPFTVRPQQLTLHPESYDYVHVTFDSNSIES-------VTEAMDFNTYMLAFMSLDEERAQVSGKVHRGVGHEADQLRLDVTGSIVCPELDIDY---NNDDKFAFNSAASDLLLMPVPASASPEAVGPAKTAFATLRNLRDTPLSFRLSLDSPFGIVQPKSAATMSQRPPPDADKEEHQEEALNSVGWSSACGPVSLTPRQTCLLELGFAFDWTMLQLVRE------SEARLASKGVQLTVNEAT-GERCLKFQGQLKMQFANGS-SQSLPLSACLRLPSLSLSQTELDFGICMVGQRRELNFTVANSTSSGSKWRAKLVRESDTCEPSSTFTFSPSSGYLDGSITYLSRNKMLIKVFFTPKHSESYSAELEFRGALEEEIRTVRLSGSGSYDEQYK 1748          
BLAST of deleted in lung and esophageal cancer protein 1 vs. TrEMBL
Match: A0A267GI26 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031628g1 PE=4 SV=1)

HSP 1 Score: 752.666 bits (1942), Expect = 0.000e+0
Identity = 518/1799 (28.79%), Postives = 863/1799 (47.97%), Query Frame = 1
Query:   25 MESIEYLQNHSQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQ-GSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEK----NKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNL------------------QNNRIESLS-----------RESSFSDLNSSPLITNR-----------------KDDKVLSSKKKEYRLP--PIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQS-NKDSCSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQG-DMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEG-GISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENI--DLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXX-GILFVNTPSTFTIELTNQSHLISSFNWQ----MPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKF----ENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDIEA------------------GKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYND--FVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFP--------ILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRSTDNF--ISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLK--AENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNI--------------ENREIKIG----------------ETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASYLFLKLVNPTDSV-----FELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQ 5019
            +E   +L   + A + D+ HI++K FG  F  + +DP++++NL+VSQ GSSD  H E++ +L+++   R+        L   I+ AK  A+  DE    +       +  L LP+  S+F   +D  LLR NGLI P D+ + +                  Q  R  + +           R S      S P    R                 KDD+V    +  YR+P  P ++   Q +I+K   +K  N  +      + +++ +L  M ++  FL NP++L+P     + N L     +D    ++F+  PE + FSDY++G+VYQ+ +  RN++  +R IRV+PP+++YFS+ LGQFPGE G VA G+  ++ + F+PDSL D+EDEI VETQ    +F+V+I  +RPRPILT  +  D+  CL+YG K V  ++ N GG G F I  +      N K  +         F +RPS F L    T  LE+ F    +   + EF I+CDNC   +  + G G+   +++  V+  G++ P+  E+TD  A+ LL+F   +PYTY Q+++ LKN ++ E+PF WKIVKP  +    D + +    ++  +RTLD +S F IEP+FG+   + S  F++TFAP  V   HS  HL+L  +     +Q +             +   +G L+                      +LE+E K    P  VR    ++ +PG++L+ T +R+ +++ N S  PVS  W        I E+EP+ G I+      +D+C+   +PG    +L C V  LD+ + L V A+ +G  +++ + D++FGL++V +   + L+LLN   + C W    G         E+   P    LGPL+ Q V + + PS  + +N      + +G + F++  A  QSP+V +  ++  +    L+++  S +T++L NQ+ L   F WQ     P      L     +P  G +EP     V + +T +A   L  + + C I+G D P+ + +SG + G  ++VT     + +  + KF     + +K ++FG  + I   +KR+L I N TSI   F + ++ FK    + E                     L+   PNLAD +SKP K A +D  K  L+   G AV  +P SGTL++Y    IE++A+NDMWG Y D   V +    I S      +P+++ V G P+ FTMTAGR +Q PILR GS T G +  +R +R+NN+S   + ++W ++      D+++LD++  +  PFP        IL  +   D   D D +     T               LD    ++        +        + L +RPHEG  +  P T +P+QL +  +SY +V VTFD + +++         E   F+ Y+L F+SL++    +  ++ R   +E +Q++LD+T  I+ P L +DY   +  D+ +F+   S LLL     +    A   + T++ TLRNL+D  + F L   SPF I   K+               E++E  +                 +T  + + F  D   + L+++      +E+       QL  NE     + ++F+  L + + N    Q + + A +  P   +S+++++F  C + +       + N + S S    KLV  +D+      F  +  +G +  S      +++ +++ FTPK +  YSA L   G + EE  ++ +S  GSYD +Y+
Sbjct:   21 LEPSNHLHRPTSAKTQDVGHILSKQFGEQFIREAIDPQVVQNLRVSQRGSSDPYHEEFLGKLLSVVDSRQRRLDKLAQLERSIMAAKARAMLADERLANRLHSGRAGYPELGLPAPSSHFRACLDAELLRSNGLIGPTDLVSRVPPPVPPPSGVARSDLSEPQRKRTAASAGSAASSGAAGKRSSRLWSAASQPQQRTRGDSKSELLEADADEAEVKDDEVSRVSEGSYRVPSAPRKQSPRQKKIEKLAKKKNLNWQEECSTEGRGEARKLLANMESRVGFLPNPKFLLPMDQGGNGNLLSSKLTRDPADTRIFVSNPEKIVFSDYQIGQVYQQSVELRNISCAMRYIRVIPPRSQYFSISLGQFPGEFGQVAPGLCARFDVSFAPDSLRDFEDEIAVETQATGATFTVRIEARRPRPILTIPSELDVGQCLVYGSKTVYLRLSNKGGDGSFAIVRADQWPATNLKRAVQGDSATDGIFELRPSCFNLPRGATSTLEVTFNAREVKIFKSEFVIVCDNCQAKELMLIGEGQRPAVAIVAVDSPGVAEPQPGESTDAGAEALLRFEAAHPYTYCQRSVTLKNLANVELPFEWKIVKPFCRPPVPDEDEVADARDLPGHRTLDADSPFTIEPEFGLLGASASQEFSLTFAPSFVGDFHSALHLLLMEVPLGPAEQQR-------------QASPNGALQ----------------------ALELECKAACEPFSVRLEPAAVQIPGDILVGTTIRQRVRLCNSSRAPVSFAWDSVADLASIVELEPRTGSIEAGSSISIDLCLTGTRPGQLDHSLGCRVQHLDEQLVLRVLASVRGVQIQLQQPDVNFGLLEVGKLAEQQLRLLNPCQLECHWSVHAGPDC------ELRFEPPSSRLGPLEEQQVTVRYRPSQAQTLNEVFRIDVANGESTFVSAFAEVQSPAVCVLEAEKLLEIADLYLDVKSAYTVQLYNQTRLRCQFEWQEAALAPSDEAGRLCETSVEPKSGWLEPRQCLPVTVYVTPRAIARLESLLILCRIDGQDSPVVIELSGNMKG--ISVTYHCSEEPLPTQDKFPHEEADAIKRIDFG-TVPIHAVSKRYLHIRNNTSIRAGFSMDVEFFKAVPPETEVILPVERSQAAAQRTKSDRNSLLSKTPNLADPKSKPYKHAFYDMCKLYLRQNKGAAVHCSPYSGTLEAYSVTTIELTAFNDMWGCYTDNLLVSVEALPIQS------VPMALKVEGCPVIFTMTAGRPDQSPILRFGSHTHGSKSVTRPVRLNNRSPFALRLDWRVFNVQ-PDDDQLLDLLCDFGKPFPPLDANGEEILPAIPGDDGEADGDSSTRRLGTGVLPDTPDTSAAPSRLDSAAEAAAAAAARDAEAELPPLRPVVLNVRPHEGRPAVAPFTVRPQQLTLHPESYDYVHVTFDSNSIES-------VTEAMDFNTYMLAFMSLDEERAQVSGKVRRGVGHEADQLRLDVTGSIVCPELDIDY---NNDDKFAFNSAASDLLLMPVPASASPEAVGPAKTAFATLRNLRDTPLSFRLSLDSPFGIVQPKSAATMSQRPPPDADKEEHQEEALNSVGWSSACGPVSLTPRQTCLLELGFAFDWTMLQLVRE------SEARLASKGVQLTVNEAT-GERCLKFQGQLKMQFANGS-SQSLPLSACLRLPSLSLSQTELDFGICMVGQRRELNFTVANSTSSGSKWRAKLVRESDTCEPSSTFTFSPSSGYLDGSITYLSRNKMLIKVFFTPKHSESYSAELEFRGALEEEIRTVRLSGSGSYDEQYK 1750          
BLAST of deleted in lung and esophageal cancer protein 1 vs. TrEMBL
Match: A0A267G8J1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031628g3 PE=4 SV=1)

