Oxysterol-binding protein

Overview
NameOxysterol-binding protein
Smed IDSMED30031216
Length (bp)2977
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Oxysterol-binding protein (SMED30031216) t-SNE clustered cells

Violin plots show distribution of expression levels for Oxysterol-binding protein (SMED30031216) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Oxysterol-binding protein (SMED30031216) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Oxysterol-binding protein (SMED30031216) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031216

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031216 dd_Smed_v4_3268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031216 dd_Smed_v4_3268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031216 dd_Smed_v4_3268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031216 dd_Smed_v4_3268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031216 dd_Smed_v4_3268_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBP2 (oxysterol binding protein 2 [Source:HGNC Symbol;Acc:HGNC:8504])

HSP 1 Score: 442.58 bits (1137), Expect = 2.082e-145
Identity = 233/422 (55.21%), Postives = 283/422 (67.06%), Query Frame = 2
Query: 1499 LKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXX---XXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            L  A  VP  S+KV+      RR +I  +PN S+NLW IMKNCIG+ELS+IP+PVNFNEPLSM+QRLTED EY   LD A  C  S+EQ+  VAAF+VSSYSTT +R  KPFNP+LGETFE DR DD+G RSL EQVSHHPP+A+ +  S  GW  WQE T+SSKFRGKY++I+P+G  HL F+ S NHY WRK TSTVHNIIVGKLWID  G+++I NHKT + C L +  YSYFSKE AR+VTGV++D  G   YVL+G+WD   + +KV+H        D   + V++T  A+ LW +   PE    MY F+  AL LNE EE VAPTDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR R +         S+     + + P+WF    D  T     +Y G YWE K    W
Sbjct:   38 LDGASLVPKGSSKVK------RRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQTLSAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDW 453          
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBP2 (oxysterol binding protein 2 [Source:HGNC Symbol;Acc:HGNC:8504])

HSP 1 Score: 448.358 bits (1152), Expect = 7.457e-145
Identity = 234/423 (55.32%), Postives = 283/423 (66.90%), Query Frame = 2
Query: 1499 LKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEE----HKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            L  A  VP  S+KV+      RR +I  +PN S+NLW IMKNCIG+ELS+IP+PVNFNEPLSM+QRLTED EY   LD A  C  S+EQ+  VAAF+VSSYSTT +R  KPFNP+LGETFE DR DD+G RSL EQVSHHPP+A+ +  S  GW  WQE T+SSKFRGKY++I+P+G  HL F+ S NHY WRK TSTVHNIIVGKLWID  G+++I NHKT + C L +  YSYFSKE AR+VTGV++D  G   YVL+G+WD   + +KV+H        D   + V++T  A+ LW +   PE    MY F+  AL LNE EE VAPTDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR R +      S      E+    + P+WF    D  T     +Y G YWE K    W
Sbjct:  236 LDGASLVPKGSSKVK------RRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQTLSAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEAEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDW 652          
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBP2 (oxysterol binding protein 2 [Source:HGNC Symbol;Acc:HGNC:8504])

HSP 1 Score: 444.121 bits (1141), Expect = 9.028e-145
Identity = 233/422 (55.21%), Postives = 283/422 (67.06%), Query Frame = 2
Query: 1499 LKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXX---XXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            L  A  VP  S+KV+      RR +I  +PN S+NLW IMKNCIG+ELS+IP+PVNFNEPLSM+QRLTED EY   LD A  C  S+EQ+  VAAF+VSSYSTT +R  KPFNP+LGETFE DR DD+G RSL EQVSHHPP+A+ +  S  GW  WQE T+SSKFRGKY++I+P+G  HL F+ S NHY WRK TSTVHNIIVGKLWID  G+++I NHKT + C L +  YSYFSKE AR+VTGV++D  G   YVL+G+WD   + +KV+H        D   + V++T  A+ LW +   PE    MY F+  AL LNE EE VAPTDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR R +         S+     + + P+WF    D  T     +Y G YWE K    W
Sbjct:  127 LDGASLVPKGSSKVK------RRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQTLSAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDW 542          
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBP2 (oxysterol binding protein 2 [Source:HGNC Symbol;Acc:HGNC:8504])

HSP 1 Score: 444.506 bits (1142), Expect = 2.420e-144
Identity = 233/422 (55.21%), Postives = 283/422 (67.06%), Query Frame = 2
Query: 1499 LKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXX---XXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            L  A  VP  S+KV+      RR +I  +PN S+NLW IMKNCIG+ELS+IP+PVNFNEPLSM+QRLTED EY   LD A  C  S+EQ+  VAAF+VSSYSTT +R  KPFNP+LGETFE DR DD+G RSL EQVSHHPP+A+ +  S  GW  WQE T+SSKFRGKY++I+P+G  HL F+ S NHY WRK TSTVHNIIVGKLWID  G+++I NHKT + C L +  YSYFSKE AR+VTGV++D  G   YVL+G+WD   + +KV+H        D   + V++T  A+ LW +   PE    MY F+  AL LNE EE VAPTDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR R +         S+     + + P+WF    D  T     +Y G YWE K    W
Sbjct:  166 LDGASLVPKGSSKVK------RRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQTLSAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDW 581          
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBP2 (oxysterol binding protein 2 [Source:HGNC Symbol;Acc:HGNC:8504])

HSP 1 Score: 446.047 bits (1146), Expect = 2.533e-144
Identity = 233/422 (55.21%), Postives = 283/422 (67.06%), Query Frame = 2
Query: 1499 LKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXX---XXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            L  A  VP  S+KV+      RR +I  +PN S+NLW IMKNCIG+ELS+IP+PVNFNEPLSM+QRLTED EY   LD A  C  S+EQ+  VAAF+VSSYSTT +R  KPFNP+LGETFE DR DD+G RSL EQVSHHPP+A+ +  S  GW  WQE T+SSKFRGKY++I+P+G  HL F+ S NHY WRK TSTVHNIIVGKLWID  G+++I NHKT + C L +  YSYFSKE AR+VTGV++D  G   YVL+G+WD   + +KV+H        D   + V++T  A+ LW +   PE    MY F+  AL LNE EE VAPTDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR R +         S+     + + P+WF    D  T     +Y G YWE K    W
Sbjct:  214 LDGASLVPKGSSKVK------RRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQTLSAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDW 629          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 418.313 bits (1074), Expect = 3.229e-134
Identity = 223/400 (55.75%), Postives = 287/400 (71.75%), Query Frame = 2
Query: 1547 KPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKV--LHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            K  R RRT +  RPN+ INLW IMKNCIGKELSKIP+PVNF+EP+S++QR+TED EY++ L+  A+ + +LEQ+ +VAA+  S+YSTT +RT KPFNPLLGETFEFDR DDLGWRS+ EQVSHHPPAA+ H E   GW  +Q+FTM+S+FRGKYL++IP+G  H+ F  + +H+++RK+T+TVHNIIVGKLWIDNHG+M+I NH+T E C L +  YSYFS+E  R+V G++ D +G+ KYV+ GTWD      KV   +   +K   +V ET   + +W+    P+   +M+NFT  A+ELNEPEE VAPTDSRLRPDQRLME G WDEAN++K  +EEKQR  RR RE E E    +G    EE++P WF  V DE      H + G YWE K    W
Sbjct:  225 KGGRQRRTTVPERPNLPINLWSIMKNCIGKELSKIPMPVNFSEPISVLQRVTEDLEYANLLETGAKLS-TLEQMCYVAAYAASNYSTTCHRTNKPFNPLLGETFEFDRMDDLGWRSVTEQVSHHPPAAAHHAEG-NGWTMYQDFTMTSRFRGKYLSVIPIGFTHVVFPATKSHFSYRKITTTVHNIIVGKLWIDNHGDMEITNHETNEKCLLKFVPYSYFSREQPRKVYGIVRDAEGIPKYVVQGTWDKSIDMLKVSSWNGNHEKPKLEVDETS-LKRIWTANPLPKNAEKMHNFTKLAIELNEPEEGVAPTDSRLRPDQRLMENGEWDEANRKKLEIEEKQRVVRRRREAEKELAMKKG-DKYEEYEPTWFVRVQDESNGALIHQFKGGYWEAKEQQNW 620          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 411.379 bits (1056), Expect = 5.538e-134
Identity = 223/400 (55.75%), Postives = 287/400 (71.75%), Query Frame = 2
Query: 1547 KPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKV--LHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            K  R RRT +  RPN+ INLW IMKNCIGKELSKIP+PVNF+EP+S++QR+TED EY++ L+  A+ + +LEQ+ +VAA+  S+YSTT +RT KPFNPLLGETFEFDR DDLGWRS+ EQVSHHPPAA+ H E   GW  +Q+FTM+S+FRGKYL++IP+G  H+ F  + +H+++RK+T+TVHNIIVGKLWIDNHG+M+I NH+T E C L +  YSYFS+E  R+V G++ D +G+ KYV+ GTWD      KV   +   +K   +V ET   + +W+    P+   +M+NFT  A+ELNEPEE VAPTDSRLRPDQRLME G WDEAN++K  +EEKQR  RR RE E E    +G    EE++P WF  V DE      H + G YWE K    W
Sbjct:   47 KGGRQRRTTVPERPNLPINLWSIMKNCIGKELSKIPMPVNFSEPISVLQRVTEDLEYANLLETGAKLS-TLEQMCYVAAYAASNYSTTCHRTNKPFNPLLGETFEFDRMDDLGWRSVTEQVSHHPPAAAHHAEG-NGWTMYQDFTMTSRFRGKYLSVIPIGFTHVVFPATKSHFSYRKITTTVHNIIVGKLWIDNHGDMEITNHETNEKCLLKFVPYSYFSREQPRKVYGIVRDAEGIPKYVVQGTWDKSIDMLKVSSWNGNHEKPKLEVDETS-LKRIWTANPLPKNAEKMHNFTKLAIELNEPEEGVAPTDSRLRPDQRLMENGEWDEANRKKLEIEEKQRVVRRRREAEKELAMKKG-DKYEEYEPTWFVRVQDESNGALIHQFKGGYWEAKEQQNW 442          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 420.239 bits (1079), Expect = 1.426e-133
Identity = 223/400 (55.75%), Postives = 287/400 (71.75%), Query Frame = 2
Query: 1547 KPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKV--LHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            K  R RRT +  RPN+ INLW IMKNCIGKELSKIP+PVNF+EP+S++QR+TED EY++ L+  A+ + +LEQ+ +VAA+  S+YSTT +RT KPFNPLLGETFEFDR DDLGWRS+ EQVSHHPPAA+ H E   GW  +Q+FTM+S+FRGKYL++IP+G  H+ F  + +H+++RK+T+TVHNIIVGKLWIDNHG+M+I NH+T E C L +  YSYFS+E  R+V G++ D +G+ KYV+ GTWD      KV   +   +K   +V ET   + +W+    P+   +M+NFT  A+ELNEPEE VAPTDSRLRPDQRLME G WDEAN++K  +EEKQR  RR RE E E    +G    EE++P WF  V DE      H + G YWE K    W
Sbjct:  330 KGGRQRRTTVPERPNLPINLWSIMKNCIGKELSKIPMPVNFSEPISVLQRVTEDLEYANLLETGAKLS-TLEQMCYVAAYAASNYSTTCHRTNKPFNPLLGETFEFDRMDDLGWRSVTEQVSHHPPAAAHHAEG-NGWTMYQDFTMTSRFRGKYLSVIPIGFTHVVFPATKSHFSYRKITTTVHNIIVGKLWIDNHGDMEITNHETNEKCLLKFVPYSYFSREQPRKVYGIVRDAEGIPKYVVQGTWDKSIDMLKVSSWNGNHEKPKLEVDETS-LKRIWTANPLPKNAEKMHNFTKLAIELNEPEEGVAPTDSRLRPDQRLMENGEWDEANRKKLEIEEKQRVVRRRREAEKELAMKKG-DKYEEYEPTWFVRVQDESNGALIHQFKGGYWEAKEQQNW 725          

HSP 2 Score: 105.145 bits (261), Expect = 7.955e-23
Identity = 48/102 (47.06%), Postives = 70/102 (68.63%), Query Frame = 2
Query:   92 GYLYKWTNYIKGYQKRWFVL-SNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDD 394
            G+L KWTNY+KGY++RWFVL SN  LSYYRN +EV HTCRG+INL  + +    + S ++ +  +QTFH+K Q+E +  QW  +L   +  AI+ +E+  D+
Sbjct:   31 GWLNKWTNYLKGYRQRWFVLDSNATLSYYRNPSEVGHTCRGSINLQEARVHTDKTTSCIVISGQSQTFHVKPQNEMDRQQWTNSLEYMRHKAITRAESEEDE 132          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 419.853 bits (1078), Expect = 4.912e-133
Identity = 223/400 (55.75%), Postives = 287/400 (71.75%), Query Frame = 2
Query: 1547 KPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKV--LHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            K  R RRT +  RPN+ INLW IMKNCIGKELSKIP+PVNF+EP+S++QR+TED EY++ L+  A+ + +LEQ+ +VAA+  S+YSTT +RT KPFNPLLGETFEFDR DDLGWRS+ EQVSHHPPAA+ H E   GW  +Q+FTM+S+FRGKYL++IP+G  H+ F  + +H+++RK+T+TVHNIIVGKLWIDNHG+M+I NH+T E C L +  YSYFS+E  R+V G++ D +G+ KYV+ GTWD      KV   +   +K   +V ET   + +W+    P+   +M+NFT  A+ELNEPEE VAPTDSRLRPDQRLME G WDEAN++K  +EEKQR  RR RE E E    +G    EE++P WF  V DE      H + G YWE K    W
Sbjct:  364 KGGRQRRTTVPERPNLPINLWSIMKNCIGKELSKIPMPVNFSEPISVLQRVTEDLEYANLLETGAKLS-TLEQMCYVAAYAASNYSTTCHRTNKPFNPLLGETFEFDRMDDLGWRSVTEQVSHHPPAAAHHAEG-NGWTMYQDFTMTSRFRGKYLSVIPIGFTHVVFPATKSHFSYRKITTTVHNIIVGKLWIDNHGDMEITNHETNEKCLLKFVPYSYFSREQPRKVYGIVRDAEGIPKYVVQGTWDKSIDMLKVSSWNGNHEKPKLEVDETS-LKRIWTANPLPKNAEKMHNFTKLAIELNEPEEGVAPTDSRLRPDQRLMENGEWDEANRKKLEIEEKQRVVRRRREAEKELAMKKG-DKYEEYEPTWFVRVQDESNGALIHQFKGGYWEAKEQQNW 759          