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 518/1800 (28.78%), Postives = 862/1800 (47.89%), Query Frame = 1
Query:   25 MESIEYLQNHSQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQ-GSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEK----NKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNL------------------QNNRIESLS-----------RESSFSDLNSSPLITNRK------------------DDKVLSSKKKEYRLP--PIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQS-NKDSCSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQG-DMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEG-GISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENI--DLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXX-GILFVNTPSTFTIELTNQSHLISSFNWQ----MPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKF----ENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDIEA------------------GKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYND--FVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFP--------ILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRSTDNF--ISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLK--AENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNI--------------ENREIKIG----------------ETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASYLFLKLVNPTDSV-----FELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQ 5019
            +E   +L   + A + D+ HI++K FG  F  + +DP++++NL+VSQ GSSD  H E++ +L+++   R+        L   I+ AK  A+  DE    +       +  L LP+  S+F   +D  LLR NGLI P D+ + +                  Q  R  + +           R S      S P     +                  DD+V    +  YR+P  P ++   Q +I+K   +K  N  +      + +++ +L  M ++  FL NP++L+P     + N L     +D    ++F+  PE + FSDY++G+VYQ+ +  RN++  +R IRV+PP+++YFSL LGQFPGE G VA G+  ++ + F+PDSL D+EDEI VETQ    +F+V+I  +RPRPILT  +  D+  CL+YG K V  ++ N GG G F I  +      N K  +         F +RPS F L    T  LE+ F    +   + EF I+CDNC   +  + G G+   +++  V+  G++ P+  E+TD  A+ LL+F   +PYTY Q+++ LKN ++ E+PF WKIVKP  +    D + +    ++  +RTLD +S F IEP+FG+   + S  F++TFAP  V   HS  HL+L  +     +Q +             +   +G L+                      +LE+E K    P  VR    ++ +PG++L+ T +R+ L++ N S  PVS  W        I E+EP+ G I+      +D+C+   +PG    +L C V  LD+ + L V A+ +G  +++ + D++FGL++V +   + L+LLN   + C W    G         E+   P    LGPL+ Q V + + PS  + +N      + +G + F++  A  QSP+V +  ++  +    L+++  S +T++L NQ+ L   F WQ     P      L     +P  G +EP     V + +T +A   L  + + C I+G D P+ + +SG + G  ++VT     + +  + KF     + +K ++FG  + I   +KR+L I N TSI   F + ++ FK    + E                     L+   PNLAD +SKP K A +D  K  L+   G AV  +P SGTL++Y    IE++A+NDMWG Y D   V +    I S      +P+++ V G P+ FTMTAGR +Q PILR GS T G +  +R +R+NN+S   + ++W ++      D+++LD++  +  PFP        IL  +   D   D D +     T               LD    ++        +        + L +RPHEG  +  P T +P+QL +  +SY +V VTFD + +++         E   F+ Y+L F+SL++    +  ++ R   +E +Q++LD+T  I+ P L +DY   +  D+ +F+   S LLL     +    A   + T++ TLRNL+D  + F L   SPF I   K+               E++E  +                 +T  + + F  D   + L+++      +E+       QL  NE     + ++F+  L + + N    Q + + A +  P   +S+++++F  C + +       + N + S S    KLV  +D+      F  +  +G +  S      +++ +++ FTPK +  YSA L   G + EE  ++ +S  GSYD +Y+
Sbjct:   19 LEPSNHLHRPTSAKTQDVGHILSKQFGEQFIREAIDPQVVQNLRVSQRGSSDPYHEEFLGKLLSVVDSRQRRLDKLAQLERSIMAAKARAMLADERLANRLHSGRAGYPELGLPAPSSHFRACLDAELLRSNGLIGPTDLVSRVPPPVPPPSGVARSDLSEPQRKRTAASAGSAASSGAAGKRSSRLWSAASQPQQQRTRGDSKSELLEADADEADVKDDEVSRVSEGSYRVPSAPRKQSPRQKKIEKLAKKKNLNWQEECSTEGRGEARKLLANMESRVGFLPNPKFLLPMDQGGNGNLLSSKLTRDPADTRIFVSNPEKIVFSDYQIGQVYQQSVELRNISCAMRYIRVIPPRSQYFSLSLGQFPGEFGQVAPGLCARFDVSFAPDSLRDFEDEIAVETQATGATFTVRIEARRPRPILTIPSELDVGQCLVYGSKTVYLRLSNKGGDGSFAIVRADQWPATNLKRAVQGDSATDGIFELRPSCFNLPRGATSTLEVTFNAREVKIFKSEFVIVCDNCQAKELMLIGEGQRPAVAIVAVDSPGVAEPQPGESTDAGAEALLRFEAAHPYTYCQRSVTLKNLANVELPFEWKIVKPFCRPPVPDEDEVADARDLPGHRTLDADSPFTIEPEFGLLGASASQEFSLTFAPSFVGDFHSALHLLLMEVPLGPAEQQR-------------QASPNGALQ----------------------ALELECKAACEPFSVRLEPAAVQIPGDILVGTTIRQRLRLCNSSRAPVSFAWDSVADLASIVELEPRTGSIEAGSFISIDLCLTGTRPGQLDYSLSCRVQHLDEQLVLRVLASVRGVQIQLQQPDVNFGLLEVGKLAEQQLRLLNPCQLECHWSVHAGPDC------ELRFEPPSSRLGPLEEQQVTVRYRPSQAQTLNEVFRIDVANGESTFVSAFAEVQSPAVCVLEAEKLLEIADLYLDVKSAYTVQLYNQTRLRCQFEWQEAALAPSDEAGRLCETSVEPKSGWLEPRQCLPVTVYVTPRAIARLESLLILCRIDGQDSPVVIELSGNMKG--ISVTYHCSEEPLPTQDKFPHEEADAIKRIDFG-TVPIHAVSKRYLHIRNNTSIRAGFSMDVEFFKAVPPETEVILPVERSQAAAQRTKSDRNSLLSKTPNLADPKSKPYKHAFYDMCKLYLRQNKGAAVHCSPYSGTLEAYSVTTIELTAFNDMWGCYTDNLLVSVEALPIQS------VPMALKVEGCPVIFTMTAGRPDQSPILRFGSHTHGSKSVTRPVRLNNRSPFALRLDWRVFNVQ-PDDDQLLDLLCDFGKPFPPLDANGEEILPAIPGDDGEADGDSSTRRLGTGVLPDTPDTSAAPSRLDSAAEAAAAAAARDAEAELPPLRPVVLNVRPHEGRPAVAPFTVRPQQLTLHPESYDYVHVTFDSNSIES-------VTEAMDFNTYMLAFMSLDEERAQVSGKVRRGVGHEADQLRLDVTGSIVCPELDIDY---NNDDKFAFNSAASDLLLMPVPASASPEAVGPAKTAFATLRNLRDTPLSFRLSLYSPFGIVQPKSAATMSQRPPPDADKEEHQEEALNSVGWSSACGPVSLTPRQTCLLELGFAFDWTMLQLVRE------SEARLASKGVQLTVNEAT-GERCLKFQGQLKMQFANGS-SQSLPLSACLRLPSLSLSQTELDFGICMVGQRRELNFTVANSTSSGSKWRAKLVRESDTCEPSSTFTFSPSSGYLDGSITYLSRNKMLIKVFFTPKHSESYSAELEFRGALEEEIRTVRLSGSGSYDEQYK 1749          
BLAST of deleted in lung and esophageal cancer protein 1 vs. TrEMBL
Match: A0A1I8HYY9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 504/1773 (28.43%), Postives = 843/1773 (47.55%), Query Frame = 1
Query:   25 MESIEYLQNHSQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQ-GSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEK----NKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNL------------------QNNRIESLS-----------RESSFSDLNSSPLITNRK------------------DDKVLSSKKKEYRLP--PIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQS-NKDSCSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQG-DMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEG-GISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENI--DLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSS---INCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXX-GILFVNTPSTFTIELTNQSHLISSFNWQ----MPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKF----ENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDIEA------------------GKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYND--FVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFP--------ILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRSTDNF--ISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLK--AENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNI--------------ENREIKIG----------------ETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASYLFLKLVNPTDSV-----FELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDY 4929
            +E   +L   + A + D+ HI++K FG  F  + +DP++++NL+VSQ GSSD  H E++ +L+++   R+        L   I+ AK  A+  DE    +       +  L LP+  S+F   +D  LLR NGLI P D+ + +                  Q  R  + +           R S      S P     +                  DD+V    +  YR+P  P ++   Q +I+K   +K  N  +      + +++ +L  M ++  FL NP++L+P     + N L     +D    ++F+  PE + FSDY++G+VYQ+ +  RN++  +R IRV+PP+++YFSL LGQFPGE G VA G+  ++ + F+PDSL D+EDEI VETQ    +F+V+I  +RPRPILT  +  D+  CL+YG K V  ++ N GG G F I  +      N K  +         F +RPS F L    T  LE+ F    +   + EF I+CDNC   +  + G G+   +++  V+  G++ P+  E+TD  A+ LL+F   +PYTY Q+++ LKN ++ E+PF WKIVKP  +    D + +    ++  +RTLD +S F IEP+FG+   + S  F++TFAP  V   HS  HL+L  +     +Q +             +   +G L+                      +LE+E K    P  VR    ++ +PG++L+ T +R+ L++ N S  PVS  W        I E+EP+ G I+      +D+C+   +PG    +L C V  LD+ + L V A+ +G  +++ + D++FGL++V +   + L+LLN S    ++  W              E+   P    LGPL+ Q V + + PS  + +N      + +G + F++  A  QSP+V +  ++  +    L+++  S +T++L NQ+ L   F WQ     P      L     +P  G +EP     V + +T +A   L  + + C I+G D P+ + +SG + G  ++VT     + +  + KF     + +K ++FG  + I   +KR+L I N TSI   F + ++ FK    + E                     L+   PNLAD +SKP K A +D  K  L+   G AV  +P SGTL++Y    IE++A+NDMWG Y D   V +    I S      +P+++ V G P+ FTMTAGR +Q PILR GS T G +  +R +R+NN+S   + ++W ++      D+++LD++  +  PFP        IL  +   D   D D +     T               LD    ++        +        + L +RPHEG  +  P T +P+QL +  +SY +V VTFD + +++         E   F+ Y+L F+SL++    +  ++ R   +E +Q++LD+T  I+ P L +DY   +  D+ +F+   S LLL     +    A   + T++ TLRNL+D  + F L   SPF I   K+               E++E  +                 +T  + + F  D   + L+++      +E+       QL  NE     + ++F+  L + + N    Q + + A +  P   +S+++++F  C + +       + N + S S    KLV  +D+      F  +  +G +  S      +++ +++ FTP  +  Y
Sbjct:   19 LEPSNHLHRPTSAKTQDVGHILSKQFGEQFIREAIDPQVVQNLRVSQRGSSDPYHEEFLGKLLSVVDSRQRRLDKLAQLERSIMAAKARAMLADERLANRLHSGRAGYPELGLPAPSSHFRACLDAELLRSNGLIGPTDLVSRVPPPVPPPSGVARSDLSEPQRKRTAASAGSAASSGAAGKRSSRLWSAASQPQQQRTRGDSKSELLEADADEADVKDDEVSRVSEGSYRVPSAPRKQSPRQKKIEKLAKKKNLNWQEECSTEGRGEARKLLANMESRVGFLPNPKFLLPMDQGGNGNLLSSKLTRDPADTRIFVSNPEKIVFSDYQIGQVYQQSVELRNISCAMRYIRVIPPRSQYFSLSLGQFPGEFGQVAPGLCARFDVSFAPDSLRDFEDEIAVETQATGATFTVRIEARRPRPILTIPSELDVGQCLVYGSKTVYLRLSNKGGDGSFAIVRADQWPATNLKRAVQGDSATDGIFELRPSCFNLPRGATSTLEVTFNAREVKIFKSEFVIVCDNCQAKELMLIGEGQRPAVAIVAVDSPGVAEPQPGESTDAGAEALLRFEAAHPYTYCQRSVTLKNLANVELPFEWKIVKPFCRPPVPDEDEVADARDLPGHRTLDADSPFTIEPEFGLLGASASQEFSLTFAPSFVGDFHSALHLLLMEVPLGPAEQQR-------------QASPNGALQ----------------------ALELECKAACEPFSVRLEPAAVQIPGDILVGTTIRQRLRLCNSSRAPVSFAWDSVADLASIVELEPRTGSIEAGSFISIDLCLTGTRPGQLDYSLSCRVQHLDEQLVLRVLASVRGVQIQLQQPDVNFGLLEVGKLAEQQLRLLNPSGVPLVSARWADC-----------ELRFEPPSSRLGPLEEQQVTVRYRPSQAQTLNEVFRIDVANGESTFVSAFAEVQSPAVCVLEAEKLLEIADLYLDVKSAYTVQLYNQTRLRCQFEWQEAALAPSDEAGRLCETSVEPKSGWLEPRQCLPVTVYVTPRAIARLESLLILCRIDGQDSPVVIELSGNMKG--ISVTYHCSEEPLPTQDKFPHEEADAIKRIDFG-TVPIHAVSKRYLHIRNNTSIRAGFSMDVEFFKAVPPETEVILPVERSQAAAQRTKSDRNSLLSKTPNLADPKSKPYKHAFYDMCKLYLRQNKGAAVHCSPYSGTLEAYSVTTIELTAFNDMWGCYTDNLLVSVEALPIQS------VPMALKVEGCPVIFTMTAGRPDQSPILRFGSHTHGSKSVTRPVRLNNRSPFALRLDWRVFNVQ-PDDDQLLDLLCDFGKPFPPLDANGEEILPAIPGDDGEADGDSSTRRLGTGVLPDTPDTSAAPSRLDSAAEAAAAAAARDAEAELPPLRPVVLNVRPHEGRPAVAPFTVRPQQLTLHPESYDYVHVTFDSNSIES-------VTEAMDFNTYMLAFMSLDEERAQVSGKVRRGVGHEADQLRLDVTGSIVCPELDIDY---NNDDKFAFNSAASDLLLMPVPASASPEAVGPAKTAFATLRNLRDTPLSFRLSLDSPFGIVQPKSAATMSQRPPPDADKEEHQEEALNSVGWSSACGPVSLTPRQTCLLELGFAFDWTMLQLVRE------SEARLASKGVQLTVNEAT-GERCLKFQGQLKMQFANGS-SQSLPLSACLRLPSLSLSQTELDFGICMVGQRRELNFTVANSTSSGSKWRAKLVRESDTCEPSSTFTFSPSSGYLDGSITYLSRNKMLIKVFFTPNGSGSY 1717          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Cavefish
Match: DLEC1 (DLEC1 cilia and flagella associated protein [Source:NCBI gene;Acc:103021865])