HSP 2 Score: 105.145 bits (261), Expect = 8.442e-23
Identity = 48/102 (47.06%), Postives = 70/102 (68.63%), Query Frame = 2
Query:   92 GYLYKWTNYIKGYQKRWFVL-SNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDD 394
            G+L KWTNY+KGY++RWFVL SN  LSYYRN +EV HTCRG+INL  + +    + S ++ +  +QTFH+K Q+E +  QW  +L   +  AI+ +E+  D+
Sbjct:   65 GWLNKWTNYLKGYRQRWFVLDSNATLSYYRNPSEVGHTCRGSINLQEARVHTDKTTSCIVISGQSQTFHVKPQNEMDRQQWTNSLEYMRHKAITRAESEEDE 166          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 421.394 bits (1082), Expect = 8.984e-133
Identity = 223/400 (55.75%), Postives = 287/400 (71.75%), Query Frame = 2
Query: 1547 KPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKV--LHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            K  R RRT +  RPN+ INLW IMKNCIGKELSKIP+PVNF+EP+S++QR+TED EY++ L+  A+ + +LEQ+ +VAA+  S+YSTT +RT KPFNPLLGETFEFDR DDLGWRS+ EQVSHHPPAA+ H E   GW  +Q+FTM+S+FRGKYL++IP+G  H+ F  + +H+++RK+T+TVHNIIVGKLWIDNHG+M+I NH+T E C L +  YSYFS+E  R+V G++ D +G+ KYV+ GTWD      KV   +   +K   +V ET   + +W+    P+   +M+NFT  A+ELNEPEE VAPTDSRLRPDQRLME G WDEAN++K  +EEKQR  RR RE E E    +G    EE++P WF  V DE      H + G YWE K    W
Sbjct:  440 KGGRQRRTTVPERPNLPINLWSIMKNCIGKELSKIPMPVNFSEPISVLQRVTEDLEYANLLETGAKLS-TLEQMCYVAAYAASNYSTTCHRTNKPFNPLLGETFEFDRMDDLGWRSVTEQVSHHPPAAAHHAEG-NGWTMYQDFTMTSRFRGKYLSVIPIGFTHVVFPATKSHFSYRKITTTVHNIIVGKLWIDNHGDMEITNHETNEKCLLKFVPYSYFSREQPRKVYGIVRDAEGIPKYVVQGTWDKSIDMLKVSSWNGNHEKPKLEVDETS-LKRIWTANPLPKNAEKMHNFTKLAIELNEPEEGVAPTDSRLRPDQRLMENGEWDEANRKKLEIEEKQRVVRRRREAEKELAMKKG-DKYEEYEPTWFVRVQDESNGALIHQFKGGYWEAKEQQNW 835          

HSP 2 Score: 60.077 bits (144), Expect = 8.290e-9
Identity = 27/73 (36.99%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  176 RNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDD 394
            RN +EV HTCRG+INL  + +    + S ++ +  +QTFH+K Q+E +  QW  +L   +  AI+ +E+  D+
Sbjct:  170 RNPSEVGHTCRGSINLQEARVHTDKTTSCIVISGQSQTFHVKPQNEMDRQQWTNSLEYMRHKAITRAESEEDE 242          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: Osbp (gene:FBgn0020626 transcript:FBtr0084801)

HSP 1 Score: 432.18 bits (1110), Expect = 1.765e-137
Identity = 224/392 (57.14%), Postives = 282/392 (71.94%), Query Frame = 2
Query: 1562 RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKT--GETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKAT 2731
            RR ++  +PN  I+LWGIMKNCIGK+LSKIP+P+NFNEPLSM+QRL ED+EY++ LD AA C D  EQL+++AAFTVS+Y+TTTNRTGKPFNPLLGET+E DR DD GWR LAEQVSHHPP A+LHCES K W CWQEF+M+SKFRGKY+ I P+G  ++ F  S   Y+WRKVT+TV+NIIVGKLW+D HGEM+I   +   G  C LN+  YSYFS++  R V GV+ +KD   K+V+ GTWD   + A VL      ++   + TG  +  W RR  P  + + YNFT  A +LNE EE VAPTDSRLRPDQRLME G WDE+NKEK RLEEKQR +RR RE E E+  ++   P   ++P+WF    +E ++   H++   YWE KA 
Sbjct:  386 RRDRVPDKPNHPISLWGIMKNCIGKDLSKIPMPINFNEPLSMLQRLVEDYEYTEILDYAATCQDECEQLAYIAAFTVSAYATTTNRTGKPFNPLLGETYECDRMDDYGWRCLAEQVSHHPPVAALHCES-KNWTCWQEFSMTSKFRGKYVQINPLGGVYVQFPNSGRRYSWRKVTTTVNNIIVGKLWVDQHGEMEIRGSQAAEGHKCILNFIPYSYFSRDVQRSVKGVVMNKDNEVKWVVRGTWDMKIEIAPVLKTSGSVSS-PTYTTGEFKLAWRRRPAPPDSDKFYNFTTLACQLNEEEEGVAPTDSRLRPDQRLMEQGDWDESNKEKLRLEEKQRTERRRRENEAEEAAAE-GRPYPAYEPMWFKREKEEGSEEYVHVFKNTYWEAKAA 774          

HSP 2 Score: 131.724 bits (330), Expect = 5.644e-31
Identity = 59/93 (63.44%), Postives = 73/93 (78.49%), Query Frame = 2
Query:   89 KGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAI 367
            KG+L KWTNYIKGYQ+RWFVLS G+LSYYRN++E++HTCRGTI+L  ++I   DS + VISN   QTFH+KA +E E   W+TAL LAK  AI
Sbjct:   18 KGWLLKWTNYIKGYQRRWFVLSKGVLSYYRNQSEINHTCRGTISLHGALIHTVDSCTFVISNGGTQTFHIKAGTEVERQSWVTALELAKAKAI 110          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: CG3860 (gene:FBgn0034951 transcript:FBtr0343288)

HSP 1 Score: 199.519 bits (506), Expect = 3.071e-55
Identity = 102/230 (44.35%), Postives = 139/230 (60.43%), Query Frame = 2
Query: 1598 INLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTW 2287
            +++W I+KNCIGK+LSKI +PV  NEPLS +QRL E  EY+  L  AA+     +++ +VAAF VS+ ++   R GKPFNPLLGET+E  + D   +R + EQVSHHPP ++ H ES K +K     +   KF GK + + P G   + F K N  Y+W  V   VHNIIVG+LWI+ +G+M+I NH TG    L +K+    +K    RV G + D      Y L G W
Sbjct:   25 VSIWAILKNCIGKDLSKITMPVMLNEPLSFLQRLCEYMEYAQLLTEAAQQEHPADRMKYVAAFAVSALASNWERLGKPFNPLLGETYELQKGD---YRIVCEQVSHHPPVSAFHAES-KDFKFHGTISPKIKFWGKSVEVNPKGTVTVEFPKWNESYSWTNVNCCVHNIIVGRLWIEQYGKMEITNHATGHVASLTFKSAGSGAKN-LHRVEGFVKDASETNLYFLYGKW 249          

HSP 2 Score: 56.9954 bits (136), Expect = 6.287e-8
Identity = 52/124 (41.94%), Postives = 66/124 (53.23%), Query Frame = 2
Query: 2372 TLWSRRFPPEYTSEMYNFTNFALELN------EPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETK 2725
            TLWS +  P   SE Y FT+FAL+LN      +P   + PTDSRLRPD   +E G  D A+KEK RLEEKQR  R+ R+              ++  P WF    +  TK    +YSG YW+ K
Sbjct:  336 TLWSCKPRPSNCSEYYQFTHFALQLNAMDSNMKPPLTLCPTDSRLRPDILHLEEGNLDGASKEKTRLEEKQRHTRKQRKSTNS----------DDWSPRWFKYATNPHTKIDDWLYSGGYWDRK 449          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: CG3860 (gene:FBgn0034951 transcript:FBtr0072201)

HSP 1 Score: 199.519 bits (506), Expect = 3.137e-55
Identity = 102/230 (44.35%), Postives = 139/230 (60.43%), Query Frame = 2
Query: 1598 INLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTW 2287
            +++W I+KNCIGK+LSKI +PV  NEPLS +QRL E  EY+  L  AA+     +++ +VAAF VS+ ++   R GKPFNPLLGET+E  + D   +R + EQVSHHPP ++ H ES K +K     +   KF GK + + P G   + F K N  Y+W  V   VHNIIVG+LWI+ +G+M+I NH TG    L +K+    +K    RV G + D      Y L G W
Sbjct:   25 VSIWAILKNCIGKDLSKITMPVMLNEPLSFLQRLCEYMEYAQLLTEAAQQEHPADRMKYVAAFAVSALASNWERLGKPFNPLLGETYELQKGD---YRIVCEQVSHHPPVSAFHAES-KDFKFHGTISPKIKFWGKSVEVNPKGTVTVEFPKWNESYSWTNVNCCVHNIIVGRLWIEQYGKMEITNHATGHVASLTFKSAGSGAKN-LHRVEGFVKDASETNLYFLYGKW 249          

HSP 2 Score: 56.9954 bits (136), Expect = 6.099e-8
Identity = 52/124 (41.94%), Postives = 66/124 (53.23%), Query Frame = 2
Query: 2372 TLWSRRFPPEYTSEMYNFTNFALELN------EPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETK 2725
            TLWS +  P   SE Y FT+FAL+LN      +P   + PTDSRLRPD   +E G  D A+KEK RLEEKQR  R+ R+              ++  P WF    +  TK    +YSG YW+ K
Sbjct:  334 TLWSCKPRPSNCSEYYQFTHFALQLNAMDSNMKPPLTLCPTDSRLRPDILHLEEGNLDGASKEKTRLEEKQRHTRKQRKSTNS----------DDWSPRWFKYATNPHTKIDDWLYSGGYWDRK 447          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: CG42668 (gene:FBgn0261550 transcript:FBtr0302666)

HSP 1 Score: 94.3597 bits (233), Expect = 2.050e-19
Identity = 67/236 (28.39%), Postives = 111/236 (47.03%), Query Frame = 2
Query: 1604 LWGIMKNCI-GKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRS--LAEQVSHHPPAASLHCESIK-GWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVL---NGTWD 2290
            +W I+K    G +LSK+ +P    EP S + +L++ + ++D L  A +  D+  ++  V  + +SS+        KP+NP+LGE F        G R+  +AEQVSHHPP ++ +  + + G+         SKF G   + +  G A +T       YT     +    I++G L ++  G+++I    TG    L +K   +     A   T V+  K  + K  L   NG WD
Sbjct:  106 IWCIVKQVRPGMDLSKVVLPTFILEPRSFLDKLSDSYYHADLLSKAVQEDDAFTRMKLVVQWYLSSFYKKPKGLKKPYNPILGERFRCYWQHPSGSRTFYIAEQVSHHPPVSAFYVTNREDGFSITCSILAKSKFYGNSTSAVLEGAATMTLLPRGECYTATTPYAHCKGILMGTLSMELGGKINIECENTGYRTELEFKLKPFLGGADA---TNVVVGKIKLGKETLATINGHWD 338          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: CG42668 (gene:FBgn0261550 transcript:FBtr0306633)

HSP 1 Score: 94.3597 bits (233), Expect = 3.003e-19
Identity = 67/236 (28.39%), Postives = 111/236 (47.03%), Query Frame = 2
Query: 1604 LWGIMKNC-IGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRS--LAEQVSHHPPAASLHCESIK-GWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVL---NGTWD 2290
            +W I+K    G +LSK+ +P    EP S + +L++ + ++D L  A +  D+  ++  V  + +SS+        KP+NP+LGE F        G R+  +AEQVSHHPP ++ +  + + G+         SKF G   + +  G A +T       YT     +    I++G L ++  G+++I    TG    L +K   +     A   T V+  K  + K  L   NG WD
Sbjct:  471 IWCIVKQVRPGMDLSKVVLPTFILEPRSFLDKLSDSYYHADLLSKAVQEDDAFTRMKLVVQWYLSSFYKKPKGLKKPYNPILGERFRCYWQHPSGSRTFYIAEQVSHHPPVSAFYVTNREDGFSITCSILAKSKFYGNSTSAVLEGAATMTLLPRGECYTATTPYAHCKGILMGTLSMELGGKINIECENTGYRTELEFKLKPFLGGADA---TNVVVGKIKLGKETLATINGHWD 703          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: si:ch211-106a19.1 (si:ch211-106a19.1 [Source:ZFIN;Acc:ZDB-GENE-060526-3])

HSP 1 Score: 458.373 bits (1178), Expect = 8.787e-151
Identity = 234/405 (57.78%), Postives = 285/405 (70.37%), Query Frame = 2
Query: 1541 EKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            E +P R RR++I+ +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY + LD AA C +SLEQ+  VAAF+VSSYSTT +RT KPFNPLLGET+E DR ++ G+RSL EQVSHHPPAA+ H  S +GW  WQE T++SKFRGKYL+I+P+G  HL F  S NHY WRKVTSTVHNIIVGKLWID  G++DI NH+T ETC L +  YSYFS+E  R+VTGV+ D DG   Y+L+GTWD   + AK++         +   + V++T   + LW +   PE    MY F++ AL LNE E+ V+ TDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR RE E  +   +     E +KP WF    DE T     +Y G YWE K    W
Sbjct:  111 ELQPRRKRRSRISEKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAARCENSLEQMCLVAAFSVSSYSTTVHRTAKPFNPLLGETYELDRLEEFGYRSLCEQVSHHPPAAAHHVVSQRGWSLWQEITIASKFRGKYLSIMPLGAIHLQFHASGNHYVWRKVTSTVHNIIVGKLWIDQSGDIDIVNHRTKETCQLKFSPYSYFSREVPRKVTGVVMDSDGQANYILSGTWDEKMESAKIVQSSRGSSSSEGKQKTVYQTLSPKLLWKKYPLPENAENMYYFSSLALTLNEEEDGVSITDSRLRPDQRLMEAGRWDEANAEKQRLEEKQRAVRRRREAEASRAIDE--EDFEGYKPQWFHQTTDEMTGENIFVYKGGYWEAKDRQDW 513          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: si:ch211-106a19.1 (si:ch211-106a19.1 [Source:ZFIN;Acc:ZDB-GENE-060526-3])

HSP 1 Score: 459.529 bits (1181), Expect = 4.050e-150
Identity = 234/405 (57.78%), Postives = 285/405 (70.37%), Query Frame = 2
Query: 1541 EKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            E +P R RR++I+ +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY + LD AA C +SLEQ+  VAAF+VSSYSTT +RT KPFNPLLGET+E DR ++ G+RSL EQVSHHPPAA+ H  S +GW  WQE T++SKFRGKYL+I+P+G  HL F  S NHY WRKVTSTVHNIIVGKLWID  G++DI NH+T ETC L +  YSYFS+E  R+VTGV+ D DG   Y+L+GTWD   + AK++         +   + V++T   + LW +   PE    MY F++ AL LNE E+ V+ TDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR RE E  +   +     E +KP WF    DE T     +Y G YWE K    W
Sbjct:  195 ELQPRRKRRSRISEKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAARCENSLEQMCLVAAFSVSSYSTTVHRTAKPFNPLLGETYELDRLEEFGYRSLCEQVSHHPPAAAHHVVSQRGWSLWQEITIASKFRGKYLSIMPLGAIHLQFHASGNHYVWRKVTSTVHNIIVGKLWIDQSGDIDIVNHRTKETCQLKFSPYSYFSREVPRKVTGVVMDSDGQANYILSGTWDEKMESAKIVQSSRGSSSSEGKQKTVYQTLSPKLLWKKYPLPENAENMYYFSSLALTLNEEEDGVSITDSRLRPDQRLMEAGRWDEANAEKQRLEEKQRAVRRRREAEASRAIDE--EDFEGYKPQWFHQTTDEMTGENIFVYKGGYWEAKDRQDW 597          

HSP 2 Score: 55.8398 bits (133), Expect = 2.138e-7
Identity = 34/114 (29.82%), Postives = 60/114 (52.63%), Query Frame = 2
Query:  806 EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQ-SESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVF 1144
            E+   F + + A +N+C +F   A     ++Q++L  EREQR  LE+ +E+LAKQ  +LE+   +  ++S       P+             ++ASD+ +D  ++DA+ED   F
Sbjct:   70 ERATLFRITSNAMINACRDFLELAESHSRRWQRVLQHEREQRTHLEETIEQLAKQHNSLERAWREAPAQSFIFFYERPR------------KEEASDEDEDTEYFDAMEDSPAF 171          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: si:ch211-106a19.1 (si:ch211-106a19.1 [Source:ZFIN;Acc:ZDB-GENE-060526-3])

HSP 1 Score: 462.996 bits (1190), Expect = 7.865e-149
Identity = 235/405 (58.02%), Postives = 287/405 (70.86%), Query Frame = 2
Query: 1541 EKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            E +P R RR++I+ +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY + LD AA C +SLEQ+  VAAF+VSSYSTT +RT KPFNPLLGET+E DR ++ G+RSL EQVSHHPPAA+ H  S +GW  WQE T++SKFRGKYL+I+P+G  HL F  S NHY WRKVTSTVHNIIVGKLWID  G++DI NH+T ETC L +  YSYFS+E  R+VTGV+ D DG   Y+L+GTWD   + AK++         +   + V++T   + LW +   PE    MY F++ AL LNE E+ V+ TDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR RE E  +   +G    E +KP+WF    DE T     +Y G YWE K    W
Sbjct:  398 ELQPRRKRRSRISEKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAARCENSLEQMCLVAAFSVSSYSTTVHRTAKPFNPLLGETYELDRLEEFGYRSLCEQVSHHPPAAAHHVVSQRGWSLWQEITIASKFRGKYLSIMPLGAIHLQFHASGNHYVWRKVTSTVHNIIVGKLWIDQSGDIDIVNHRTKETCQLKFSPYSYFSREVPRKVTGVVMDSDGQANYILSGTWDEKMESAKIVQSSRGSSSSEGKQKTVYQTLSPKLLWKKYPLPENAENMYYFSSLALTLNEEEDGVSITDSRLRPDQRLMEAGRWDEANAEKQRLEEKQRAVRRRREAEASRAIDEG-EDFEGYKPLWFHQTTDEMTGENIFVYKGGYWEAKDRQDW 801          

HSP 2 Score: 138.658 bits (348), Expect = 4.828e-33
Identity = 76/169 (44.97%), Postives = 100/169 (59.17%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDISLYYKEFEQRLFDLNTSVSLVKK 586
            D +KG+L+KWTNYIKGYQ+RWFVLSNGLLSYYR + E++HTCRGTINL+T+ I  +D+ +IV+S+   +T+HLKA +E E  +W+TAL LAK  AI +     DDS  E P                             SD S+I    K    +L DL+T   L+ K
Sbjct:   71 DTYKGWLFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMAHTCRGTINLATAHIDTEDACNIVLSS-GGRTYHLKASTEVERQRWVTALELAKAKAIRMMNDQSDDSADEEPTS--------------------------QSDHSEIQGTLKTLASKLDDLSTCNELIAK 212          

HSP 3 Score: 62.003 bits (149), Expect = 3.143e-9
Identity = 38/113 (33.63%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  806 EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVF 1144
            E+   F + + A +N+C +F   A     ++Q++L  EREQR  LE+ +E+LAKQ  +LE +A +++ +  +NT     +D   + R +  + + +D D EYF DA+ED   F
Sbjct:  242 ERATLFRITSNAMINACRDFLELAESHSRRWQRVLQHEREQRTHLEETIEQLAKQHNSLE-RAWREAPAHAVNTPDTPTTDTGVSERPRKEEASDEDEDTEYF-DAMEDSPAF 352          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: si:ch211-106a19.1 (si:ch211-106a19.1 [Source:ZFIN;Acc:ZDB-GENE-060526-3])

HSP 1 Score: 449.129 bits (1154), Expect = 1.572e-148
Identity = 231/398 (58.04%), Postives = 281/398 (70.60%), Query Frame = 2
Query: 1562 RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            RR++I+ +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY + LD AA C +SLEQ+  VAAF+VSSYSTT +RT KPFNPLLGET+E DR ++ G+RSL EQVSHHPPAA+ H  S +GW  WQE T++SKFRGKYL+I+P+G  HL F  S NHY WRKVTSTVHNIIVGKLWID  G++DI NH+T ETC L +  YSYFS+E  R+VTGV+ D DG   Y+L+GTWD   + AK++         +   + V++T   + LW +   PE    MY F++ AL LNE E+ V+ TDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR RE E  +   +     E +KP WF    DE T     +Y G YWE K    W
Sbjct:   33 RRSRISEKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAARCENSLEQMCLVAAFSVSSYSTTVHRTAKPFNPLLGETYELDRLEEFGYRSLCEQVSHHPPAAAHHVVSQRGWSLWQEITIASKFRGKYLSIMPLGAIHLQFHASGNHYVWRKVTSTVHNIIVGKLWIDQSGDIDIVNHRTKETCQLKFSPYSYFSREVPRKVTGVVMDSDGQANYILSGTWDEKMESAKIVQSSRGSSSSEGKQKTVYQTLSPKLLWKKYPLPENAENMYYFSSLALTLNEEEDGVSITDSRLRPDQRLMEAGRWDEANAEKQRLEEKQRAVRRRREAEASRAIDE--EDFEGYKPQWFHQTTDEMTGENIFVYKGGYWEAKDRQDW 428          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: osbp (oxysterol binding protein [Source:ZFIN;Acc:ZDB-GENE-090312-18])

HSP 1 Score: 454.907 bits (1169), Expect = 3.123e-146
Identity = 254/444 (57.21%), Postives = 307/444 (69.14%), Query Frame = 2
Query: 1466 NVSG--------DVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRK------DKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIE-----EHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            NVSG        D +T  + ++  S P      E  P R RRT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRL+ED EY + LD  A+C  SLEQ+ +VAAFTVSSYSTT +RTGKPFNPLLGETFE DR  + G+RSL EQVSHHPPAA+ H  S +GW   QE  ++SKFRGKYL+I+P+G  H  FEKSNNHYTW+KVT+TVHNIIVGKLWID  GE+DI NH+TG+ CHL +  YSYFS++ AR+VTGV+TDKDG   YVL+GTWD   + ++V+   +      D   + V++T  A+ LW +   PE    MY F+  AL LNEPEE VAPTDSR RPDQRLME G W+EAN EK+RLEEKQR  RR RE+E  +  +    P E      +K +WF    D  T   THIY G YWETK  G W
Sbjct:  314 NVSGISSEMGMDDGTTSLDEQSMASNPESPQSQEVVPVRKRRTRIPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLSEDLEYYELLDRGAKCQSSLEQMCYVAAFTVSSYSTTVHRTGKPFNPLLGETFELDRLQESGYRSLCEQVSHHPPAAAHHAISERGWTLRQEIALASKFRGKYLSIMPLGSIHCIFEKSNNHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHRTGDRCHLKFAPYSYFSRDVARKVTGVVTDKDGKAHYVLSGTWDEKMECSRVMQSSRGGENGADGRQKTVYQTLKAKELWRKTPLPEGAENMYYFSTLALTLNEPEEGVAPTDSRKRPDQRLMEQGRWEEANAEKQRLEEKQRTARREREREANRSAN----PEEGGHQDSYKAMWFDRCVDPMTGEPTHIYRGGYWETKEQGNW 753          

HSP 2 Score: 144.05 bits (362), Expect = 8.553e-35
Identity = 67/120 (55.83%), Postives = 83/120 (69.17%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNS 439
            D +KG+L+KWTNYIKGYQ+RWFVLSNGLLSYYR + E+ HTCRGTINL+T+ I  +DS + VISN   QT+HLKA SE E  +W+TAL LAK  A  +     D  D   P  +   G +
Sbjct:   13 DTYKGWLFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMGHTCRGTINLATANIAVEDSCNFVISNGGTQTYHLKASSEVERQRWITALELAKAKAFRMQAESDDSGDESTPPAAGQGGGA 132          

HSP 3 Score: 63.5438 bits (153), Expect = 1.015e-9
Identity = 42/129 (32.56%), Postives = 70/129 (54.26%), Query Frame = 2
Query:  773 GPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLP 1159
            G   + + +  E+   F + + A +N+C +F   A     ++QK L  EREQR+RLE+ +E+LAKQ   LE +A + +  +  + S P  + D K   V     ASD+ ++  F+DA ED   F +++P
Sbjct:  179 GETSEKIRQVTERATLFRITSNAMINACRDFLALAQAHSKRWQKALQAEREQRVRLEETLEQLAKQHNHLE-RAFRGATVLPPSQSNP--AIDSKG-SVPGKGDASDEDEENEFFDACEDVQEF-ITVP 302          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: ccdc6 (coiled-coil domain containing 6 [Source:Xenbase;Acc:XB-GENE-978266])

HSP 1 Score: 450.669 bits (1158), Expect = 2.596e-144
Identity = 235/409 (57.46%), Postives = 289/409 (70.66%), Query Frame = 2
Query: 1529 STKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIR-----KDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            S + E  P + RRT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY + LD A +C  S+EQ+ ++AAF+VSSYSTT +RT KPFNPLLGETFE DR DDLG+RS+ EQVSHHPPAA+ +  S  GWK WQE T++SKFRGKYL+I+P+G  HL F  S NHY WRKVTSTVHNIIVGKLWID  G+++I N+KT + C L +  YSYFS++ AR+VTGV+TD +G   YVL+GTWD   + AK++         +   + V++T P + LW +   PE    MY F+ FAL LNE +E+VAPTDSR RPDQRLME G WDEAN EK+RLEEKQR  RR RE E  +   +G    E ++P+WF    D  T      Y G YWE K    W
Sbjct:  363 SKRKELIPKKRRRTRIPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAVKCESSIEQMCFIAAFSVSSYSTTVHRTAKPFNPLLGETFELDRLDDLGFRSICEQVSHHPPAAAHYVHSKNGWKLWQEITIASKFRGKYLSIMPLGDIHLEFHSSGNHYVWRKVTSTVHNIIVGKLWIDQSGDIEIINYKTKDKCQLKFSPYSYFSRDIARKVTGVVTDANGKAHYVLSGTWDEKMECAKIVQSSHGNSCAEGKQKTVYQTLPPKLLWKKYPLPENAENMYFFSEFALTLNESDESVAPTDSRNRPDQRLMENGKWDEANVEKQRLEEKQRAVRRRREAEAVEALEEG-NDYEGYQPLWFERKVDPYTGELICNYKGGYWECKERQDW 770          

HSP 2 Score: 131.339 bits (329), Expect = 1.368e-30
Identity = 66/111 (59.46%), Postives = 85/111 (76.58%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAP 412
            D +KG+L+KWTNY+KGYQ+RWFVLSNGLLSYYR + E++HTCRGTINLST+ I  +DS +IV++N   +T+HLKA  E E  +W+TAL LAK  A  L+E   +DS  E P
Sbjct:   69 DTYKGWLFKWTNYLKGYQRRWFVLSNGLLSYYRTQAEMAHTCRGTINLSTAHIDTEDSCNIVLTN-GGRTYHLKASCEVERQRWVTALELAK--AKLLAE---NDSGDEEP 173          

HSP 3 Score: 62.003 bits (149), Expect = 4.630e-9
Identity = 36/113 (31.86%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  806 EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVF 1144
            E+   F + + A +N+C +F + A     K+ + L  EREQR+RLE+ +E+LAKQ  +LE +A + +  +  NT+   ++       +K   +ASD+ ++  ++DA+ED   F
Sbjct:  235 ERATLFRITSNAMINACRDFLDLAETHSRKWHRALQYEREQRVRLEETIEQLAKQHNSLE-RACRGAPGLTSNTTGVLNTPKGNVPAIKG--EASDEDEETEYFDAMEDAPAF 344          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: ccdc6 (coiled-coil domain containing 6 [Source:Xenbase;Acc:XB-GENE-978266])