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 471/1739 (27.08%), Postives = 817/1739 (46.98%), Query Frame = 1
Query:   73 DISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTK-----EKNKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNL----------------------QNNRIESLSRESSFSDLNSSPLITNRKDDKVLSSKKKEYRLPPIEKPATQDQIKKRK-SEKKRNPTDMMLASE-KYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQS----------NKDSCSQK-------MFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIG-GSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCG-----IEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPI-GRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHF--KTSSNDIEAGKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGR---KEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDR---NLDIDNFSSRFQEIISTKRSTDNFISLT---------IRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLD--NRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNIENREIKI---------GETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNE----------QQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSAS-YLFLKLVNPTDSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNK 5013
            DIS I+   F  L++ +    + + +L  ++   +    +YV+EL  +  E     ++++ L  HI  A+ +A   +E  +     E  + +  L+LP  +  F   +DN+LL+ N LI P+D  T                         N  I +  ++  +S +  S L        VL   ++   L   E+ ++   I  +K S+  ++   + ++++ K + KA L+ +    NFL+NP +  P         LI +          NK+ CS         +F+  P VV F DY VG+VY+  +  RN+T   R +RV+PP T +FS+GLG+FPG+ G+VA GISCQY +RF+PDSL DYED ++VETQ      V +  +RP P+LT     D  YCL+ G+K +    +N G  +G FCI         + ++ + ++     PF + P  F L   + + +E++F P +     + F I+CDNC    F + G G++  + +  +EGG  +PE+ E  D++A   ++F P N  + SQK +I+KN +H E+PF W I+KPNL+   +  E  D + +++  L  ++ F I P+ G+  P +   F +++ P ++  +HSV  LV++ + D++                    ++DG      S       K+G     D   +EI+VKG++ P K+     ++I+PGE  I+T +RK  ++ N S   +   W +  S+  I EVEP  G I+  E   +D+ +   +PG F  TL CHV    +PI L +EA FKGP L +    LD GL+++ + V  ++ + N S +   W  R   ++ T  F ++ INP  G+L PL S +V + F     R V C      ++ S+  G+  FL+V A  QSP V L   +L ++ + +V    +  + L NQ+ L + F W   + G  A L S  F P  G +EPN + ++ ++ T     EL ++   C +EG+  P+ L  S K    +++ ++ +   + ++    ++ +      + + I ++  R L++ N T+I   F ++ + F  +     +   +++++ P    +  K ++    +F   +L    G A    P SGTL  ++  II ++A+N+MWG Y D +          ++ V+IP+ ++V G P+ F M   +   + Q PI+R G+     +  SR +R+NN S  DI ++W  Y K+   D K++D+I++Y +PF    PLKD+D N                  S    TDR   +L   +  S F + +  +  T   +S+          I PHEG  ++ P    P+Q+V+P+     + V+F P  +        D +       Y LGF+SL D  + +D   ++ R   YE+E ++LD+ A +    L V     ++ D + FS   S LL    +  +L +       L L N  D  + F L  + PF +    +  +  +            E +K     +L  ++ + +K   +  H  +  L  + Q  P E           +R  K + F+  LT+ Y+N  + Q + + A +  P    S   I F TC++ +T    + + N+  S+S +  L        VF +    GL++  E         ++I FT      Y  +L + GI+GE  +++ +   GS+D +
Sbjct:   27 DISSILANIFKDLYTNEVTGKDTVTSLTKARREDNSYQDKYVQELQQVHLEYSRRMRDAEMLEKHISQARRQASDKEEQAQASILEEVGEAYHQLSLPLVKPAFLWCVDNDLLKRNHLICPQDCITEQVPLIKAPKGKPSTPGFAQPTVSYNKHIGTQPQDDGYSTVPHSDLTIQ----SVLERSEETLTLFSSEEASSTGSIHSQKVSQMDKHSWKLKVSAQSKAEDKAALQKLRKPQNFLRNPHFQ-PLSGQRGGESLIATKRRVQSAPNKNKECCSSSSPEAPVPVFIASPPVVLFDDYRVGQVYEATVELRNMTAASRHVRVIPPTTPHFSVGLGRFPGDGGVVAPGISCQYTVRFAPDSLDDYEDFLLVETQSPFPLVVPLEARRPPPVLTLPAVLDFGYCLVGGVKFMEVLCRNDGLSAGTFCIMPKHQWPASSLRSAVKASFAEQPPFAVSPCLFALLPGQAVVMEVVFFPAAAESCAQSFTIVCDNCQVKDFTMQGMGQLVMLELVAMEGGEDLPELGELHDLTADHFVRFDPANLNSISQKKLIIKNNTHLELPFQWCIMKPNLQ-PLLPGETPDPSGIQHH-LSTDNCFSISPEVGMLDPAQEHVFLLSYHPEQLMDYHSVCRLVIRDVPDMQ------------------NIYEDG-----GSQQLDMIPKVG-----DAIVMEIDVKGSTEPYKILLEPYALIIPGETYIHTTIRKSFKMWNHSKSAICFEWER-ISDHHIIEVEPSSGEIEINECFDMDLILTGGQPGHFATTLQCHVKHHPNPIGLPIEATFKGPQLTLSVPSLDLGLLQLGQEVCSTILISNNSPLEAQWSLRKLPSDPTVNFRQVKINPSEGVLPPLASCSVDVCF-----RAVCCQSFEGVLQLSVLDGTGCFLSVRADVQSPQVCLLCCELLLTDV-YVGVAQSNKVTLFNQTLLPAHFTWSNQLHGPQAHLCSASFTPTSGTLEPNTQMEISVSFTAHTDEELSEVTAVCEVEGMKKPVVLEFSAKAKRLSVSYSLPDTDCAGSDVVGQQSVILDFTEDQAVLIGKSVTRQLMVTNHTAIAAPFTMAANVFTGRCPLQSVRKREIVRM-PFHEMQAKKIEEKEYEEFVSGLLAHGKGAAFFTEPESGTLGPFESAIINITAFNNMWGTYEDHL----ICQVGDLDPVLIPMRLSVRGCPIHFQMIGPQPDNQNQGPIIRFGTHVSEGDTVSRLLRLNNTSPYDIRMDWLTYNKE-SEDGKLIDLIVAYGEPF----PLKDADGNEVVGGLEASMAFPPPWGQSHTPSTDRTSSSLRTRSGCSEFVDELCGEEETGTLVSVAPVKKLFSVFINPHEGNAADYPYCITPQQIVVPARGSSTIHVSFTPLTLS-------DPSIDQRCIGYALGFMSL-DSKVDVDPQGQVFRAQGYELEPLRLDLEAFVKPAVLTVQL--EEDEDLLEFSAAASDLL----DGDMLRQESLVVQTLQLSNSTDMPLGFRLCVQQPFSVLKSGHRHSHTVSSHSPSLTHSQSEAVKSQPALLLQPKRTIQVK---VAFHLSTALLTYQNQ--PVEDIPPSVTVLCSERGEKKLCFQQSLTIQYSNNTV-QTVPLCAHLALPTLYFSCDSINFGTCYVGQTRIKEVHLYNRGGSSSCWTTLIEAEEGSEVFRVAPEHGLLKPLEYPVSSCRQTLEISFTANDERSYQGTLTVQGILGEPPLTLHLEGNGSFDER 1693          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Cavefish
Match: DLEC1 (DLEC1 cilia and flagella associated protein [Source:NCBI gene;Acc:103021865])