HSP 1 Score: 447.203 bits (1149), Expect = 3.269e-143
Identity = 235/436 (53.90%), Postives = 296/436 (67.89%), Query Frame = 2
Query: 1457 DLYNVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIR-----KDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXX---XXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            D +++  +VS F+     +S      + E  P + RRT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY + LD A +C  S+EQ+ ++AAF+VSSYSTT +RT KPFNPLLGETFE DR DDLG+RS+ EQVSHHPPAA+ +  S  GWK WQE T++SKFRGKYL+I+P+G  HL F  S NHY WRKVTSTVHNIIVGKLWID  G+++I N+KT + C L +  YSYFS++ AR+VTGV+TD +G   YVL+GTWD   + AK++         +   + V++T P + LW +   PE    MY F+ FAL LNE +E+VAPTDSR RPDQRLME G WDEAN EK+RLEEKQ   R +R     E  +  +Q       ++P+WF    D  T      Y G YWE K    W
Sbjct:  324 DDWHLEDNVSIFAVCNNHES-----KRKELIPKKRRRTRIPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAVKCESSIEQMCFIAAFSVSSYSTTVHRTAKPFNPLLGETFELDRLDDLGFRSICEQVSHHPPAAAHYVHSKNGWKLWQEITIASKFRGKYLSIMPLGDIHLEFHSSGNHYVWRKVTSTVHNIIVGKLWIDQSGDIEIINYKTKDKCQLKFSPYSYFSRDIARKVTGVVTDANGKAHYVLSGTWDEKMECAKIVQSSHGNSCAEGKQKTVYQTLPPKLLWKKYPLPENAENMYFFSEFALTLNESDESVAPTDSRNRPDQRLMENGKWDEANVEKQRLEEKQRAVRRRREAEAVEALEEVNQRSESPNRYQPLWFERKVDPYTGELICNYKGGYWECKERQDW 754          

HSP 2 Score: 139.428 bits (350), Expect = 3.654e-33
Identity = 66/111 (59.46%), Postives = 84/111 (75.68%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAP 412
            D +KG+L+KWTNY+KGYQ+RWFVLSNGLLSYYR + E++HTCRGTINLST+ I  +DS +IV++N   +T+HLKA  E E  +W+TAL LAK  AI +     DDS  E P
Sbjct:   18 DTYKGWLFKWTNYLKGYQRRWFVLSNGLLSYYRTQAEMAHTCRGTINLSTAHIDTEDSCNIVLTN-GGRTYHLKASCEVERQRWVTALELAKAKAIRMMNNQSDDSGDEEP 127          

HSP 3 Score: 61.6178 bits (148), Expect = 5.922e-9
Identity = 36/113 (31.86%), Postives = 65/113 (57.52%), Query Frame = 2
Query:  806 EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVF 1144
            E+   F + + A +N+C +F + A     K+ + L  EREQR+RLE+ +E+LAKQ  +LE +A + +  +  NT+   ++       +K   +ASD+ ++  ++DA+ED   F
Sbjct:  189 ERATLFRITSNAMINACRDFLDLAETHSRKWHRALQYEREQRVRLEETIEQLAKQHNSLE-RACRGAPGLTSNTTGVLNTPKGNVPAIKG--EASDEDEETEYFDAMEDAPAF 298          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: OSBP (oxysterol binding protein [Source:NCBI gene;Acc:100488223])

HSP 1 Score: 419.083 bits (1076), Expect = 1.154e-132
Identity = 229/395 (57.97%), Postives = 269/395 (68.10%), Query Frame = 2
Query: 1562 RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT 2746
            RRT+I  +PN S+NLW +MKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY   LD  A+C  +LEQL  VAAFTVSSYSTT  RT KPFNPLLGETFE DR ++ G+RSL EQVSHHPPAA+ H ES  GW   QE T++SKFRGKYL+I+P+G  H  F  S NHYTW+KVT+TVHNIIVGKLWID   E+DI NHKTG+ C L +  YSYFS++ AR+V+G + D  G   Y L GTWD   +   V  +     N           LW R   P+    MY FT FAL LN PEE  AP+DSR RPDQRLME G WDEAN EK+RLEEKQR  R+ RE E E+    G  P++ +KP+WF    D  +K  THI  G YWE K    W +
Sbjct:  342 RRTRIPYKPNYSLNLWSVMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHTLLDRGAQCESALEQLCLVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRMEESGYRSLCEQVSHHPPAAAHHAESRHGWTLRQEITVTSKFRGKYLSIMPLGTIHCVFHNSGNHYTWKKVTTTVHNIIVGKLWIDQEREIDIVNHKTGDRCKLKFAPYSYFSRDVARKVSGEVMDATGRVHYTLMGTWDERMECIPVYSVSTVSENGGDKAADNKILLWKRNPLPKNAEYMYYFTEFALTLNAPEEGTAPSDSRHRPDQRLMENGNWDEANSEKQRLEEKQRNTRKKREAERERAGEDG-SPVDTYKPMWFERKMDPVSKEMTHICRGIYWECKERQDWAS 735          

HSP 2 Score: 80.4925 bits (197), Expect = 8.129e-15
Identity = 42/78 (53.85%), Postives = 54/78 (69.23%), Query Frame = 2
Query:  179 NKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAP 412
            +K E+ HTCRGTINL+T+ I  +DS + VISN   QT+HLKA SE E  +W+TAL LAK  A+ + +A  DDS  E P
Sbjct:   66 SKAEMRHTCRGTINLATANISVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKARAVKM-QAESDDSGDEDP 142          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: OSBP (oxysterol binding protein [Source:NCBI gene;Acc:100488223])

HSP 1 Score: 416.772 bits (1070), Expect = 1.790e-132
Identity = 229/395 (57.97%), Postives = 269/395 (68.10%), Query Frame = 2
Query: 1562 RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT 2746
            RRT+I  +PN S+NLW +MKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY   LD  A+C  +LEQL  VAAFTVSSYSTT  RT KPFNPLLGETFE DR ++ G+RSL EQVSHHPPAA+ H ES  GW   QE T++SKFRGKYL+I+P+G  H  F  S NHYTW+KVT+TVHNIIVGKLWID   E+DI NHKTG+ C L +  YSYFS++ AR+V+G + D  G   Y L GTWD   +   V  +     N           LW R   P+    MY FT FAL LN PEE  AP+DSR RPDQRLME G WDEAN EK+RLEEKQR  R+ RE E E+    G  P++ +KP+WF    D  +K  THI  G YWE K    W +
Sbjct:  293 RRTRIPYKPNYSLNLWSVMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHTLLDRGAQCESALEQLCLVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRMEESGYRSLCEQVSHHPPAAAHHAESRHGWTLRQEITVTSKFRGKYLSIMPLGTIHCVFHNSGNHYTWKKVTTTVHNIIVGKLWIDQEREIDIVNHKTGDRCKLKFAPYSYFSRDVARKVSGEVMDATGRVHYTLMGTWDERMECIPVYSVSTVSENGGDKAADNKILLWKRNPLPKNAEYMYYFTEFALTLNAPEEGTAPSDSRHRPDQRLMENGNWDEANSEKQRLEEKQRNTRKKREAERERAGEDG-SPVDTYKPMWFERKMDPVSKEMTHICRGIYWECKERQDWAS 686          

HSP 2 Score: 82.8037 bits (203), Expect = 1.729e-15
Identity = 47/89 (52.81%), Postives = 59/89 (66.29%), Query Frame = 2
Query:  146 VLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAP 412
            VLSN      R+K E+ HTCRGTINL+T+ I  +DS + VISN   QT+HLKA SE E  +W+TAL LAK  A+ + +A  DDS  E P
Sbjct:    3 VLSN----CKRSKAEMRHTCRGTINLATANISVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKARAVKM-QAESDDSGDEDP 86          

HSP 3 Score: 51.2174 bits (121), Expect = 9.048e-6
Identity = 28/80 (35.00%), Postives = 46/80 (57.50%), Query Frame = 2
Query:  749 RAPSHSSIGPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEK 988
            R P  SS     + + +  E+   F + + A +N+C +F + A     ++Q+ L  ER+QRLRLE+ +E+LAKQ   LE+
Sbjct:  134 RLPQESS-----EKIKQVNERATLFRITSNAMINACRDFMSLAESHSKRWQRALQYERDQRLRLEETLEQLAKQHNHLER 208          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: OSBP (oxysterol binding protein [Source:NCBI gene;Acc:100488223])

HSP 1 Score: 417.157 bits (1071), Expect = 5.497e-132
Identity = 229/395 (57.97%), Postives = 269/395 (68.10%), Query Frame = 2
Query: 1562 RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT 2746
            RRT+I  +PN S+NLW +MKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY   LD  A+C  +LEQL  VAAFTVSSYSTT  RT KPFNPLLGETFE DR ++ G+RSL EQVSHHPPAA+ H ES  GW   QE T++SKFRGKYL+I+P+G  H  F  S NHYTW+KVT+TVHNIIVGKLWID   E+DI NHKTG+ C L +  YSYFS++ AR+V+G + D  G   Y L GTWD   +   V  +     N           LW R   P+    MY FT FAL LN PEE  AP+DSR RPDQRLME G WDEAN EK+RLEEKQR  R+ RE E E+    G  P++ +KP+WF    D  +K  THI  G YWE K    W +
Sbjct:  339 RRTRIPYKPNYSLNLWSVMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHTLLDRGAQCESALEQLCLVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRMEESGYRSLCEQVSHHPPAAAHHAESRHGWTLRQEITVTSKFRGKYLSIMPLGTIHCVFHNSGNHYTWKKVTTTVHNIIVGKLWIDQEREIDIVNHKTGDRCKLKFAPYSYFSRDVARKVSGEVMDATGRVHYTLMGTWDERMECIPVYSVSTVSENGGDKAADNKILLWKRNPLPKNAEYMYYFTEFALTLNAPEEGTAPSDSRHRPDQRLMENGNWDEANSEKQRLEEKQRNTRKKREAERERAGEDG-SPVDTYKPMWFERKMDPVSKEMTHICRGIYWECKERQDWAS 732          

HSP 2 Score: 82.0333 bits (201), Expect = 2.797e-15
Identity = 44/101 (43.56%), Postives = 61/101 (60.40%), Query Frame = 2
Query:  110 TNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAP 412
            + +++G  +    L  G     R +  + HTCRGTINL+T+ I  +DS + VISN   QT+HLKA SE E  +W+TAL LAK  A+ + +A  DDS  E P
Sbjct:   32 STFLRGGSEFLAFLREGGAGESREQKAMRHTCRGTINLATANISVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKARAVKM-QAESDDSGDEDP 131          

HSP 3 Score: 51.6026 bits (122), Expect = 6.941e-6
Identity = 28/80 (35.00%), Postives = 46/80 (57.50%), Query Frame = 2
Query:  749 RAPSHSSIGPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEK 988
            R P  SS     + + +  E+   F + + A +N+C +F + A     ++Q+ L  ER+QRLRLE+ +E+LAKQ   LE+
Sbjct:  179 RLPQESS-----EKIKQVNERATLFRITSNAMINACRDFMSLAESHSKRWQRALQYERDQRLRLEETLEQLAKQHNHLER 253          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbp2 (oxysterol binding protein 2 [Source:MGI Symbol;Acc:MGI:1921559])

HSP 1 Score: 441.039 bits (1133), Expect = 4.214e-145
Identity = 225/432 (52.08%), Postives = 289/432 (66.90%), Query Frame = 2
Query: 1472 SGDVSTFSELKTAQSVPSLSTKVEKKPARV-RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQ--VFETGPAETLWSRRFP-PEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEE-----HKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            SG  +T  +  +A +V   ++ + K   +V RR +I  +PN S+NLW IMKNCIG+ELS+IP+PVNFNEPLSM+QRLTED EY   LD A  C  S+EQ+  VAAF+VSSYSTT +R  KPFNP+LGETFE DR +D+G RSL EQVSHHPP+A+ H  S  GW  WQE T++SKFRGKY++I+P+G  HL F+ S NHY WRK TSTVHNIIVGKLWID  G+++I NHKT + C L +  YSYFSKE AR+VTGV++D  G   YVL+G+WD   + +K++H     + +Q  V++T PA+ LW R++P PE    MY F+  AL LNE E+ VAPTDSRLRPDQRLME G WDEA       +++  EK+R   +   +  + G    EE     + P+WF    D  T     +Y G YWE K    W
Sbjct:   22 SGPGTTTVDWTSADNVLDGASFMPKNSCKVKRRVRIPDKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVNCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRMEDMGLRSLCEQVSHHPPSAAHHVFSKHGWSLWQEITIASKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTKDRCQLKFVPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDDQMECSKIVHSSPSSDGRQKTVYQTLPAKLLW-RKYPLPENAENMYYFSELALTLNEQEDGVAPTDSRLRPDQRLMERGRWDEA----NTEKQRLEEKQRLSRRRRLESCTAGCGGEEEKESDGYVPLWFEKRLDPLTGEMACMYKGGYWEAKEKKDW 448          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbp2 (oxysterol binding protein 2 [Source:MGI Symbol;Acc:MGI:1921559])

HSP 1 Score: 440.269 bits (1131), Expect = 3.607e-144
Identity = 225/432 (52.08%), Postives = 289/432 (66.90%), Query Frame = 2
Query: 1472 SGDVSTFSELKTAQSVPSLSTKVEKKPARV-RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQ--VFETGPAETLWSRRFP-PEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEE-----HKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            SG  +T  +  +A +V   ++ + K   +V RR +I  +PN S+NLW IMKNCIG+ELS+IP+PVNFNEPLSM+QRLTED EY   LD A  C  S+EQ+  VAAF+VSSYSTT +R  KPFNP+LGETFE DR +D+G RSL EQVSHHPP+A+ H  S  GW  WQE T++SKFRGKY++I+P+G  HL F+ S NHY WRK TSTVHNIIVGKLWID  G+++I NHKT + C L +  YSYFSKE AR+VTGV++D  G   YVL+G+WD   + +K++H     + +Q  V++T PA+ LW R++P PE    MY F+  AL LNE E+ VAPTDSRLRPDQRLME G WDEA       +++  EK+R   +   +  + G    EE     + P+WF    D  T     +Y G YWE K    W
Sbjct:   64 SGPGTTTVDWTSADNVLDGASFMPKNSCKVKRRVRIPDKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVNCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRMEDMGLRSLCEQVSHHPPSAAHHVFSKHGWSLWQEITIASKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTKDRCQLKFVPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDDQMECSKIVHSSPSSDGRQKTVYQTLPAKLLW-RKYPLPENAENMYYFSELALTLNEQEDGVAPTDSRLRPDQRLMERGRWDEA----NTEKQRLEEKQRLSRRRRLESCTAGCGGEEEKESDGYVPLWFEKRLDPLTGEMACMYKGGYWEAKEKKDW 490          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbp2 (oxysterol binding protein 2 [Source:MGI Symbol;Acc:MGI:1921559])

HSP 1 Score: 445.277 bits (1144), Expect = 8.875e-141
Identity = 225/432 (52.08%), Postives = 289/432 (66.90%), Query Frame = 2
Query: 1472 SGDVSTFSELKTAQSVPSLSTKVEKKPARV-RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQ--VFETGPAETLWSRRFP-PEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHK-----PVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            SG  +T  +  +A +V   ++ + K   +V RR +I  +PN S+NLW IMKNCIG+ELS+IP+PVNFNEPLSM+QRLTED EY   LD A  C  S+EQ+  VAAF+VSSYSTT +R  KPFNP+LGETFE DR +D+G RSL EQVSHHPP+A+ H  S  GW  WQE T++SKFRGKY++I+P+G  HL F+ S NHY WRK TSTVHNIIVGKLWID  G+++I NHKT + C L +  YSYFSKE AR+VTGV++D  G   YVL+G+WD   + +K++H     + +Q  V++T PA+ LW R++P PE    MY F+  AL LNE E+ VAPTDSRLRPDQRLME G WDEA       +++  EK+R   +   +  + G    EE +     P+WF    D  T     +Y G YWE K    W
Sbjct:  475 SGPGTTTVDWTSADNVLDGASFMPKNSCKVKRRVRIPDKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVNCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRMEDMGLRSLCEQVSHHPPSAAHHVFSKHGWSLWQEITIASKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTKDRCQLKFVPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDDQMECSKIVHSSPSSDGRQKTVYQTLPAKLLW-RKYPLPENAENMYYFSELALTLNEQEDGVAPTDSRLRPDQRLMERGRWDEA----NTEKQRLEEKQRLSRRRRLESCTAGCGGEEEKESDGYVPLWFEKRLDPLTGEMACMYKGGYWEAKEKKDW 901          

HSP 2 Score: 126.716 bits (317), Expect = 4.359e-29
Identity = 56/98 (57.14%), Postives = 75/98 (76.53%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISL 373
            D +KG+L KWTNY+KGYQ+RWFVL NGLLSYYRN+ E++HTCR TINL+++    +DS  I++ N + +T+HLKA SE +   W+TAL LAK  AI +
Sbjct:  180 DSYKGWLLKWTNYLKGYQRRWFVLGNGLLSYYRNQGEMAHTCRATINLASTHFETEDSCGILLCNGA-RTYHLKASSEVDRQHWITALELAKAKAIRV 276          

HSP 3 Score: 53.9138 bits (128), Expect = 1.027e-6
Identity = 36/113 (31.86%), Postives = 57/113 (50.44%), Query Frame = 2
Query:  806 EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVF 1144
            E+   F + + A +N+C +F   A     K+Q+ LN E+EQR+ LE+ +E+LAKQ  +LE+             +    S  E +      + + +D D EYF DA+ED   F
Sbjct:  353 ERATLFRITSNAMINACRDFLELAETHSRKWQRALNYEQEQRVHLEETIEQLAKQHNSLERAFCNTPG----GPASSSKSFSEGSFLTSKGENSEEDEDTEYF-DAMEDSTSF 460          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbp (oxysterol binding protein [Source:MGI Symbol;Acc:MGI:97447])

HSP 1 Score: 414.075 bits (1063), Expect = 4.095e-130
Identity = 230/399 (57.64%), Postives = 274/399 (68.67%), Query Frame = 2
Query: 1562 RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAE----TLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT 2746
            +RT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY + LD AA+C +SLEQL +VAAFTVSSYSTT  RT KPFNPLLGETFE DR ++ G+RS+ EQVSHHPPAA+ H ES  GW   QE  ++SKFRGKYL+I+P+G  H  F  + +HYTW+KVT+TVHNIIVGKLWID  GE+DI NHKTG+ C+L +  YSYFS++ AR+VTG +TD  G   + L GTWD      KV     +           AE     LW R   P+    MY F+  AL LN  E   APTDSRLRPDQRLME G WDEAN EK+RLEEKQR  R+ RE E  +    G P  + +K +WF    D  T+  THIYSG YWE K    WG+
Sbjct:  403 KRTRIPYKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRLEENGYRSICEQVSHHPPAAAHHAESKNGWTLRQEIKITSKFRGKYLSIMPLGTIHCIFHSTGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMDCFKVQAASGENGGDARQRGHEAEDSRVMLWKRNPLPKNAENMYYFSELALTLNAWEGGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKKREAEAAKATEDGTPH-DPYKALWFERKKDPVTRELTHIYSGEYWECKEKQDWGS 800          

HSP 2 Score: 138.658 bits (348), Expect = 4.810e-33
Identity = 64/107 (59.81%), Postives = 81/107 (75.70%), Query Frame = 2
Query:   89 KGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEA 409
            +G+L+KWTNYIKGYQ+RWFVLSNGLLSYYR+K E+ HTCRGTINL+T+ I  +DS + +ISN   QT+HLKA SE E  +W+TAL LAK  A+ +     D  D E+
Sbjct:   90 EGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVKMLAESDDSGDEES 196          

HSP 3 Score: 55.4546 bits (132), Expect = 3.319e-7
Identity = 36/113 (31.86%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  791 MHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIE 1129
            + +  E+   F + + A +N+C +F   A     K+QK L  ER+QR+RLE+ +E+LAKQ   LE +A + +  +  N   P  +   K+         SD+ D+  F+DA E
Sbjct:  253 IKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLE-RAFRGATVLPANP--PGSAGSGKDQCCSGKGDMSDEDDENEFFDAPE 362          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbpl3 (oxysterol binding protein-like 3 [Source:MGI Symbol;Acc:MGI:1918970])

HSP 1 Score: 244.973 bits (624), Expect = 6.214e-68
Identity = 147/375 (39.20%), Postives = 218/375 (58.13%), Query Frame = 2
Query: 1442 DNLGKDLYNVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKI-TPRPNMS-INLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTG-KPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCH--LNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAET--LWSRRFPPEYTSEMYNFTNFALELNEPE----ENVAPTDSRLRPDQRLMETGFWDEA 2533
            DNL  D  N+S D+   +E +T   V   S +   K    RRT +  P PN S ++LW I++N IGK+LSK+ +PV  NEPL+ +QRL E+ EYS+ LD A+     LE++ +VAAF +S+Y+++  R G KPFNP+LGET+E  R D  G++  AEQVSHHPP ++ H ES   +  WQ+    +KF GK + I+P+G  H+T     +H+ W KVTS +HNI+ G+ WI+++GE+DI N    ++CH  +N+    Y+S   A  + G + D+ G   + L G W                 ++ ++  G + +  +W     P+   + Y FT FALELNE +      + PTD+R RPDQRL+E G  +EA
Sbjct:  412 DNLSLD--NLSNDLD--NERQTLGPVLESSGEARSK----RRTSLPAPGPNTSSVSLWSILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELEYSELLDKASRIPSPLERMVYVAAFAISAYASSYFRAGSKPFNPVLGETYECIRQDK-GFQFFAEQVSHHPPISACHAES-GNFVFWQDVRWKNKFWGKSMEIVPIGTTHVTLPAFGDHFEWNKVTSCIHNILSGQRWIEHYGEIDIKN-LNDDSCHCKVNFIKAKYWSTN-AHEIEGTVFDRSGKAVHRLFGKW-----------------HESIYCGGASSSTCVWRANPMPKGYEQYYGFTQFALELNEMDPLSRSLLPPTDTRFRPDQRLLEEGNIEEA 757          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|Q969R2|OSBP2_HUMAN (Oxysterol-binding protein 2 OS=Homo sapiens OX=9606 GN=OSBP2 PE=1 SV=2)

HSP 1 Score: 445.277 bits (1144), Expect = 5.731e-140
Identity = 233/422 (55.21%), Postives = 283/422 (67.06%), Query Frame = 2
Query: 1499 LKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXX---XXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            L  A  VP  S+KV+      RR +I  +PN S+NLW IMKNCIG+ELS+IP+PVNFNEPLSM+QRLTED EY   LD A  C  S+EQ+  VAAF+VSSYSTT +R  KPFNP+LGETFE DR DD+G RSL EQVSHHPP+A+ +  S  GW  WQE T+SSKFRGKY++I+P+G  HL F+ S NHY WRK TSTVHNIIVGKLWID  G+++I NHKT + C L +  YSYFSKE AR+VTGV++D  G   YVL+G+WD   + +KV+H        D   + V++T  A+ LW +   PE    MY F+  AL LNE EE VAPTDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR R +         S+     + + P+WF    D  T     +Y G YWE K    W
Sbjct:  494 LDGASLVPKGSSKVK------RRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQTLSAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDW 909          

HSP 2 Score: 132.109 bits (331), Expect = 5.529e-30
Identity = 67/138 (48.55%), Postives = 93/138 (67.39%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRL 493
            D  +G+L KWTNY+KGYQ+RWFVL NGLLSYYRN+ E++HTCRGTINLST+ I  +DS  I++++ + +++HLKA SE +  QW+TAL LAK  A+ +     DDS  +    +P   + L   HH+     L +D L
Sbjct:  183 DSFEGWLLKWTNYLKGYQRRWFVLGNGLLSYYRNQGEMAHTCRGTINLSTAHIDTEDSCGILLTSGA-RSYHLKASSEVDRQQWITALELAKAKAVRVMNTHSDDSGDDDEATTPADKSEL---HHTLKNLSLKLDDL 316          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|Q5QNQ6|OSBP2_MOUSE (Oxysterol-binding protein 2 OS=Mus musculus OX=10090 GN=Osbp2 PE=1 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 6.208e-140
Identity = 225/432 (52.08%), Postives = 289/432 (66.90%), Query Frame = 2
Query: 1472 SGDVSTFSELKTAQSVPSLSTKVEKKPARV-RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQ--VFETGPAETLWSRRFP-PEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHK-----PVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            SG  +T  +  +A +V   ++ + K   +V RR +I  +PN S+NLW IMKNCIG+ELS+IP+PVNFNEPLSM+QRLTED EY   LD A  C  S+EQ+  VAAF+VSSYSTT +R  KPFNP+LGETFE DR +D+G RSL EQVSHHPP+A+ H  S  GW  WQE T++SKFRGKY++I+P+G  HL F+ S NHY WRK TSTVHNIIVGKLWID  G+++I NHKT + C L +  YSYFSKE AR+VTGV++D  G   YVL+G+WD   + +K++H     + +Q  V++T PA+ LW R++P PE    MY F+  AL LNE E+ VAPTDSRLRPDQRLME G WDEA       +++  EK+R   +   +  + G    EE +     P+WF    D  T     +Y G YWE K    W
Sbjct:  475 SGPGTTTVDWTSADNVLDGASFMPKNSCKVKRRVRIPDKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVNCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRMEDMGLRSLCEQVSHHPPSAAHHVFSKHGWSLWQEITIASKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTKDRCQLKFVPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDDQMECSKIVHSSPSSDGRQKTVYQTLPAKLLW-RKYPLPENAENMYYFSELALTLNEQEDGVAPTDSRLRPDQRLMERGRWDEA----NTEKQRLEEKQRLSRRRRLESCTAGCGGEEEKESDGYVPLWFEKRLDPLTGEMACMYKGGYWEAKEKKDW 901          

HSP 2 Score: 126.716 bits (317), Expect = 3.049e-28
Identity = 56/98 (57.14%), Postives = 75/98 (76.53%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISL 373
            D +KG+L KWTNY+KGYQ+RWFVL NGLLSYYRN+ E++HTCR TINL+++    +DS  I++ N + +T+HLKA SE +   W+TAL LAK  AI +
Sbjct:  180 DSYKGWLLKWTNYLKGYQRRWFVLGNGLLSYYRNQGEMAHTCRATINLASTHFETEDSCGILLCNGA-RTYHLKASSEVDRQHWITALELAKAKAIRV 276          

HSP 3 Score: 53.9138 bits (128), Expect = 7.186e-6
Identity = 36/113 (31.86%), Postives = 57/113 (50.44%), Query Frame = 2
Query:  806 EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVF 1144
            E+   F + + A +N+C +F   A     K+Q+ LN E+EQR+ LE+ +E+LAKQ  +LE+             +    S  E +      + + +D D EYF DA+ED   F
Sbjct:  353 ERATLFRITSNAMINACRDFLELAETHSRKWQRALNYEQEQRVHLEETIEQLAKQHNSLERAFCNTPG----GPASSSKSFSEGSFLTSKGENSEEDEDTEYF-DAMEDSTSF 460          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|P22059|OSBP1_HUMAN (Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1)

HSP 1 Score: 414.075 bits (1063), Expect = 2.718e-129
Identity = 230/399 (57.64%), Postives = 274/399 (68.67%), Query Frame = 2
Query: 1562 RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAE----TLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT 2746
            +RT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY + LD AA+C +SLEQL +VAAFTVSSYSTT  RT KPFNPLLGETFE DR ++ G+RSL EQVSHHPPAA+ H ES  GW   QE  ++SKFRGKYL+I+P+G  H  F  + +HYTW+KVT+TVHNIIVGKLWID  GE+DI NHKTG+ C+L +  YSYFS++ AR+VTG +TD  G   + L GTWD   +  KV  +  +           AE     LW R   P+    MY F+  AL LN  E   APTDSRLRPDQRLME G WDEAN EK+RLEEKQR  R+ RE E  +    G  P + +K +WF    D  TK  THIY G YWE K    W +
Sbjct:  405 KRTRIPYKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLRQEIKITSKFRGKYLSIMPLGTIHCIFHATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMECFKVQPVIGENGGDARQRGHEAEESRVMLWKRNPLPKNAENMYYFSELALTLNAWESGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKKREAEAMKATEDG-TPYDPYKALWFERKKDPVTKELTHIYRGEYWECKEKQDWSS 802          