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 461/1717 (26.85%), Postives = 805/1717 (46.88%), Query Frame = 1
Query:   73 DISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTK-----EKNKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNLQNNRIESLSRESSFSDLNSSPLITNRKDDKVLSSKKKEYRLPPIEKPATQDQIKKRK-SEKKRNPTDMMLASE-KYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQS----------NKDSCSQK-------MFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIG-GSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCG-----IEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPI-GRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHF--KTSSNDIEAGKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGR---KEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDR---NLDIDNFSSRFQEIISTKRSTDNFISLT---------IRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLD--NRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNIENREIKI---------GETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNE----------QQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSAS-YLFLKLVNPTDSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNK 5013
            DIS I+   F  L++ +    + + +L  ++   +    +YV+EL  +  E     ++++ L  HI  A+ +A   +E  +     E  + +  L+LP  + +             G   P    T   N  I +  ++  +S +  S L        VL   ++   L   E+ ++   I  +K S+  ++   + ++++ K + KA L+ +    NFL+NP +  P         LI +          NK+ CS         +F+  P VV F DY VG+VY+  +  RN+T   R +RV+PP T +FS+GLG+FPG+ G+VA GISCQY +RF+PDSL DYED ++VETQ      V +  +RP P+LT     D  YCL+ G+K +    +N G  +G FCI         + ++ + ++     PF + P  F L   + + +E++F P +     + F I+CDNC    F + G G++  + +  +EGG  +PE+ E  D++A   ++F P N  + SQK +I+KN +H E+PF W I+KPNL+   +  E  D + +++  L  ++ F I P+ G+  P +   F +++ P ++  +HSV  LV++ +    PD     ++G  +Q  ++    D  +                        +EI+VKG++ P K+     ++I+PGE  I+T +RK  ++ N S   +   W +  S+  I EVEP  G I+  E   +D+ +   +PG F  TL CHV    +PI L +EA FKGP L +    LD GL+++ + V  ++ + N S +   W  R   ++ T  F ++ INP  G+L PL S +V + F     R V C      ++ S+  G+  FL+V A  QSP V L   +L ++ + +V    +  + L NQ+ L + F W   + G  A L S  F P  G +EPN + ++ ++ T     EL ++   C +EG+  P+ L  S K    +++ ++ +   + ++    ++ +      + + I ++  R L++ N T+I   F ++ + F  +     +   +++++ P    +  K ++    +F   +L    G A    P SGTL  ++  II ++A+N+MWG Y D +          ++ V+IP+ ++V G P+ F M   +   + Q PI+R G+     +  SR +R+NN S  DI ++W  Y K+   D K++D+I++Y +PF    PLKD+D N                  S    TDR   +L   +  S F + +  +  T   +S+          I PHEG  ++ P    P+Q+V+P+     + V+F P  +        D +       Y LGF+SL D  + +D   ++ R   YE+E ++LD+ A +    L V     ++ D + FS   S LL    +  +L +       L L N  D  + F L  + PF +    +  +  +            E +K     +L  ++ + +K   +  H  +  L  + Q  P E           +R  K + F+  LT+ Y+N  + Q + + A +  P    S   I F TC++ +T    + + N+  S+S +  L        VF +    GL++  E         ++I FT      Y  +L + GI+GE  +++ +   GS+D +
Sbjct:   25 DISSILANIFKDLYTNEVTGKDTVTSLTKARREDNSYQDKYVQELQQVHLEYSRRMRDAEMLEKHISQARRQASDKEEQAQASILEEVGEAYHQLSLPLGKPS-----------TPGFAQP----TVSYNKHIGTQPQDDGYSTVPHSDLTIQ----SVLERSEETLTLFSSEEASSTGSIHSQKVSQMDKHSWKLKVSAQSKAEDKAALQKLRKPQNFLRNPHFQ-PLSGQRGGESLIATKRRVQSAPNKNKECCSSSSPEAPVPVFIASPPVVLFDDYRVGQVYEATVELRNMTAASRHVRVIPPTTPHFSVGLGRFPGDGGVVAPGISCQYTVRFAPDSLDDYEDFLLVETQSPFPLVVPLEARRPPPVLTLPAVLDFGYCLVGGVKFMEVLCRNDGLSAGTFCIMPKHQWPASSLRSAVKASFAEQPPFAVSPCLFALLPGQAVVMEVVFFPAAAESCAQSFTIVCDNCQVKDFTMQGMGQLVMLELVAMEGGEDLPELGELHDLTADHFVRFDPANLNSISQKKLIIKNNTHLELPFQWCIMKPNLQ-PLLPGETPDPSGIQHH-LSTDNCFSISPEVGMLDPAQEHVFLLSYHPEQLMDYHSVCRLVIRDV----PDMQNIYEDGGSQQLDMIPKVGDAIV------------------------MEIDVKGSTEPYKILLEPYALIIPGETYIHTTIRKSFKMWNHSKSAICFEWER-ISDHHIIEVEPSSGEIEINECFDMDLILTGGQPGHFATTLQCHVKHHPNPIGLPIEATFKGPQLTLSVPSLDLGLLQLGQEVCSTILISNNSPLEAQWSLRKLPSDPTVNFRQVKINPSEGVLPPLASCSVDVCF-----RAVCCQSFEGVLQLSVLDGTGCFLSVRADVQSPQVCLLCCELLLTDV-YVGVAQSNKVTLFNQTLLPAHFTWSNQLHGPQAHLCSASFTPTSGTLEPNTQMEISVSFTAHTDEELSEVTAVCEVEGMKKPVVLEFSAKAKRLSVSYSLPDTDCAGSDVVGQQSVILDFTEDQAVLIGKSVTRQLMVTNHTAIAAPFTMAANVFTGRCPLQSVRKREIVRM-PFHEMQAKKIEEKEYEEFVSGLLAHGKGAAFFTEPESGTLGPFESAIINITAFNNMWGTYEDHL----ICQVGDLDPVLIPMRLSVRGCPIHFQMIGPQPDNQNQGPIIRFGTHVSEGDTVSRLLRLNNTSPYDIRMDWLTYNKE-SEDGKLIDLIVAYGEPF----PLKDADGNEVVGGLEASMAFPPPWGQSHTPSTDRTSSSLRTRSGCSEFVDELCGEEETGTLVSVAPVKKLFSVFINPHEGNAADYPYCITPQQIVVPARGSSTIHVSFTPLTLS-------DPSIDQRCIGYALGFMSL-DSKVDVDPQGQVFRAQGYELEPLRLDLEAFVKPAVLTVQL--EEDEDLLEFSAAASDLL----DGDMLRQESLVVQTLQLSNSTDMPLGFRLCVQQPFSVLKSGHRHSHTVSSHSPSLTHSQSEAVKSQPALLLQPKRTIQVK---VAFHLSTALLTYQNQ--PVEDIPPSVTVLCSERGEKKLCFQQSLTIQYSNNTV-QTVPLCAHLALPTLYFSCDSINFGTCYVGQTRIKEVHLYNRGGSSSCWTTLIEAEEGSEVFRVAPEHGLLKPLEYPVSSCRQTLEISFTANDERSYQGTLTVQGILGEPPLTLHLEGNGSFDER 1654          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Cavefish
Match: DLEC1 (DLEC1 cilia and flagella associated protein [Source:NCBI gene;Acc:103021865])

HSP 1 Score: 566.229 bits (1458), Expect = 1.002e-172
Identity = 423/1500 (28.20%), Postives = 724/1500 (48.27%), Query Frame = 1
Query:   73 DISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTK-----EKNKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNL----------------------QNNRIESLSRESSFSDLNSSPLITNRKDDKVLSSKKKEYRLPPIEKPATQDQIKKRK-SEKKRNPTDMMLASE-KYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQS----------NKDSCSQK-------MFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIG-GSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCG-----IEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPI-GRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHF--KTSSNDIEAGKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGR---KEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDR---NLDIDNFSSRFQEIISTKRSTDNFISLT---------IRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLD--NRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSF---TSYLTLRN 4347
            DIS I+   F  L++ +    + + +L  ++   +    +YV+EL  +  E     ++++ L  HI  A+ +A   +E  +     E  + +  L+LP  +  F   +DN+LL+ N LI P+D  T                         N  I +  ++  +S +  S L        VL   ++   L   E+ ++   I  +K S+  ++   + ++++ K + KA L+ +    NFL+NP +  P         LI +          NK+ CS         +F+  P VV F DY VG+VY+  +  RN+T   R +RV+PP T +FS+GLG+FPG+ G+VA GISCQY +RF+PDSL DYED ++VETQ      V +  +RP P+LT     D  YCL+ G+K +    +N G  +G FCI         + ++ + ++     PF + P  F L   + + +E++F P +     + F I+CDNC    F + G G++  + +  +EGG  +PE+ E  D++A   ++F P N  + SQK +I+KN +H E+PF W I+KPNL+   +  E  D + +++  L  ++ F I P+ G+  P +   F +++ P ++  +HSV  LV++ + D++                    ++DG      S       K+G     D   +EI+VKG++ P K+     ++I+PGE  I+T +RK  ++ N S   +   W +  S+  I EVEP  G I+  E   +D+ +   +PG F  TL CHV    +PI L +EA FKGP L +    LD GL+++ + V  ++ + N S +   W  R   ++ T  F ++ INP  G+L PL S +V + F     R V C      ++ S+  G+  FL+V A  QSP V L   +L ++ + +V    +  + L NQ+ L + F W   + G  A L S  F P  G +EPN + ++ ++ T     EL ++   C +EG+  P+ L  S K    +++ ++ +   + ++    ++ +      + + I ++  R L++ N T+I   F ++ + F  +     +   +++++ P    +  K ++    +F   +L    G A    P SGTL  ++  II ++A+N+MWG Y D +          ++ V+IP+ ++V G P+ F M   +   + Q PI+R G+     +  SR +R+NN S  DI ++W  Y K+   D K++D+I++Y +PF    PLKD+D N                  S    TDR   +L   +  S F + +  +  T   +S+          I PHEG  ++ P    P+Q+V+P+     + V+F P  +        D +       Y LGF+SL D  + +D   ++ R   YE+E ++LD+ A +    L V     ++ D + FS   S LL   + D L     +F   T+ LT +N
Sbjct:   27 DISSILANIFKDLYTNEVTGKDTVTSLTKARREDNSYQDKYVQELQQVHLEYSRRMRDAEMLEKHISQARRQASDKEEQAQASILEEVGEAYHQLSLPLVKPAFLWCVDNDLLKRNHLICPQDCITEQVPLIKAPKGKPSTPGFAQPTVSYNKHIGTQPQDDGYSTVPHSDLTIQ----SVLERSEETLTLFSSEEASSTGSIHSQKVSQMDKHSWKLKVSAQSKAEDKAALQKLRKPQNFLRNPHFQ-PLSGQRGGESLIATKRRVQSAPNKNKECCSSSSPEAPVPVFIASPPVVLFDDYRVGQVYEATVELRNMTAASRHVRVIPPTTPHFSVGLGRFPGDGGVVAPGISCQYTVRFAPDSLDDYEDFLLVETQSPFPLVVPLEARRPPPVLTLPAVLDFGYCLVGGVKFMEVLCRNDGLSAGTFCIMPKHQWPASSLRSAVKASFAEQPPFAVSPCLFALLPGQAVVMEVVFFPAAAESCAQSFTIVCDNCQVKDFTMQGMGQLVMLELVAMEGGEDLPELGELHDLTADHFVRFDPANLNSISQKKLIIKNNTHLELPFQWCIMKPNLQ-PLLPGETPDPSGIQHH-LSTDNCFSISPEVGMLDPAQEHVFLLSYHPEQLMDYHSVCRLVIRDVPDMQ------------------NIYEDG-----GSQQLDMIPKVG-----DAIVMEIDVKGSTEPYKILLEPYALIIPGETYIHTTIRKSFKMWNHSKSAICFEWER-ISDHHIIEVEPSSGEIEINECFDMDLILTGGQPGHFATTLQCHVKHHPNPIGLPIEATFKGPQLTLSVPSLDLGLLQLGQEVCSTILISNNSPLEAQWSLRKLPSDPTVNFRQVKINPSEGVLPPLASCSVDVCF-----RAVCCQSFEGVLQLSVLDGTGCFLSVRADVQSPQVCLLCCELLLTDV-YVGVAQSNKVTLFNQTLLPAHFTWSNQLHGPQAHLCSASFTPTSGTLEPNTQMEISVSFTAHTDEELSEVTAVCEVEGMKKPVVLEFSAKAKRLSVSYSLPDTDCAGSDVVGQQSVILDFTEDQAVLIGKSVTRQLMVTNHTAIAAPFTMAANVFTGRCPLQSVRKREIVRM-PFHEMQAKKIEEKEYEEFVSGLLAHGKGAAFFTEPESGTLGPFESAIINITAFNNMWGTYEDHL----ICQVGDLDPVLIPMRLSVRGCPIHFQMIGPQPDNQNQGPIIRFGTHVSEGDTVSRLLRLNNTSPYDIRMDWLTYNKE-SEDGKLIDLIVAYGEPF----PLKDADGNEVVGGLEASMAFPPPWGQSHTPSTDRTSSSLRTRSGCSEFVDELCGEEETGTLVSVAPVKKLFSVFINPHEGNAADYPYCITPQQIVVPARGSSTIHVSFTPLTLS-------DPSIDQRCIGYALGFMSL-DSKVDVDPQGQVFRAQGYELEPLRLDLEAFVKPAVLTVQL--EEDEDLLEFSAAASDLL---DGDMLRQVKVAFHLSTALLTYQN 1461          