HSP 2 Score: 137.502 bits (345), Expect = 7.971e-32
Identity = 72/144 (50.00%), Postives = 94/144 (65.28%), Query Frame = 2
Query:   89 KGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDIS 520
            +G+L+KWTNYIKGYQ+RWFVLSNGLLSYYR+K E+ HTCRGTINL+T+ I  +DS + +ISN   QT+HLKA SE E  +W+TAL LAK  A+ +     +  D E          S+++   +  QN L   R  SS   D+S
Sbjct:   92 EGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVKMLAESDESGDEE----------SVSQTDKTELQNTL---RTLSSKVEDLS 222          

HSP 3 Score: 57.7658 bits (138), Expect = 5.461e-7
Identity = 37/113 (32.74%), Postives = 60/113 (53.10%), Query Frame = 2
Query:  791 MHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIE 1129
            + +  E+   F + + A +N+C +F   A     K+QK L  ER+QR+RLE+ +E+LAKQ   LE +A + +  +  NT  P +    K+         SD+ D+  F+DA E
Sbjct:  255 IKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLE-RAFRGATVLPANT--PGNVGSGKDQCCSGKGDMSDEDDENEFFDAPE 364          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|Q3B7Z2|OSBP1_MOUSE (Oxysterol-binding protein 1 OS=Mus musculus OX=10090 GN=Osbp PE=1 SV=3)

HSP 1 Score: 414.075 bits (1063), Expect = 2.864e-129
Identity = 230/399 (57.64%), Postives = 274/399 (68.67%), Query Frame = 2
Query: 1562 RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAE----TLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT 2746
            +RT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY + LD AA+C +SLEQL +VAAFTVSSYSTT  RT KPFNPLLGETFE DR ++ G+RS+ EQVSHHPPAA+ H ES  GW   QE  ++SKFRGKYL+I+P+G  H  F  + +HYTW+KVT+TVHNIIVGKLWID  GE+DI NHKTG+ C+L +  YSYFS++ AR+VTG +TD  G   + L GTWD      KV     +           AE     LW R   P+    MY F+  AL LN  E   APTDSRLRPDQRLME G WDEAN EK+RLEEKQR  R+ RE E  +    G P  + +K +WF    D  T+  THIYSG YWE K    WG+
Sbjct:  403 KRTRIPYKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRLEENGYRSICEQVSHHPPAAAHHAESKNGWTLRQEIKITSKFRGKYLSIMPLGTIHCIFHSTGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMDCFKVQAASGENGGDARQRGHEAEDSRVMLWKRNPLPKNAENMYYFSELALTLNAWEGGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKKREAEAAKATEDGTPH-DPYKALWFERKKDPVTRELTHIYSGEYWECKEKQDWGS 800          

HSP 2 Score: 138.658 bits (348), Expect = 3.365e-32
Identity = 64/107 (59.81%), Postives = 81/107 (75.70%), Query Frame = 2
Query:   89 KGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEA 409
            +G+L+KWTNYIKGYQ+RWFVLSNGLLSYYR+K E+ HTCRGTINL+T+ I  +DS + +ISN   QT+HLKA SE E  +W+TAL LAK  A+ +     D  D E+
Sbjct:   90 EGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVKMLAESDDSGDEES 196          

HSP 3 Score: 55.4546 bits (132), Expect = 2.322e-6
Identity = 36/113 (31.86%), Postives = 59/113 (52.21%), Query Frame = 2
Query:  791 MHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIE 1129
            + +  E+   F + + A +N+C +F   A     K+QK L  ER+QR+RLE+ +E+LAKQ   LE +A + +  +  N   P  +   K+         SD+ D+  F+DA E
Sbjct:  253 IKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLE-RAFRGATVLPANP--PGSAGSGKDQCCSGKGDMSDEDDENEFFDAPE 362          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|P16258|OSBP1_RABIT (Oxysterol-binding protein 1 OS=Oryctolagus cuniculus OX=9986 GN=OSBP PE=1 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 5.669e-129
Identity = 230/399 (57.64%), Postives = 273/399 (68.42%), Query Frame = 2
Query: 1562 RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAE----TLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT 2746
            +RT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY + LD AA+C +SLEQL +VAAFTVSSYSTT  RT KPFNPLLGETFE DR ++ G+RSL EQVSHHPPAA+ H ES  GW   QE  ++SKFRGKYL+I+P+G  H  F  + +HYTW+KVT+TVHNIIVGKLWID  GE+DI NHKTG+ C+L +  YSYFS++ AR+VTG +TD  G   + L GTWD      KV  +  +           AE     LW R   P+    MY F+  AL LN  E   APTDSRLRPDQRLME G WDEAN EK+RLEEKQR  R+ RE E  +    G  P + +K +WF    D  TK  THIY G YWE K    W +
Sbjct:  407 KRTRIPYKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLRQEIKITSKFRGKYLSIMPLGTIHCIFHATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMDCFKVQPVSGENGGDARQRGHEAEESRVMLWKRNPLPKNAENMYYFSELALTLNAWEGGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKKREAEAMKATEDG-TPYDPYKALWFERKKDPVTKELTHIYRGEYWECKEKQDWNS 804          

HSP 2 Score: 137.502 bits (345), Expect = 9.387e-32
Identity = 72/144 (50.00%), Postives = 94/144 (65.28%), Query Frame = 2
Query:   89 KGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDIS 520
            +G+L+KWTNYIKGYQ+RWFVLSNGLLSYYR+K E+ HTCRGTINL+T+ I  +DS + +ISN   QT+HLKA SE E  +W+TAL LAK  A+ +     +  D E          S+++   +  QN L   R  SS   D+S
Sbjct:   94 EGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVKMLAESDESGDEE----------SVSQTDKTELQNTL---RTLSSKVEDLS 224          

HSP 3 Score: 55.4546 bits (132), Expect = 2.599e-6
Identity = 38/117 (32.48%), Postives = 60/117 (51.28%), Query Frame = 2
Query:  791 MHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDE----KNVRVKNTDQASDDSDDEYFYDAIE 1129
            + +  E+   F + + A +N+C +F   A     K+QK L  ER+QR+RLE+ +E+LAKQ   LE +A + +      T LP H+       K+         SD+ D+  F+DA E
Sbjct:  257 IKQVNERATLFRITSNAMINACRDFLVLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLE-RAFRGA------TVLPAHTSGSAGSGKDQCCSGKGDMSDEDDENEFFDAPE 366          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: A0A1S3J541 (Oxysterol-binding protein OS=Lingula unguis OX=7574 GN=LOC106170170 PE=3 SV=1)

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 390/889 (43.87%), Postives = 508/889 (57.14%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDISLYYKEFEQRLFDLNTSVSLVKKTSESXXXXXXXXXXXXSPHXXXXXXXXXXXXVDMKAHDQXXXXXXXXXXXXIDHRAPSHSSIGPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHV-FNVSLPRPISQNNVKLEPKYTINXXXXXXXXXXXXKDNSKGNSIARVIVRSTEXXXXXXXXXXXXXXGDSSQFHRRTVSSGFPSQSLCPSNSLKANKNQCDNLGKDLYNVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWG 2743
            D +KG+LYKWTNYIKGYQKRWFVL NGLLSYYRN+ E++HTCRGTINL+ + I  +DS S VISN   QT+HLKA SE E  +W+TAL LAK  AI + E+   DS+ +  L        +++P     QN L                 +    +L DLNT   L+ K   +                                     L    S L  +D+   + + I  V +    F+       + + A +N+CS+F + A     ++Q+LL  E EQR+RLE MVE++AKQ   LEK+A K   +  L++ +  +  + K   V+ +++  DD     F+DA++ +H  + V+LP   S +                           KG  + RV                     D SQ    ++ +G+  Q    S S        D  G +   V       S+ K  Q    + T+      R RR+ I  RPN ++NLWGIMKNCIG++LSKIP+PVNF+EPLSM+QRLTE+FEYS+ LD AA C DS EQL++VAAFT+S+Y+TT+ RTGKPFNPLLGET+E DR DD GWR ++EQVSHHPP A+++ E  + W  WQEFTMSSKFRGKYLAI P+GIAHL F KS NHYTWRKVT+TVHNIIVGKLW+DNHGEMDI NH  G+ CHL Y  YSYFS+E  R+VTGV+ D++G T +VL G WD   + AKVL        + VFE+GP++ LW +   P    +MYNFT  A+ELNE E  VAPTDSRLRPDQR ME   WD ANKEK +LEEKQR  R+ RE E EQ  S+G   +  ++P WF    D++T    H+Y+  YWE K    WG
Sbjct:   11 DSYKGWLYKWTNYIKGYQKRWFVLQNGLLSYYRNQAEMAHTCRGTINLANAFIHTEDSCSFVISNGGTQTYHLKASSEVERQKWVTALELAKAKAIRMMES---DSEEDEDL--------ISQPDKDELQNTL-----------------RTLGAKLEDLNTCNDLIVKHGAA-------------------------------------LQKSLSELEQLDNSTDTATRIKSVNERATLFR-------ITSSAMINACSDFLDLAQTQGKRWQRLLQHEHEQRVRLEDMVEQIAKQQQNLEKQARKSLAAANLHSKIDTNDTEPK---VEGSEEEEDD-----FFDALDIQHTEYQVALPHKPSMH---------------------------KG--LRRV-------------------GSDVSQISLDSLGAGYQRQDYDSSES--------DAEGDNEARVIATARKQSKTKMGQPGTPVRTR-RANSLRKRRSAILERPNHTLNLWGIMKNCIGRDLSKIPMPVNFSEPLSMLQRLTEEFEYSEILDTAAACEDSCEQLAYVAAFTISAYATTSFRTGKPFNPLLGETYECDRRDDYGWRVISEQVSHHPPTAAMYAEG-RDWALWQEFTMSSKFRGKYLAITPLGIAHLRFNKSGNHYTWRKVTTTVHNIIVGKLWVDNHGEMDIVNHTNGDLCHLKYSQYSYFSRETPRKVTGVVADRNGQTNWVLTGMWDEKIEGAKVLSCTTSSKGKPVFESGPSKVLWKKNPIPPGNEKMYNFTQLAVELNEMEPGVAPTDSRLRPDQRSMENQDWDGANKEKLKLEEKQRLARKRREAEAEQAASEGREYV-PYEPAWFKKTKDQQTGNLIHMYTHEYWEAKEKQDWG 760          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: Q7QGU9 (Oxysterol-binding protein (Fragment) OS=Anopheles gambiae OX=7165 GN=AgaP_AGAP010893 PE=3 SV=4)

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 376/894 (42.06%), Postives = 511/894 (57.16%), Query Frame = 2
Query:   77 PDCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDISLYYKEFEQRLFDLNTSVSLVKKTSESXXXXXXXXXXXXSPHXXXXXXXXXXXXVDMKAHDQXXXXXXXXXXXXIDHRAPSHSSIGPVPDLMHKFK---EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLPRPISQNNVKLEPKYTINXXXXXXXXXXXXKDNSKGNSIARVIVRSTEXXXXXXXXXXXXXXGDSSQFHRRTVSSGFPSQSLCPSNSLKANKNQCDNLGKDLYNVSGDVSTFSELKTAQSV-PSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKT--GETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            PD  KG+L KWTNY+KGYQKRWFVLS G+LSYYRN+ E++HTCRGTI+L  ++I   DS + VISN   QTFH+KA +E E   W+TAL LAK  AI   E+  ++ D+ A                    N +P        + +++L  +E   RL +L T   L+ K   +L                                                 RA S    G   DL +K K   E+   F +++ A +N+CS++   A     K+ K+L  ER+Q+L LE+MVE+LA+Q   LE+ A +   S  ++++                  ASDD D+E FYDA E+              +  + +  + +N   +   +     +++ G+S                        G+S     R++++G  S S  P   + A     DN+         DV+    + ++Q++ P+L+   + K  R RRT++  +PN  +NLW I+KNCIGK+LSKIP+PVNFNEPLSM+QRLTEDFEYS+ LD AA+  D+ EQL++V AFTVSSYSTT+NRTGKPFNPLLGET+E DRTDDLGWR + EQVSHHPP A+ +CE  +GW+CWQEFTM+SKFRGKY+ I+P+G AH+ F  + N YTWRKVT+TVHNIIVGKLW+DNHG+M+I+  +   G  CHL Y  YSYF+++  RRV GV+ D     K+V+NGTWDS  + A V        N  V++TG  +T W+RR PP  +   YNFT  A +LNEPE  VAPTDSRLRPDQRLME G W+E+N+EK RLEE QR +RR RE E E   ++G  P   ++P+WF    +E T    H+Y+G YW+ KA G W
Sbjct:   14 PDM-KGWLLKWTNYLKGYQKRWFVLSKGVLSYYRNQAEMAHTCRGTISLHGALIHTVDSCTFVISNGGTQTFHIKAANEVERQSWVTALELAKAKAIRAMESDEEEEDNTA--------------------NTIP--------SEELNLVVRELTVRLENLKTCYDLITKHGAAL------------------------------------------------QRALSELETGD--DLANKTKIVSERATLFRISSNAMINACSDYLQTAQTQGHKWSKMLQHERDQKLHLEEMVEQLARQHSHLEQAATRHRPSDHVSSATKS---------FNAATSASDDEDNE-FYDAQEE------------GGSVTQEDSSFILNIPVTTHHNHRRNSNDATGSS-------------------SEGEDGNSETQQCRSLTAGHLSLSFSPRTGISAE--NLDNM---------DVTDRISVHSSQALTPTLAN--QSKVVRKRRTRVPDKPNYPLNLWSIIKNCIGKDLSKIPMPVNFNEPLSMLQRLTEDFEYSEILDKAAQAKDTCEQLAYVTAFTVSSYSTTSNRTGKPFNPLLGETYECDRTDDLGWRCINEQVSHHPPMAAQYCEG-RGWRCWQEFTMTSKFRGKYIQIVPLGYAHVEFPATGNRYTWRKVTTTVHNIIVGKLWVDNHGDMEIFGERNAKGVKCHLKYLPYSYFTRDTQRRVKGVVMDSSNQVKWVVNGTWDSKIEIAPVTSTSGSTEN-PVYKTGNYKTAWTRRMPPPDSDRYYNFTLLACQLNEPEPGVAPTDSRLRPDQRLMEDGKWNESNQEKLRLEEGQRARRRQREAEAETAAAEGR-PYPPYEPIWFGKEKEEGTDNLVHVYNGTYWDAKAKGDW 771          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: A0A4Y2GK20 (Oxysterol-binding protein 1 OS=Araneus ventricosus OX=182803 GN=OSBP PE=4 SV=1)