HSP 2 Score: 61.2326 bits (147), Expect = 1.055e-8
Identity = 37/147 (25.17%), Postives = 68/147 (46.26%), Query Frame = 1
Query: 4576 QRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSAS-YLFLKLVNPTDSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNK 5013
            +R  K + F+  LT+ Y+N  + Q + + A +  P    S   I F TC++ +T    + + N+  S+S +  L        VF +    GL++  E         ++I FT      Y  +L + GI+GE  +++ +   GS+D +
Sbjct: 1477 ERGEKKLCFQQSLTIQYSNNTV-QTVPLCAHLALPTLYFSCDSINFGTCYVGQTRIKEVHLYNRGGSSSCWTTLIEAEEGSEVFRVAPEHGLLKPLEYPVSSCRQTLEISFTANDERSYQGTLTVQGILGEPPLTLHLEGNGSFDER 1622          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001803.1 (pep scaffold:Pmarinus_7.0:GL476330:20174:144478:-1 gene:ENSPMAG00000001615.1 transcript:ENSPMAT00000001803.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 2.734e-6
Identity = 32/106 (30.19%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  793 QKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGL-VAAGISCQYAIRFSPDSLGDYEDEIVVETQGD-MSFSVKIIGKR 1104
            Q MF P P  + F ++E  + Y+  +N RN   V R ++V    + YF +     P + G  VA G++  + I F+P+   DY  ++V  T+ +     V+ IG R
Sbjct:   95 QAMFQPFPSEITFQNFEPCETYEVPLNLRNNDRVPRLVKVSQEDSPYFKI---ISPNDVGTKVAPGMASTFRIVFTPEQKKDYTHQVVCVTEREKFMVPVRAIGSR 197          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Nematostella
Match: EDO45789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRN0])

HSP 1 Score: 366.311 bits (939), Expect = 4.444e-103
Identity = 302/1188 (25.42%), Postives = 527/1188 (44.36%), Query Frame = 1
Query: 1588 ILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPI-GRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKID-SMTNEPK---FENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTS------------SNDIEAGKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFV--RISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRSTDN-------FISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNIENRE-----------IKIGETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIE---RQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASYLFL----KLVNPTDSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQ 5019
            I     +  +PF WK+ KP L S S +          +R  D +  F + P  G  PP+E + F++  AP EV   H V H+VL+ I     D   SI +                                     DVT++EIEVK    P  +  +   +++PG +++ TP    ++I N S+   S  W   +++D+   +EP+ G++   E+  + V +  N P     TL C+V     P+ L V+ NF+GP++ I   DL+FGLV++ ++ + ++ + N S +   W           + E  F+ P  G LGP++     + F P+  R V    + ++  G T +L+V +  Q+P V L SS L +  + ++N P +  + L N + L + F W+  +  +  +  ++ F+P  G + P     V++T T   +  L  +   C + G+D PI L IS  V G N+     + +D    +E K    E+    L F + + + +  K  L++ NT++I   + + ++HFK +             N      L+   PN+AD  SK    A  D + ++L+   G A   +P  G L  +   ++EVSAYNDMWG+Y D +  ++ G      ++ V IP+ +TVVG PL F M    K+Q PILR G+   G     R +R+NN S  DI ++W  Y    D D ++LD+++ Y  P P+                                          F S+ QE I +     +        I + ++ H+GI+S++P    P Q +IP+ S+  + VTF PH          D+ EG +   Y   ++SL+  N+ +  R+ R+   E+ + +LD+TA I    L V+     E D+ +     +S +LK +      K   F     + N  +  + F L+  +PF +   +   + +           +K G+ I+V V F L R  + L    +  GH+    +  E   RQL+ N           RD++    NNTK  QLI + A +  P F +S+  ++F  C + +     + + N ++S S   +    +  + T  VF +    G ++    +  +++  +++ FT +  + Y   ++  G + E+   + +  +GSYD  ++
Sbjct:  852 IRTRSCNVSLPFRWKLFKPFLPSVSQEPTG-----RVHRVPDDQGVFSVTPNMGALPPHEVVHFSLENAPKEVGSFHGVAHMVLEEIPVQGGDAAGSIAK-------------------------------------DVTAIEIEVKAECKPFYIEVSPALLVIPGRMMLGTPYLYSVKIQNNSVSRSSFEWQDIKTDDYAVSIEPRSGVLGAGEMVELCVSVFGNSPDSMDATLTCYVPFSSSPVFLRVKGNFQGPEVLIGLPDLNFGLVRLGKSSKSTIPIKNTSIVRADWSMEECSDMTQDVSEFTFV-PSHGSLGPMEEITCEVTFGPTQCRRVRSVFQCAVRKGKTSYLSVFSEVQTPLVCLVSSSLYIEDV-YLNVPVSREVVLQNHTLLATHFQWKEIVDDKGDKGYTVTFEPSSGELGPRQALPVQMTFTGHRKGPLESLVTSCEVTGMDKPIWLDISTDVRGLNVTFETPKLLDLRRPDEIKTVDIESTPLLLEF-ETVPLGEQGKATLVMTNTSAIRARYSLHVEHFKAAKPPSPPEGQPKNKNSRRLQGLLARTPNIADPLSKTATKAQADHSATVLRDGRGAAFILSPCEGELLPFGYQVVEVSAYNDMWGDYRDLLVCQVEG------LDPVYIPIKMTVVGCPLNFQMM---KDQAPILRFGTHVSGAPSVQRSLRLNNTSPFDIRLDWGTYNIIRD-DPQLLDMLVFYGQPLPL------------------------------------------FDSKGQEQIPSPPPLPDSLCDELPLIQVKLQEHDGILSSKPFGVTPSQQIIPAKSHATMNVTFTPH---------TDDPEGEACICYAAAYMSLDGQNVNIPGRVSRKQGLEMARFRLDVTANIRPALLSVEM----EEDKGAHFTTAASDVLKGD----ATKVHRF----VMSNTTETPLNFRLEIPAPFRLVCTEPPPSAKSSRPVPGGLTTVKPGKNIEVKVGFCLTRGLLELASSVDESGHDGCSLITKETGNRQLVFN-----------RDLVVFFSNNTK--QLIPLTASVDVPTFRLSEEVLDFGICLVGQEKELDLTLENPAESDSTWMVEHDPRYPDVTREVFSITPSEGFLEGHYSHVSKNKTLLKVTFTARHNVKYKCVVMFRGRLQEQVQRLTLIGQGSYDGHHE 1908          

HSP 2 Score: 257.684 bits (657), Expect = 4.455e-69
Identity = 172/551 (31.22%), Postives = 286/551 (51.91%), Query Frame = 1
Query:   40 YLQNHSQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEKN----KDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTN--------LQNNRIESLSR--ESSFSDLNSSPLITNRKDDKVLS-----SKKKEYRLPPIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCS--------NESKNWLIQSNKDSC-SQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTV-LDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNES 1605
            ++Q  S A S D+SHI+   F  LF+ D V  + +++L  S+   +  H +YV++L  I  +R+   + +  L  HI+ A+  A+  DE   +K     +D++ L LP  +SN    +D  LLR  GLI P+D FT+         Q   I S +R   SS      +P +T+      L+     SK+         + +   Q  K K  K     D M  +++   +  L+ + +K  + +N R++ P+ +        + SK      +K    + ++FL  P  + F+DY VG+VY+  I  +N+T+  R++RV+PP +K+FS+GLG+FPGE G+VA G+SC Y IRF+PDSL DY+D I +++Q D    V +  +RP P L+        +CL+ G K V     N GG G+FC+         + K  +    +V ++PF I P+ F+LR  E+  +++ F P +    ++E  ++CDNC    F + G G+MA I   ++ GG+S  ++ E  D+S++ L++F   NP T   K + +KN +
Sbjct:   16 HIQRPSSARSQDVSHILASVFRELFTRDSVGEQRVKHLATSRSGEETYHDKYVQQLRKIQQDRDQCHREADMLETHIMQAQAAAMAADERDIQKALVECEDYQKLGLPPGKSNLRHCLDTELLRKFGLIVPQD-FTSEDPKPARPPQAADIPSYARCTTSSQQRFRKTPPLTDYVTTSSLAYPFAASKQTSLAHEQGLRESPPPQTAKTKQSKTSAWKDSMKPNQRKVERDDLQRLESKAEYKQNLRFVPPEAAELIQKKTKHRSKTKTTSQDKSGFKAVEVFLVSPNPLVFTDYNVGEVYELSIELKNVTSSSRQVRVVPPTSKHFSIGLGRFPGENGVVAPGMSCVYPIRFAPDSLADYDDLIKIKSQVDPPLIVHLQARRPPPSLSLPPTLRCGHCLVGGYKAVRMYCTNSGGDGRFCLIPKTQWPTASFKWTLEDPGSVNVNPFEIEPAMFQLRKGESTTIKITFSPYAATFFKQEIAMVCDNCQVKSFSVEGTGQMAGIQFMSISGGLSQYDVGEMKDVSSKFLVRFDHQNPQTNHSKILEIKNTT 565          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Medaka
Match: DLEC1 (DLEC1 cilia and flagella associated protein [Source:NCBI gene;Acc:101155890])

HSP 1 Score: 370.933 bits (951), Expect = 6.334e-108
Identity = 318/1153 (27.58%), Postives = 509/1153 (44.15%), Query Frame = 1
Query:  988 ISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIG-GSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISG---KVLGPNLNVTIFEKIDSMTNEPKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDIEAGKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGRKE---QKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIIS-TKRSTDNFISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYL-LGFLSLE-DHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKN 4416
            +SC+Y++RF PDSL DY+D +VVETQ +    V I  +RP PILT     D  YCL+ GLK V +  +N+G  SG FCI         N +++  +  +   PF + PS F+L   +T  +E++F PT+  K  + +  +CDNC    F I    E   ++++ V      PE  E  D++A+  ++F   NP++   K ++++N +H ++PF W+I +PNL             I  +   D   AF I P  G+ PP +   F +TF P E+K +HSV  LVL+   D  P +T                                           V ++EIEVKG++ P ++     +II+PGE+ + T   +  ++ N S   +   W K +S      VEP  G I+  E    D+ +   KP   +  L+C+++    PI L +E +FKGP + +    +DFGLV++ E   RSL+L N + +   W   +             + P  G+L PL S +V + FTP   +     +E  +E+G    + + A  QSP V L + KL  + I ++  P + ++ L NQ+ L + F+W                                        EL ++   C +EG++ P+ L I+    K L  + ++     ++     P        L+FG ++ +     R LLI N T+I   F I +++F  S                       Q LAD            G A    P SG L  ++   + V+A  DMWGEY+D +          +E VIIP+ + V G PL F MT  R +   Q PI+  G+   G +  S  +RINN S  DI ++WE Y  + D D K+LD++L++ +PFP     KD+D + +                            D   +  +E  + T  +    +S+ IRPH G +S+ P    P+Q+VIP+ S   + V+F P        L   E    S  + L LGF+SL+ +    +  ++ R    E++ +++D+ A +  P L V   +  E           +L  KA    LL K    +    LRN  +  + F ++T+ PF +   K 
Sbjct:    1 MSCKYSLRFIPDSLEDYKDFLVVETQAEQVLLVPIEAQRPPPILTPKV-LDCGYCLVGGLKYVEFLCQNVGQSSGTFCIIPKSQWPFSNLRSLSRTYFSEQPPFAVGPSLFQLEPGDTTVIEVVFSPTTAQKSRQTYTFVCDNCQVKDFSIE---EGQLVALQLVSEEKETPEAGEIHDVTAEHYVRFDVCNPHSVQHKRLVIRN-NHLDLPFQWQIRQPNLYPLPPGEVPEPSQIHFHPATD--DAFRISPVAGLLPPYQDQEFLLTFCPKELKDYHSVCRLVLRDAPD--PVET-------------------------------------------VIAMEIEVKGSTEPFQILLEPYAIIIPGEIFVCTTTHRQFKMWNHSKTFILFQWEKLKSSYHTMVVEPPTGRIE-NECFDFDLILSGRKPEKLKTNLICNIEHHLQPITLPIEVSFKGPMVTLSVPSVDFGLVRLGEQTHRSLELTNTTQLEAFWTLMIS------------VKPCSGMLPPLGSCSVEVIFTPQFCQQFKAELELEVENGRGH-VWIQADVQSPQVCLLNCKLAFTEI-YLGVPKSASVTLFNQTALPAKFSW---------------------------------------LELTEVAALCEVEGMNLPLILGIAASKPKKLSVSYSLPSDFPLNGRCTSP------VELDFGDDVILKNPVTRQLLITNQTAIAAPFAIEVEYFFVS-----------------------QLLAD----------GRGAAFRVVPDSGLLGPFETQTVAVTAVTDMWGEYSDNL----ICKVGDLEAVIIPLRMAVRGCPLYFQMTGPRTDNQFQGPII-FGTCIPGGDTVSHPLRINNPSTFDIRMDWETYNIEKD-DSKLLDVVLAFGEPFPP----KDADGSEE----------------------------DQGDAEGEEGCALTSHAKKKLVSVHIRPHVGKLSDYPFCINPQQIVIPAKSGATIHVSFTP--------LTPSECVSESRCSGLALGFMSLDFEMAACVPGKVRRAQGLELQPVRVDLQAAV-KPALLVQMEEVGE-----------ALEFKASAGDLL-KEFDVSQTFQLRNTSEVALHFRMETQPPFSVLKAKQ 949          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Medaka
Match: DLEC1 (DLEC1 cilia and flagella associated protein [Source:NCBI gene;Acc:101155890])

HSP 1 Score: 223.402 bits (568), Expect = 1.634e-62
Identity = 116/328 (35.37%), Postives = 189/328 (57.62%), Query Frame = 1
Query:  637 DMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNKDSCSQ------KMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIG-GSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKN 1599
            D + A+++ +    ++ +  + NFL+NPR+L P  + +    LIQ    S +        +F+  P VV F+ Y+VG +Y+  +  RN+T+  R IRVLPP + +FS+GLG+FP E+G +A G+SC+Y++RF PDSL DY+D +VVETQ +    V I  +RP PILT     D  YCL+ GLK V +  +N+G  SG FCI         N +++  +  +   PF + PS F+L   +T  +E++F PT+  K  + +  +CDNC    F I G G++  ++++ V      PE  E  D++A+  ++F   NP++   K ++++N
Sbjct:  161 DELSATDQVEGMREIQKLKDRQNFLRNPRFLSPT-AEQGGVSLIQRRGPSKTNLSGDPPPIFIAKPSVVTFTGYKVGHIYETTLELRNVTSSSRHIRVLPPNSPHFSIGLGRFPSEEGTIAPGMSCKYSLRFIPDSLEDYKDFLVVETQAEQVLLVPIEAQRPPPILTLPKVLDCGYCLVGGLKYVEFLCQNVGQSSGTFCIIPKSQWPFSNLRSLSRTYFSEQPPFAVGPSLFQLEPGDTTVIEVVFSPTTAQKSRQTYTFVCDNCQVKDFSIEGEGQL--VALQLVSEEKETPEAGEIHDVTAEHYVRFDVCNPHSVQHKRLVIRN 485          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Medaka
Match: DLEC1 (DLEC1 cilia and flagella associated protein [Source:NCBI gene;Acc:101155890])

HSP 1 Score: 211.46 bits (537), Expect = 1.281e-58
Identity = 118/333 (35.44%), Postives = 180/333 (54.05%), Query Frame = 1
Query:  799 MFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIG-GSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFA 1794
            +F+  P VV F+ Y+VG +Y+  +  RN+T+  R IRVLPP + +FS+GLG+FP E+G +A G+SC+Y++RF PDSL DY+D +VVETQ +    V I  +RP PILT     D  YCL+ GLK V +  +N+G  SG FCI         N +++  +  +   PF + PS F+L   +T  +E++F PT+  K  + +  +CDNC    F I G      ++++ V      PE  E  D++A+  ++F             +  + SH ++PF W+I +PNL             I  +   D   AF I P  G+ PP +   F +TF+
Sbjct:  156 IFIAKPSVVTFTGYKVGHIYETTLELRNVTSSSRHIRVLPPNSPHFSIGLGRFPSEEGTIAPGMSCKYSLRFIPDSLEDYKDFLVVETQAEQVLLVPIEAQRPPPILTLPKVLDCGYCLVGGLKYVEFLCQNVGQSSGTFCIIPKSQWPFSNLRSLSRTYFSEQPPFAVGPSLFQLEPGDTTVIEVVFSPTTAQKSRQTYTFVCDNCQVKDFSIEG----QLVALQLVSEEKETPEAGEIHDVTAEHYVRFD------------VSSHVSHLDLPFQWQIRQPNLYPLPPGEVPEPSQIHFHPATD--DAFRISPVAGLLPPYQDQEFLLTFS 470          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Medaka
Match: ENSORLT00000016246.2 (pep primary_assembly:ASM223467v1:6:24744336:24775564:-1 gene:ENSORLG00000012964.2 transcript:ENSORLT00000016246.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 3.365e-6
Identity = 78/373 (20.91%), Postives = 147/373 (39.41%), Query Frame = 1
Query:  799 MFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTK-YFSLGLGQFPGEQGL-VAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCW---------------------------KIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGH-HSVF 1827
            +F P P  + F ++   + Y+  +   N   VLR +++   +++ +F +G    P   G  VA G+S  + + F+P    DYE  ++  T+ +  F + +    PR IL          CL+       + ++NIG S               +K  +++ +    PF ++PS   L   E++ + + F P ++G    +  +   + HT        GE  FIS+       S  E+D   +    + LK T +     +  T+ L N S T + +CW                           ++ +    S++    ++    L+         ++   Q G   PN +  F+I F P E K + H+V+
Sbjct:   72 LFQPFPSELVFQNFTPLQTYKLPLILLNNDKVLRHVKLEQQESEDFFVVG----PVNSGSKVAPGMSITFTVGFTPKENKDYEGRLICVTERE-RFEIPVRAIGPRAILDFRDEIFFPICLVKAFTQKTHLLRNIGNS--------------QAKFKLHTQR----PFSVKPSFGTLDVGESLQVTVSFHPLTVGDHREDLLL---HYHT--------GEDVFISLCG-----SCEELDIHLEPEC-VTLKRTYIG--LTNVHTVSLTNSSDTTLQYCWTMWPIQEVEEKNSVLLQEEKEEESKGQRLFECESSSTAAHHYSVQSGALQENGTTINCFYIFVVQKGEIWPNTTAQFSIVFKPEEAKIYQHTVY 402          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Planmine SMEST
Match: SMESG000079694.1 (SMESG000079694.1)

HSP 1 Score: 3307.69 bits (8575), Expect = 0.000e+0
Identity = 1652/1668 (99.04%), Postives = 1661/1668 (99.58%), Query Frame = 1
Query:   22 MMESIEYLQNHSQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEKNKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNLQNNRIESLSRESSFSDLNSSPLITNRKDDKVLSSKKKEYRLPPIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNKDSCSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDIEAGKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRSTDNFISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNIENREIKIGETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASYLFLKLVNPTDSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQKD 5025
            MMESIEYLQNHSQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEA KDDEMTKEKNKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIF NLQNNRIESLSRESSFSDLNSSPLITNRKD+KVLSSKKKEYRLPPIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNKDSCSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQ+KSIDEGLIKQKTLVKTFDDGFLESQNSL TQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQSPSVVLSSSKLDVSGILFVNTPSTFTIELTNQSHLISSFNWQMPIGR+AELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGV+DPICLHI GKVLGPNLNVTIFEKIDSMTNEPKFENGLKTL+FGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSND EAGKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQ+IIPVSITVVGSPLEFTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIIL YDDPFPI+TPLKDSDINLDSDRTVGV VTNSNVSDSTRMVTDRNLDIDNFSSRFQEIISTKRSTDNFISLTIRPHEGIISNEPLTFQPEQLVIPS+SYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNIENREIKIGETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCF+RETITDYIRIVNKSKSASYLFLKLVNPTDSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQKD
Sbjct:    1 MMESIEYLQNHSQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEAFKDDEMTKEKNKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFPNLQNNRIESLSRESSFSDLNSSPLITNRKDEKVLSSKKKEYRLPPIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNKDSCSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQSKSIDEGLIKQKTLVKTFDDGFLESQNSLPTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQSPSVVLSSSKLDVSGILFVNTPSTFTIELTNQSHLISSFNWQMPIGREAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVNDPICLHILGKVLGPNLNVTIFEKIDSMTNEPKFENGLKTLHFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDTEAGKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQIIIPVSITVVGSPLEFTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILIYDDPFPIVTPLKDSDINLDSDRTVGVYVTNSNVSDSTRMVTDRNLDIDNFSSRFQEIISTKRSTDNFISLTIRPHEGIISNEPLTFQPEQLVIPSESYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNIENREIKIGETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFMRETITDYIRIVNKSKSASYLFLKLVNPTDSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQKD 1668          
BLAST of deleted in lung and esophageal cancer protein 1 vs. Planmine SMEST
Match: SMESG000079694.1 (SMESG000079694.1)