HSP 1 Score: 538.11 bits (1385), Expect = 8.353e-175
Identity = 304/664 (45.78%), Postives = 410/664 (61.75%), Query Frame = 2
Query:  779 VPDLMHKFK---EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHV-FNVSLPRPISQNNVKLEPKYTINXXXXXXXXXXXXKDNSKGNSIARVIVRSTEXXXXXXXXXXXXXXGDSSQFHRRTVSSGFPSQSLCPSNSLKANKNQCDNLGKDLYNVSGDVSTFSELKTAQSVPSLSTKVEKK-----PARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFP-PEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            VPD ++K +   E+   F + + A +N+C ++   A     K+ K++  E EQRLRLE+MVE+LAKQ   LE+ A + S     + S   HSDD++                  FYDA E+    F +++P  + +   +    +++               +++G S+ +                     GD     RR   +     S+C +N  + N++  +                 ++ +A   P+ ST  EK      P + RR  +  +PN S+NLW IMKNCIGKEL+KIP+PVNFNEPLS +QRLTE++EYSD LD AA+C+DS EQ+++VAA+TVS+Y+TT+NRTGKPFNPLLGET+E DRTDD GWR L+EQVSHHPP  + HCE  +GW CWQEFTMSSKFRGKYL IIP+GIAHL F  S NHYTWRKVT+ VHNIIVG+LW+D+HGEM+I NH T + CHL +  YSYFS+E  R+VTGV+TD +G  K+VL GTWD+  + A+VL+       + + ET   +T+W R+FP PEY  +MYNFT  A +LNEPEE VAPTDSR+RPDQRLME G WDEAN+ K +LEEKQR+ RR +E+E EQ  ++G  P + ++P+WF    DE T    H + G YW+ K    W
Sbjct:  169 VPDAVNKIRSVNERATLFRITSNAMINACQDYLQLAQTQGRKWMKMVQHEHEQRLRLEEMVEQLAKQHSHLERAAKEAS-----SNSPGMHSDDDE------------------FYDAEEETGSDFVITIPGKVHR---RTPSGFSLQSEGQDLDGGASSDTDAEGTSLTK--------------------SGD--MIARRKKRNRGQVHSVCVTNHCEDNESDSER----------------KVSSASESPTHSTNAEKDNKSLVPVKNRRLTVPEKPNYSLNLWSIMKNCIGKELTKIPMPVNFNEPLSTLQRLTEEYEYSDLLDKAAQCSDSCEQMAYVAAYTVSAYATTSNRTGKPFNPLLGETYECDRTDDYGWRCLSEQVSHHPPMLAQHCEG-RGWICWQEFTMSSKFRGKYLQIIPLGIAHLLFPASGNHYTWRKVTTFVHNIIVGRLWVDHHGEMEIVNHHTEDKCHLRFIPYSYFSREVPRKVTGVVTDHEGNAKFVLQGTWDNKMESARVLNSHGSVKGKPLLETSTPKTIWRRQFPGPEY-EKMYNFTVLACQLNEPEEGVAPTDSRVRPDQRLMEDGAWDEANRIKVQLEEKQRQVRRKKEEEAEQAAAEGR-PYQGYEPIWFTKETDEITGNPVHKFKGEYWKCKENQDW 765          

HSP 2 Score: 145.976 bits (367), Expect = 5.571e-32
Identity = 69/108 (63.89%), Postives = 83/108 (76.85%), Query Frame = 2
Query:   89 KGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAP 412
            KG+LYKWTNY+KGYQKRWFVL NGLLSYYRN NEV+HTCRGTINL +++I   DS + VISN   QTFHLKA +E E  +W+TAL LAK  AI ++E+  D+  S  P
Sbjct:   13 KGWLYKWTNYLKGYQKRWFVLYNGLLSYYRNPNEVAHTCRGTINLVSAVIHTVDSSNFVISNGGTQTFHLKASNEIERQRWVTALELAKARAIRMTESDEDEDYSLLP 120          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: A0A1S3J6B2 (Oxysterol-binding protein OS=Lingula unguis OX=7574 GN=LOC106170170 PE=3 SV=1)

HSP 1 Score: 534.258 bits (1375), Expect = 4.001e-173
Identity = 304/647 (46.99%), Postives = 395/647 (61.05%), Query Frame = 2
Query:  806 EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHV-FNVSLPRPISQNNVKLEPKYTINXXXXXXXXXXXXKDNSKGNSIARVIVRSTEXXXXXXXXXXXXXXGDSSQFHRRTVSSGFPSQSLCPSNSLKANKNQCDNLGKDLYNVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWG 2743
            E+   F + + A +N+CS+F + A     ++Q+LL  E EQR+RLE MVE++AKQ   LEK+A K   +  L++ +  +  + K   V+ +++  DD     F+DA++ +H  + V+LP   S +                           KG  + RV                     D SQ    ++ +G+  Q    S S        D  G +   V       S+ K  Q    + T+      R RR+ I  RPN ++NLWGIMKNCIG++LSKIP+PVNF+EPLSM+QRLTE+FEYS+ LD AA C DS EQL++VAAFT+S+Y+TT+ RTGKPFNPLLGET+E DR DD GWR ++EQVSHHPP A+++ E  + W  WQEFTMSSKFRGKYLAI P+GIAHL F KS NHYTWRKVT+TVHNIIVGKLW+DNHGEMDI NH  G+ CHL Y  YSYFS+E  R+VTGV+ D++G T +VL G WD   + AKVL        + VFE+GP++ LW +   P    +MYNFT  A+ELNE E  VAPTDSRLRPDQR ME   WD ANKEK +LEEKQR  R+ RE E EQ  S+G   +  ++P WF    D++T    H+Y+  YWE K    WG
Sbjct:  199 ERATLFRITSSAMINACSDFLDLAQTQGKRWQRLLQHEHEQRVRLEDMVEQIAKQQQNLEKQARKSLAAANLHSKIDTNDTEPK---VEGSEEEEDD-----FFDALDIQHTEYQVALPHKPSMH---------------------------KG--LRRV-------------------GSDVSQISLDSLGAGYQRQDYDSSES--------DAEGDNEARVIATARKQSKTKMGQPGTPVRTR-RANSLRKRRSAILERPNHTLNLWGIMKNCIGRDLSKIPMPVNFSEPLSMLQRLTEEFEYSEILDTAAACEDSCEQLAYVAAFTISAYATTSFRTGKPFNPLLGETYECDRRDDYGWRVISEQVSHHPPTAAMYAEG-RDWALWQEFTMSSKFRGKYLAITPLGIAHLRFNKSGNHYTWRKVTTTVHNIIVGKLWVDNHGEMDIVNHTNGDLCHLKYSQYSYFSRETPRKVTGVVADRNGQTNWVLTGMWDEKIEGAKVLSCTTSSKGKPVFESGPSKVLWKKNPIPPGNEKMYNFTQLAVELNEMEPGVAPTDSRLRPDQRSMENQDWDGANKEKLKLEEKQRLARKRREAEAEQAASEGREYV-PYEPAWFKKTKDQQTGNLIHMYTHEYWEAKEKQDWG 778          

HSP 2 Score: 148.288 bits (373), Expect = 9.678e-33
Identity = 69/108 (63.89%), Postives = 83/108 (76.85%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSE-AVLDDSD 400
            D +KG+LYKWTNYIKGYQKRWFVL NGLLSYYRN+ E++HTCRGTINL+ + I  +DS S VISN   QT+HLKA SE E  +W+TAL LAK  AI + E  + +D D
Sbjct:   11 DSYKGWLYKWTNYIKGYQKRWFVLQNGLLSYYRNQAEMAHTCRGTINLANAFIHTEDSCSFVISNGGTQTYHLKASSEVERQKWVTALELAKAKAIRMMESGISEDGD 118          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: A0A2R2MKW8 (Oxysterol-binding protein OS=Lingula unguis OX=7574 GN=LOC106170170 PE=3 SV=1)

HSP 1 Score: 529.25 bits (1362), Expect = 3.666e-171
Identity = 303/647 (46.83%), Postives = 392/647 (60.59%), Query Frame = 2
Query:  806 EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHV-FNVSLPRPISQNNVKLEPKYTINXXXXXXXXXXXXKDNSKGNSIARVIVRSTEXXXXXXXXXXXXXXGDSSQFHRRTVSSGFPSQSLCPSNSLKANKNQCDNLGKDLYNVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWG 2743
            E+   F + + A +N+CS+F + A     ++Q+LL  E EQR+RLE MVE++AKQ   LEK+A K   +  L++ +    D       + +++  DD     F+DA++ +H  + V+LP   S +                           KG  + RV                     D SQ    ++ +G+  Q    S S        D  G +   V       S+ K  Q    + T+      R RR+ I  RPN ++NLWGIMKNCIG++LSKIP+PVNF+EPLSM+QRLTE+FEYS+ LD AA C DS EQL++VAAFT+S+Y+TT+ RTGKPFNPLLGET+E DR DD GWR ++EQVSHHPP A+++ E  + W  WQEFTMSSKFRGKYLAI P+GIAHL F KS NHYTWRKVT+TVHNIIVGKLW+DNHGEMDI NH  G+ CHL Y  YSYFS+E  R+VTGV+ D++G T +VL G WD   + AKVL        + VFE+GP++ LW +   P    +MYNFT  A+ELNE E  VAPTDSRLRPDQR ME   WD ANKEK +LEEKQR  R+ RE E EQ  S+G   +  ++P WF    D++T    H+Y+  YWE K    WG
Sbjct:  199 ERATLFRITSSAMINACSDFLDLAQTQGKRWQRLLQHEHEQRVRLEDMVEQIAKQQQNLEKQARKSLAAANLHSKI----DTNDTEPKEGSEEEEDD-----FFDALDIQHTEYQVALPHKPSMH---------------------------KG--LRRV-------------------GSDVSQISLDSLGAGYQRQDYDSSES--------DAEGDNEARVIATARKQSKTKMGQPGTPVRTR-RANSLRKRRSAILERPNHTLNLWGIMKNCIGRDLSKIPMPVNFSEPLSMLQRLTEEFEYSEILDTAAACEDSCEQLAYVAAFTISAYATTSFRTGKPFNPLLGETYECDRRDDYGWRVISEQVSHHPPTAAMYAEG-RDWALWQEFTMSSKFRGKYLAITPLGIAHLRFNKSGNHYTWRKVTTTVHNIIVGKLWVDNHGEMDIVNHTNGDLCHLKYSQYSYFSRETPRKVTGVVADRNGQTNWVLTGMWDEKIEGAKVLSCTTSSKGKPVFESGPSKVLWKKNPIPPGNEKMYNFTQLAVELNEMEPGVAPTDSRLRPDQRSMENQDWDGANKEKLKLEEKQRLARKRREAEAEQAASEGREYV-PYEPAWFKKTKDQQTGNLIHMYTHEYWEAKEKQDWG 777          

HSP 2 Score: 148.288 bits (373), Expect = 9.892e-33
Identity = 69/108 (63.89%), Postives = 84/108 (77.78%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEA-VLDDSD 400
            D +KG+LYKWTNYIKGYQKRWFVL NGLLSYYRN+ E++HTCRGTINL+ + I  +DS S VISN   QT+HLKA SE E  +W+TAL LAK  AI + E+ + +D D
Sbjct:   11 DSYKGWLYKWTNYIKGYQKRWFVLQNGLLSYYRNQAEMAHTCRGTINLANAFIHTEDSCSFVISNGGTQTYHLKASSEVERQKWVTALELAKAKAIRMMESGISEDGD 118          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbp (oxysterol binding protein [Source:NCBI gene;Acc:103044970])

HSP 1 Score: 481.871 bits (1239), Expect = 5.455e-158
Identity = 245/406 (60.34%), Postives = 296/406 (72.91%), Query Frame = 2
Query: 1541 EKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNN------QQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            E  P R RRT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEP+SM+QRL+ED EYS+ LD  A+C  SLEQL +VAAFTVSSYSTT +RTGKPFNPLLGETFE DR  + G+RSL EQVSHHPPAA+ H  S +GW   QE T++SKFRGKYL+I+P+G  H  F+KSNNHY+W+KVT+TVHNIIVGKLWID  GE+D+ NH+TG+ CHL +  YSYFS++ AR+VTGV+TDKDG   YVL+GTWD   + ++V+   +   N      + V++T  A  LW +   PE    MY FT  AL LNE E+ VAPTDSR RPDQRLME G WDEAN EK+RLEEKQR  RR RE+E   ++     P + +  +WF  V DE T   THIY G YWETK  G W
Sbjct:  255 EVVPVRKRRTRIPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPISMLQRLSEDLEYSELLDRGAKCQSSLEQLCYVAAFTVSSYSTTVHRTGKPFNPLLGETFELDRLQESGYRSLCEQVSHHPPAAAHHVISERGWTLRQEITVASKFRGKYLSIMPLGSIHCIFDKSNNHYSWKKVTTTVHNIIVGKLWIDQSGEIDVINHRTGDRCHLKFAPYSYFSRDVARKVTGVVTDKDGKAHYVLSGTWDEKMECSRVMQSSRGGENGTEGRQKTVYQTLKARELWRKNPLPEGAENMYYFTQLALTLNEQEDGVAPTDSRRRPDQRLMEQGMWDEANAEKQRLEEKQRSVRREREREAWAKEHGA--PQDNYTALWFEQVVDEATGEPTHIYKGGYWETKEQGTW 658          

HSP 2 Score: 72.7886 bits (177), Expect = 1.073e-12
Identity = 34/61 (55.74%), Postives = 44/61 (72.13%), Query Frame = 2
Query:  191 VSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISL 373
            + HTCRGTINL+T+ I  +DS + VISN   QT+HLKA SE E  +W+TAL LAK  A+ +
Sbjct:    1 MGHTCRGTINLATANIAVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKAKAVRM 61          