HSP 1 Score: 3305.77 bits (8570), Expect = 0.000e+0
Identity = 1651/1667 (99.04%), Postives = 1660/1667 (99.58%), Query Frame = 1
Query:   25 MESIEYLQNHSQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEKNKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNLQNNRIESLSRESSFSDLNSSPLITNRKDDKVLSSKKKEYRLPPIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNKDSCSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQXXXXXXXXXXXXXXGILFVNTPSTFTIELTNQSHLISSFNWQMPIGRDAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIFEKIDSMTNEPKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDIEAGKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVIIPVSITVVGSPLEFTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRXXXXXXXXXXXXXXXRMVTDRNLDIDNFSSRFQEIISTKRSTDNFISLTIRPHEGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNIENREIKIGETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASYLFLKLVNPTDSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQKD 5025
            MESIEYLQNHSQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEA KDDEMTKEKNKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIF NLQNNRIESLSRESSFSDLNSSPLITNRKD+KVLSSKKKEYRLPPIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNKDSCSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQ+KSIDEGLIKQKTLVKTFDDGFLESQNSL TQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQSPSVVLSSSKLDVSGILFVNTPSTFTIELTNQSHLISSFNWQMPIGR+AELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGV+DPICLHI GKVLGPNLNVTIFEKIDSMTNEPKFENGLKTL+FGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSND EAGKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQ+IIPVSITVVGSPLEFTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIIL YDDPFPI+TPLKDSDINLDSDRTVGV VTNSNVSDSTRMVTDRNLDIDNFSSRFQEIISTKRSTDNFISLTIRPHEGIISNEPLTFQPEQLVIPS+SYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNIENREIKIGETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCF+RETITDYIRIVNKSKSASYLFLKLVNPTDSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQKD
Sbjct:    1 MESIEYLQNHSQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQGSSDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEAFKDDEMTKEKNKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFPNLQNNRIESLSRESSFSDLNSSPLITNRKDEKVLSSKKKEYRLPPIEKPATQDQIKKRKSEKKRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQSNKDSCSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPPKTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGDMSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCIADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTSLGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTDISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDTENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHSVFHLVLQGIADLKPDQSKSIDEGLIKQKTLVKTFDDGFLESQNSLPTQNTFKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHLQIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKPGFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVRRSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVIINFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQSPSVVLSSSKLDVSGILFVNTPSTFTIELTNQSHLISSFNWQMPIGREAELISIYFDPDRGIIEPNGKTKVKLTITCQAQTELRDIFLPCSIEGVNDPICLHILGKVLGPNLNVTIFEKIDSMTNEPKFENGLKTLHFGKNIAIFQNTKRFLLIENTTSIVTNFEISIDHFKTSSNDTEAGKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLAVGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQIIIPVSITVVGSPLEFTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCCDIFINWEMYKKDLDSDEKILDIILIYDDPFPIVTPLKDSDINLDSDRTVGVYVTNSNVSDSTRMVTDRNLDIDNFSSRFQEIISTKRSTDNFISLTIRPHEGIISNEPLTFQPEQLVIPSESYGFVIVTFDPHFVKNEKELQFDENEGASFDNYLLGFLSLEDHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDYPDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKFTLKTRSPFEIGNGKNIENREIKIGETIKVPVKFVLDREQILLLKDENLYGHNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQIHFPEFIVSKSQIEFPTCFMRETITDYIRIVNKSKSASYLFLKLVNPTDSVFELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQISIPISARGSYDNKYQKD 1667          
The following BLAST results are available for this feature:
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DLEC10.000e+028.03DLEC1 cilia and flagella associated protein [Sourc... [more]
DLEC10.000e+028.37DLEC1 cilia and flagella associated protein [Sourc... [more]
DLEC18.919e-1148.33DLEC1 cilia and flagella associated protein [Sourc... [more]
CFAP2213.454e-931.15cilia and flagella associated protein 221 [Source:... [more]
CFAP2216.435e-931.15cilia and flagella associated protein 221 [Source:... [more]
back to top
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dlec10.000e+027.64DLEC1 cilia and flagella associated protein [Sourc... [more]
dlec12.554e-14827.33DLEC1 cilia and flagella associated protein [Sourc... [more]
dlec12.151e-4932.32DLEC1 cilia and flagella associated protein [Sourc... [more]
back to top
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
DLEC10.000e+028.46DLEC1, cilia and flagella associated protein [Sour... [more]
ENSXETT00000018114.11.052e-831.58cilia and flagella associated protein 221 [Source:... [more]
back to top
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dlec10.000e+027.72deleted in lung and esophageal cancer 1 [Source:MG... [more]
Dlec10.000e+027.66deleted in lung and esophageal cancer 1 [Source:MG... [more]
Dlec14.883e-7830.66deleted in lung and esophageal cancer 1 [Source:MG... [more]
Cfap2216.052e-929.25cilia and flagella associated protein 221 [Source:... [more]
Hydin1.223e-821.03HYDIN, axonemal central pair apparatus protein [So... [more]
back to top
BLAST of deleted in lung and esophageal cancer protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y238|DLEC1_HUMAN0.000e+028.03Deleted in lung and esophageal cancer protein 1 OS... [more]
sp|Q8BLA1|DLEC1_MOUSE3.111e-7730.66Deleted in lung and esophageal cancer protein 1 ho... [more]
sp|Q80W93|HYDIN_MOUSE8.557e-821.03Hydrocephalus-inducing protein OS=Mus musculus OX=... [more]
sp|Q4G0P3|HYDIN_HUMAN1.675e-721.08Hydrocephalus-inducing protein homolog OS=Homo sap... [more]
sp|Q4G0U5|PCDP1_HUMAN6.784e-731.15Cilia- and flagella-associated protein 221 OS=Homo... [more]
back to top
BLAST of deleted in lung and esophageal cancer protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JXK00.000e+030.77deleted in lung and esophageal cancer protein 1 OS... [more]
A0A267GA630.000e+028.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GI260.000e+028.79Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267G8J10.000e+028.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HYY90.000e+028.43Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
DLEC10.000e+027.08DLEC1 cilia and flagella associated protein [Sourc... [more]
DLEC10.000e+026.85DLEC1 cilia and flagella associated protein [Sourc... [more]
DLEC11.002e-17228.20DLEC1 cilia and flagella associated protein [Sourc... [more]
back to top
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001803.12.734e-630.19pep scaffold:Pmarinus_7.0:GL476330:20174:144478:-1... [more]
back to top
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO457894.444e-10325.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of deleted in lung and esophageal cancer protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DLEC16.334e-10827.58DLEC1 cilia and flagella associated protein [Sourc... [more]
DLEC11.634e-6235.37DLEC1 cilia and flagella associated protein [Sourc... [more]
DLEC11.281e-5835.44DLEC1 cilia and flagella associated protein [Sourc... [more]
ENSORLT00000016246.23.365e-620.91pep primary_assembly:ASM223467v1:6:24744336:247755... [more]
back to top
BLAST of deleted in lung and esophageal cancer protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000079694.10.000e+099.04SMESG000079694.1[more]
SMESG000079694.10.000e+099.04SMESG000079694.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031219 ID=SMED30031219|Name=deleted in lung and esophageal cancer protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5047bp
ATATAAATCTTATATGATAGTATGATGGAATCAATTGAATATTTGCAAAA
TCATTCACAAGCACATTCTCTTGATATTTCTCATATTATTAACAAAAGTT
TTGGAATTTTATTTAGTGCAGATAAAGTTGATCCAGAAATAATCGAAAAT
CTCAAAGTATCTCAAGGAAGTTCAGATCAAAGTCATGTAGAGTATGTGGA
AGAATTAATAAATATAACAACTGAAAGAGAAGGAATTTTCAAGAATTCCA
AATTCCTCCGAGATCATATATTATGGGCAAAAGACGAGGCATTGAAAGAC
GATGAAATGACAAAGGAAAAAAATAAAGACTTTGAATATTTAAATCTGCC
ATCCGAAGAATCAAACTTTTTCAAATACATCGACAACAATTTGCTGAGAA
TGAACGGCTTGATTGCACCGGAAGACATTTTCACAAATTTACAAAATAAT
AGAATTGAATCTCTATCAAGAGAAAGTTCTTTTTCTGATTTAAATTCAAG
TCCATTAATTACAAATCGAAAAGATGATAAGGTTTTATCATCAAAAAAGA
AAGAATACCGCTTACCACCGATTGAAAAACCAGCAACCCAAGATCAAATA
AAAAAACGGAAATCGGAAAAGAAACGAAATCCAACGGACATGATGCTTGC
TTCAGAAAAGTATGACAGCAAGGCAATGCTAGAACTGATGACAGCAAAAA
ATAATTTTTTGAAAAATCCTCGCTATTTAATTCCCGATTGTTCTAATGAA
TCGAAAAATTGGTTGATTCAGTCCAACAAAGATTCCTGCTCTCAGAAAAT
GTTTCTACCAATTCCAGAAGTCGTCGAGTTCTCAGATTATGAAGTCGGAA
AAGTTTATCAAAAACTAATTAATTTTCGGAATCTCACAACTGTTCTTAGA
AGAATTCGCGTTTTACCACCGAAAACGAAATATTTTTCTCTTGGTTTAGG
TCAATTTCCCGGGGAGCAAGGCTTAGTTGCTGCTGGAATTTCATGTCAAT
ATGCAATCAGATTTTCTCCAGATTCCCTAGGAGATTACGAAGATGAAATC
GTTGTAGAAACTCAAGGAGACATGAGTTTCTCCGTGAAGATCATTGGCAA
ACGCCCAAGACCAATTTTAACGGGGTCAACTAATTGGGATATAAATTACT
GTTTGATATATGGCCTCAAAGTGGTTTGCTATAAAATAAAAAACATTGGC
GGTTCAGGAAAATTTTGCATTGCCGACTCGATTTTGCAGTCAATTCCGAA
TTCCAAAGCAGTAATTTACAGTGCTCAAACCGTTCTAGATCCATTCATAA
TCCGGCCGAGCCACTTTGAGTTGCGTACAAATGAAACTATTAATTTAGAA
TTAATATTTTGTCCGACTTCTCTTGGAAAGGTCGAAAGAGAATTCAACAT
AATCTGTGATAACTGTCATACTGACAAATTTAAAATCACTGGATTTGGAG
AAATGGCATTCATTTCTGTAGAAACGGTTGAAGGTGGTATTAGTGTCCCT
GAAATAGATGAAACAACAGACATTTCTGCGCAAATACTTTTAAAATTTAC
TCCTTTAAATCCTTATACTTACTCTCAAAAAACTATAATTTTAAAAAATG
AAAGTCACACAGAAATTCCATTTTGCTGGAAGATTGTCAAGCCAAATTTA
AAATCCTCTTCAGTGGATACAGAAAATATAGATCTAAATATTTTAAAGAA
TAGAACATTGGATTTTGAAAGTGCCTTTGTTATAGAACCACAATTTGGTG
TTTTCCCTCCGAATGAAAGTCTTCCATTTACAATTACATTTGCTCCATTA
GAGGTAAAGGGCCACCACAGTGTTTTTCACTTAGTGCTACAAGGAATCGC
TGATCTGAAGCCTGATCAAACCAAATCTATTGATGAAGGCTTGATAAAGC
AGAAAACTTTGGTAAAAACCTTTGATGATGGATTTCTTGAATCGCAAAAT
TCTCTTCATACACAAAATACTTTTAAAATGGGTGAAATAACATTGAATGA
TGTCACTAGTTTAGAGATTGAAGTAAAAGGAACAAGCATTCCATTAAAAG
TTCGTTTTAATACTCCATCCATTATTGTGCCCGGTGAGCTGTTGATAAAT
ACTCCAGTTAGAAAACATTTGCAGATAATAAATGAGAGTATGTGCCCTGT
GAGCCTCGTGTGGAGTAAACCTGAATCTGAAGATTTTATTTTCGAAGTCG
AACCTAAAATTGGAATGATCGACACTAAAGAGATCGGAGTTGTTGATGTC
TGTATTGTTGCAAATAAACCTGGCTTTTTTAGGGATACTCTACTCTGTCA
TGTGGACACATTAGATGATCCCATTGAACTAATAGTTGAGGCTAACTTTA
AAGGCCCTGATTTGGAGATAGACAGAAACGATTTGGATTTTGGTCTTGTG
AAAGTTAATGAAACAGTAAGAAGATCCCTCAAACTATTAAACAAAAGCTC
AATCAATTGCACATGGAGGAGCAGAGTCGGTGGAACCAATGACACTTCCT
TATTCGAGGAAATGTTCATAAATCCTAAAGGGGGCATTTTAGGACCACTT
CAAAGTCAAAATGTGATTATTAACTTTACTCCTTCCCACCCCAGATTAGT
TAATTGTGGTATTGAGTTCAGTTTGGAGCATGGCTCAACAAAATTTCTCA
ATGTTCTCGCTTGCGCACAGAGTCCAAGTGTGGTCTTAAGCTCCAGTAAA
TTGGATGTCAGTGGAATCTTATTCGTCAACACTCCTTCAACATTCACCAT
TGAATTAACCAATCAAAGTCATTTAATTTCAAGTTTTAATTGGCAAATGC
CTATTGGAAGAGATGCAGAGCTTATTTCGATTTATTTTGATCCTGACCGA
GGAATCATTGAACCGAATGGAAAAACTAAAGTAAAACTCACCATCACCTG
CCAAGCTCAGACTGAATTACGTGACATTTTCTTACCGTGCTCGATTGAAG
GAGTGGACGATCCAATATGTCTTCACATATCAGGAAAGGTTTTAGGTCCG
AATTTGAATGTCACTATCTTTGAGAAAATTGATTCAATGACAAATGAACC
AAAGTTTGAAAATGGTTTGAAAACGTTAAATTTCGGCAAAAACATTGCAA
TTTTTCAAAATACTAAGCGATTTTTGTTAATTGAAAATACAACATCAATC
GTAACAAATTTTGAAATCTCCATAGATCACTTCAAAACCTCTTCTAATGA
CATTGAGGCTGGAAAATTAATCAAACTGCGCCCGAATCTTGCAGACAGGC
AGAGTAAACCTCAAAAATTGGCTGATTTTGATTTTAATAAAAGTATGCTG
AAATTGAAAAATGGCTTAGCAGTCGGTTTCAATCCTTCCTCAGGGACCTT
ACAAAGTTATGATAAAATGATTATTGAAGTATCCGCTTATAATGACATGT
GGGGTGAATACAATGACTTCGTGAGGATCTCTGGTTTCTCCATTAATTCC
TCAATAGAACAAGTTATAATTCCAGTTAGCATTACTGTAGTTGGAAGTCC
ATTAGAATTCACAATGACTGCCGGTAGAAAAGAGCAAAAACCAATCTTGA
GATTGGGAAGCAAAACATTTGGAGAAGAGCCTAACTCCAGAAAAATTAGA
ATTAATAATAAAAGCTGTTGTGATATTTTCATAAACTGGGAAATGTACAA
GAAAGATTTGGACTCAGATGAAAAGATTTTAGACATTATTCTAAGTTATG
ATGATCCTTTTCCGATACTTACGCCACTTAAAGACTCGGATATAAATTTA
GATTCTGATAGAACGGTTGGGGTTAATGTAACTAATAGCAACGTGAGTGA
TAGCACTCGTATGGTAACAGATCGGAATTTGGATATAGACAACTTTTCTA
GCAGATTTCAAGAAATTATATCCACAAAAAGATCAACTGATAATTTCATT
TCTCTAACAATTAGGCCACACGAAGGAATAATTTCAAATGAACCGTTAAC
TTTCCAACCGGAACAATTAGTTATTCCTTCTGATTCCTATGGGTTTGTTA
TTGTGACATTCGACCCGCATTTTGTCAAAAACGAGAAAGAGCTTCAATTT
GATGAAAACGAAGGAGCCAGTTTTGATAATTACCTTCTGGGATTCTTGTC
ATTGGAAGATCATAACCTTATGCTGGACAATCGGATGTTGAGGCAACATC
AGTATGAAGTCGAACAAATCAAACTTGATATTACCGCTCGGATTTTACTA
CCAAATTTACAAGTTGATTATCCTGACTCCGATGAAAGAGATGAAATATC
TTTTTCAGTTCCTTTCAGTAGCCTTTTATTGAAAGCCGAAAATGACTATT
TATTGGCGAAATCAAAATCGTTCACAAGTTACCTCACGTTGCGTAATTTA
AAGGATGCTGAAATGAAGTTTACTCTCAAAACCCGATCACCTTTTGAGAT
AGGTAATGGAAAGAATATTGAAAATAGAGAAATTAAAATCGGTGAAACTA
TCAAAGTACCTGTGAAATTTGTCCTAGATCGAGAACAAATCTTGCTACTT
AAAGATGAAAATCTCTACGGTCACAATGAATCACATTGCTTGAAAATCGA
ACGCCAACTCTTGCCGAATGAGCAACAGAGAACGGCTAAAATGGTTCAGT
TTCGTGATGTGCTAACAGTCAATTACAACAACACAAAACTCGATCAATTA
ATTCAAATCCGAGCTCAAATTCATTTTCCTGAATTCATAGTTTCAAAATC
CCAAATCGAATTTCCGACTTGTTTCATCCGGGAAACAATAACTGATTACA
TCCGAATTGTCAATAAATCGAAATCGGCATCTTATTTGTTTTTGAAATTG
GTTAATCCGACCGATTCGGTTTTTGAGTTGAACAAATTTGCCGGTCTCAT
CCAATTCTCTGAAATGAACTCTGAAGAAAGCGAACTTGAAGTGCAAATAA
TGTTTACGCCCAAACAAGCGATCGATTATAGTGCTTCATTAATCATATCC
GGTATCATGGGAGAAGAACAGATTTCTATTCCCATTTCTGCTAGAGGATC
TTATGATAATAAATATCAAAAAGATTAACTATTTGCTTAACTGTTGA
back to top

protein sequence of SMED30031219-orf-1

>SMED30031219-orf-1 ID=SMED30031219-orf-1|Name=SMED30031219-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1669bp
MMESIEYLQNHSQAHSLDISHIINKSFGILFSADKVDPEIIENLKVSQGS
SDQSHVEYVEELINITTEREGIFKNSKFLRDHILWAKDEALKDDEMTKEK
NKDFEYLNLPSEESNFFKYIDNNLLRMNGLIAPEDIFTNLQNNRIESLSR
ESSFSDLNSSPLITNRKDDKVLSSKKKEYRLPPIEKPATQDQIKKRKSEK
KRNPTDMMLASEKYDSKAMLELMTAKNNFLKNPRYLIPDCSNESKNWLIQ
SNKDSCSQKMFLPIPEVVEFSDYEVGKVYQKLINFRNLTTVLRRIRVLPP
KTKYFSLGLGQFPGEQGLVAAGISCQYAIRFSPDSLGDYEDEIVVETQGD
MSFSVKIIGKRPRPILTGSTNWDINYCLIYGLKVVCYKIKNIGGSGKFCI
ADSILQSIPNSKAVIYSAQTVLDPFIIRPSHFELRTNETINLELIFCPTS
LGKVEREFNIICDNCHTDKFKITGFGEMAFISVETVEGGISVPEIDETTD
ISAQILLKFTPLNPYTYSQKTIILKNESHTEIPFCWKIVKPNLKSSSVDT
ENIDLNILKNRTLDFESAFVIEPQFGVFPPNESLPFTITFAPLEVKGHHS
VFHLVLQGIADLKPDQTKSIDEGLIKQKTLVKTFDDGFLESQNSLHTQNT
FKMGEITLNDVTSLEIEVKGTSIPLKVRFNTPSIIVPGELLINTPVRKHL
QIINESMCPVSLVWSKPESEDFIFEVEPKIGMIDTKEIGVVDVCIVANKP
GFFRDTLLCHVDTLDDPIELIVEANFKGPDLEIDRNDLDFGLVKVNETVR
RSLKLLNKSSINCTWRSRVGGTNDTSLFEEMFINPKGGILGPLQSQNVII
NFTPSHPRLVNCGIEFSLEHGSTKFLNVLACAQSPSVVLSSSKLDVSGIL
FVNTPSTFTIELTNQSHLISSFNWQMPIGRDAELISIYFDPDRGIIEPNG
KTKVKLTITCQAQTELRDIFLPCSIEGVDDPICLHISGKVLGPNLNVTIF
EKIDSMTNEPKFENGLKTLNFGKNIAIFQNTKRFLLIENTTSIVTNFEIS
IDHFKTSSNDIEAGKLIKLRPNLADRQSKPQKLADFDFNKSMLKLKNGLA
VGFNPSSGTLQSYDKMIIEVSAYNDMWGEYNDFVRISGFSINSSIEQVII
PVSITVVGSPLEFTMTAGRKEQKPILRLGSKTFGEEPNSRKIRINNKSCC
DIFINWEMYKKDLDSDEKILDIILSYDDPFPILTPLKDSDINLDSDRTVG
VNVTNSNVSDSTRMVTDRNLDIDNFSSRFQEIISTKRSTDNFISLTIRPH
EGIISNEPLTFQPEQLVIPSDSYGFVIVTFDPHFVKNEKELQFDENEGAS
FDNYLLGFLSLEDHNLMLDNRMLRQHQYEVEQIKLDITARILLPNLQVDY
PDSDERDEISFSVPFSSLLLKAENDYLLAKSKSFTSYLTLRNLKDAEMKF
TLKTRSPFEIGNGKNIENREIKIGETIKVPVKFVLDREQILLLKDENLYG
HNESHCLKIERQLLPNEQQRTAKMVQFRDVLTVNYNNTKLDQLIQIRAQI
HFPEFIVSKSQIEFPTCFIRETITDYIRIVNKSKSASYLFLKLVNPTDSV
FELNKFAGLIQFSEMNSEESELEVQIMFTPKQAIDYSASLIISGIMGEEQ
ISIPISARGSYDNKYQKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR033304DLEC1
IPR019774Aromatic-AA_hydroxylase_C
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0008285negative regulation of cell proliferation
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 259..363
e-value: 1.1E-9
score: 40.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 780..882
e-value: 2.4E-14
score: 55.4
coord: 505..615
e-value: 1.2E-8
score: 37.0
coord: 1549..1662
e-value: 9.0E-7
score: 31.0
coord: 671..779
e-value: 5.5E-11
score: 44.5
coord: 883..995
e-value: 3.6E-13
score: 51.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 176..206
IPR033304Deleted in lung and esophageal cancer protein 1PANTHERPTHR46348FAMILY NOT NAMEDcoord: 11..1667