HSP 3 Score: 63.929 bits (154), Expect = 7.139e-10
Identity = 42/129 (32.56%), Postives = 65/129 (50.39%), Query Frame = 2
Query:  773 GPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLP 1159
            G   D + +  E+   F + + A +N+C +F   A     ++QK L  ER+QR+RLE+ +E+LAKQ   LE+     +      +S P   D            ASDD D+E F+DA ED   F +++P
Sbjct:  118 GDTSDKIRQVTERATLFRITSNAMINACRDFLALAQAHSKRWQKALQAERDQRVRLEETLEQLAKQHNHLERAFRGATVLPASPSSGPGKGD------------ASDDDDNE-FFDACEDVQEF-ITIP 232          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbp (oxysterol binding protein [Source:NCBI gene;Acc:103044970])

HSP 1 Score: 482.641 bits (1241), Expect = 6.276e-157
Identity = 250/429 (58.28%), Postives = 304/429 (70.86%), Query Frame = 2
Query: 1478 DVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNN------QQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQG--LPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            D +T  + ++  S P      E  P R RRT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEP+SM+QRL+ED EYS+ LD  A+C  SLEQL +VAAFTVSSYSTT +RTGKPFNPLLGETFE DR  + G+RSL EQVSHHPPAA+ H  S +GW   QE T++SKFRGKYL+I+P+G  H  F+KSNNHY+W+KVT+TVHNIIVGKLWID  GE+D+ NH+TG+ CHL +  YSYFS++ AR+VTGV+TDKDG   YVL+GTWD   + ++V+   +   N      + V++T  A  LW +   PE    MY FT  AL LNE E+ VAPTDSR RPDQRLME G WDEAN EK+RLEEKQR  RR RE+E  +  S      P + +  +WF  V DE T   THIY G YWETK  G W
Sbjct:  326 DGTTSLDEQSLASNPESPQSQEVVPVRKRRTRIPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPISMLQRLSEDLEYSELLDRGAKCQSSLEQLCYVAAFTVSSYSTTVHRTGKPFNPLLGETFELDRLQESGYRSLCEQVSHHPPAAAHHVISERGWTLRQEITVASKFRGKYLSIMPLGSIHCIFDKSNNHYSWKKVTTTVHNIIVGKLWIDQSGEIDVINHRTGDRCHLKFAPYSYFSRDVARKVTGVVTDKDGKAHYVLSGTWDEKMECSRVMQSSRGGENGTEGRQKTVYQTLKARELWRKNPLPEGAENMYYFTQLALTLNEQEDGVAPTDSRRRPDQRLMEQGMWDEANAEKQRLEEKQRSVRREREREAVRLASTAEEGAPQDNYTALWFEQVVDEATGEPTHIYKGGYWETKEQGTW 754          

HSP 2 Score: 147.902 bits (372), Expect = 4.524e-36
Identity = 71/121 (58.68%), Postives = 87/121 (71.90%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSL 442
            D +KG+L+KWTNYIKGYQ+RWFVLSNGLLSYYR + E+ HTCRGTINL+T+ I  +DS + VISN   QT+HLKA SE E  +W+TAL LAK  A+ + +A  DDS  E     P  G  L
Sbjct:   13 DTYKGWLFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMGHTCRGTINLATANIAVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKAKAVRM-QAESDDSGDECSTSPPSAGQGL 132          

HSP 3 Score: 65.855 bits (159), Expect = 1.729e-10
Identity = 45/129 (34.88%), Postives = 71/129 (55.04%), Query Frame = 2
Query:  773 GPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLP 1159
            G   D + +  E+   F + + A +N+C +F   A     ++QK L  ER+QR+RLE+ +E+LAKQ   LE +A + +  +  + S P  + D K       D ASDD D+E F+DA ED   F +++P
Sbjct:  181 GDTSDKIRQVTERATLFRITSNAMINACRDFLALAQAHSKRWQKALQAERDQRVRLEETLEQLAKQHNHLE-RAFRGATVLPASPSNP--TADSKGSGPGKGD-ASDDDDNE-FFDACEDVQEF-ITIP 303          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbp (oxysterol binding protein [Source:NCBI gene;Acc:103044970])

HSP 1 Score: 478.404 bits (1230), Expect = 3.811e-155
Identity = 250/442 (56.56%), Postives = 304/442 (68.78%), Query Frame = 2
Query: 1478 DVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNN------QQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQG---------------LPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            D +T  + ++  S P      E  P R RRT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEP+SM+QRL+ED EYS+ LD  A+C  SLEQL +VAAFTVSSYSTT +RTGKPFNPLLGETFE DR  + G+RSL EQVSHHPPAA+ H  S +GW   QE T++SKFRGKYL+I+P+G  H  F+KSNNHY+W+KVT+TVHNIIVGKLWID  GE+D+ NH+TG+ CHL +  YSYFS++ AR+VTGV+TDKDG   YVL+GTWD   + ++V+   +   N      + V++T  A  LW +   PE    MY FT  AL LNE E+ VAPTDSR RPDQRLME G WDEAN EK+RLEEKQR  RR RE+E  +  S                   P + +  +WF  V DE T   THIY G YWETK  G W
Sbjct:  326 DGTTSLDEQSLASNPESPQSQEVVPVRKRRTRIPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPISMLQRLSEDLEYSELLDRGAKCQSSLEQLCYVAAFTVSSYSTTVHRTGKPFNPLLGETFELDRLQESGYRSLCEQVSHHPPAAAHHVISERGWTLRQEITVASKFRGKYLSIMPLGSIHCIFDKSNNHYSWKKVTTTVHNIIVGKLWIDQSGEIDVINHRTGDRCHLKFAPYSYFSRDVARKVTGVVTDKDGKAHYVLSGTWDEKMECSRVMQSSRGGENGTEGRQKTVYQTLKARELWRKNPLPEGAENMYYFTQLALTLNEQEDGVAPTDSRRRPDQRLMEQGMWDEANAEKQRLEEKQRSVRREREREAVRLASTAEEAVIEDSITDSPLKSAPQDNYTALWFEQVVDEATGEPTHIYKGGYWETKEQGTW 767          

HSP 2 Score: 147.902 bits (372), Expect = 4.116e-36
Identity = 71/121 (58.68%), Postives = 87/121 (71.90%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSL 442
            D +KG+L+KWTNYIKGYQ+RWFVLSNGLLSYYR + E+ HTCRGTINL+T+ I  +DS + VISN   QT+HLKA SE E  +W+TAL LAK  A+ + +A  DDS  E     P  G  L
Sbjct:   13 DTYKGWLFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMGHTCRGTINLATANIAVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKAKAVRM-QAESDDSGDECSTSPPSAGQGL 132          

HSP 3 Score: 65.855 bits (159), Expect = 1.730e-10
Identity = 45/129 (34.88%), Postives = 71/129 (55.04%), Query Frame = 2
Query:  773 GPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLP 1159
            G   D + +  E+   F + + A +N+C +F   A     ++QK L  ER+QR+RLE+ +E+LAKQ   LE +A + +  +  + S P  + D K       D ASDD D+E F+DA ED   F +++P
Sbjct:  181 GDTSDKIRQVTERATLFRITSNAMINACRDFLALAQAHSKRWQKALQAERDQRVRLEETLEQLAKQHNHLE-RAFRGATVLPASPSNP--TADSKGSGPGKGD-ASDDDDNE-FFDACEDVQEF-ITIP 303          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbp (oxysterol binding protein [Source:NCBI gene;Acc:103044970])

HSP 1 Score: 471.47 bits (1212), Expect = 2.589e-152
Identity = 250/458 (54.59%), Postives = 304/458 (66.38%), Query Frame = 2
Query: 1478 DVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNN------QQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEE-------------------------------HKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            D +T  + ++  S P      E  P R RRT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEP+SM+QRL+ED EYS+ LD  A+C  SLEQL +VAAFTVSSYSTT +RTGKPFNPLLGETFE DR  + G+RSL EQVSHHPPAA+ H  S +GW   QE T++SKFRGKYL+I+P+G  H  F+KSNNHY+W+KVT+TVHNIIVGKLWID  GE+D+ NH+TG+ CHL +  YSYFS++ AR+VTGV+TDKDG   YVL+GTWD   + ++V+   +   N      + V++T  A  LW +   PE    MY FT  AL LNE E+ VAPTDSR RPDQRLME G WDEAN EK+RLEEKQR  RR RE+E  +  S     + E                               +  +WF  V DE T   THIY G YWETK  G W
Sbjct:  326 DGTTSLDEQSLASNPESPQSQEVVPVRKRRTRIPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPISMLQRLSEDLEYSELLDRGAKCQSSLEQLCYVAAFTVSSYSTTVHRTGKPFNPLLGETFELDRLQESGYRSLCEQVSHHPPAAAHHVISERGWTLRQEITVASKFRGKYLSIMPLGSIHCIFDKSNNHYSWKKVTTTVHNIIVGKLWIDQSGEIDVINHRTGDRCHLKFAPYSYFSRDVARKVTGVVTDKDGKAHYVLSGTWDEKMECSRVMQSSRGGENGTEGRQKTVYQTLKARELWRKNPLPEGAENMYYFTQLALTLNEQEDGVAPTDSRRRPDQRLMEQGMWDEANAEKQRLEEKQRSVRREREREAVRLASTAEEAVIEDSITDSPLKTDDVEFSSDPSDSAFKSAPQDNYTALWFEQVVDEATGEPTHIYKGGYWETKEQGTW 783          

HSP 2 Score: 147.902 bits (372), Expect = 4.511e-36
Identity = 71/121 (58.68%), Postives = 87/121 (71.90%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSL 442
            D +KG+L+KWTNYIKGYQ+RWFVLSNGLLSYYR + E+ HTCRGTINL+T+ I  +DS + VISN   QT+HLKA SE E  +W+TAL LAK  A+ + +A  DDS  E     P  G  L
Sbjct:   13 DTYKGWLFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMGHTCRGTINLATANIAVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKAKAVRM-QAESDDSGDECSTSPPSAGQGL 132          

HSP 3 Score: 65.855 bits (159), Expect = 1.779e-10
Identity = 45/129 (34.88%), Postives = 71/129 (55.04%), Query Frame = 2
Query:  773 GPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLP 1159
            G   D + +  E+   F + + A +N+C +F   A     ++QK L  ER+QR+RLE+ +E+LAKQ   LE +A + +  +  + S P  + D K       D ASDD D+E F+DA ED   F +++P
Sbjct:  181 GDTSDKIRQVTERATLFRITSNAMINACRDFLALAQAHSKRWQKALQAERDQRVRLEETLEQLAKQHNHLE-RAFRGATVLPASPSNP--TADSKGSGPGKGD-ASDDDDNE-FFDACEDVQEF-ITIP 303          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbp (oxysterol binding protein [Source:NCBI gene;Acc:103044970])

HSP 1 Score: 455.292 bits (1170), Expect = 1.165e-145
Identity = 215/358 (60.06%), Postives = 263/358 (73.46%), Query Frame = 2
Query: 1478 DVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNN------QQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEA 2533
            D +T  + ++  S P      E  P R RRT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEP+SM+QRL+ED EYS+ LD  A+C  SLEQL +VAAFTVSSYSTT +RTGKPFNPLLGETFE DR  + G+RSL EQVSHHPPAA+ H  S +GW   QE T++SKFRGKYL+I+P+G  H  F+KSNNHY+W+KVT+TVHNIIVGKLWID  GE+D+ NH+TG+ CHL +  YSYFS++ AR+VTGV+TDKDG   YVL+GTWD   + ++V+   +   N      + V++T  A  LW +   PE    MY FT  AL LNE E+ VAPTDSR RPDQRLME G WDEA
Sbjct:  326 DGTTSLDEQSLASNPESPQSQEVVPVRKRRTRIPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPISMLQRLSEDLEYSELLDRGAKCQSSLEQLCYVAAFTVSSYSTTVHRTGKPFNPLLGETFELDRLQESGYRSLCEQVSHHPPAAAHHVISERGWTLRQEITVASKFRGKYLSIMPLGSIHCIFDKSNNHYSWKKVTTTVHNIIVGKLWIDQSGEIDVINHRTGDRCHLKFAPYSYFSRDVARKVTGVVTDKDGKAHYVLSGTWDEKMECSRVMQSSRGGENGTEGRQKTVYQTLKARELWRKNPLPEGAENMYYFTQLALTLNEQEDGVAPTDSRRRPDQRLMEQGMWDEA 683          

HSP 2 Score: 147.902 bits (372), Expect = 5.419e-36
Identity = 71/121 (58.68%), Postives = 87/121 (71.90%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSL 442
            D +KG+L+KWTNYIKGYQ+RWFVLSNGLLSYYR + E+ HTCRGTINL+T+ I  +DS + VISN   QT+HLKA SE E  +W+TAL LAK  A+ + +A  DDS  E     P  G  L
Sbjct:   13 DTYKGWLFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMGHTCRGTINLATANIAVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKAKAVRM-QAESDDSGDECSTSPPSAGQGL 132          

HSP 3 Score: 66.2402 bits (160), Expect = 1.589e-10
Identity = 45/129 (34.88%), Postives = 71/129 (55.04%), Query Frame = 2
Query:  773 GPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLP 1159
            G   D + +  E+   F + + A +N+C +F   A     ++QK L  ER+QR+RLE+ +E+LAKQ   LE +A + +  +  + S P  + D K       D ASDD D+E F+DA ED   F +++P
Sbjct:  181 GDTSDKIRQVTERATLFRITSNAMINACRDFLALAQAHSKRWQKALQAERDQRVRLEETLEQLAKQHNHLE-RAFRGATVLPASPSNP--TADSKGSGPGKGD-ASDDDDNE-FFDACEDVQEF-ITIP 303          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: osbp (oxysterol binding protein [Source:ZFIN;Acc:ZDB-GENE-090312-18])

HSP 1 Score: 466.077 bits (1198), Expect = 1.343e-151
Identity = 242/423 (57.21%), Postives = 298/423 (70.45%), Query Frame = 2
Query: 1496 ELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEH---KPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            +LK A S  SL  ++  K  + RR +I  +PN S+NLW IMKNCIGK+LSKIP+PVNFNEPLSM+QRLTED EY D LD AA+C  SLEQL +VAAF+VSSYSTT  RTGKPFNPLLGETFE DR ++ G+RS+ EQVSHHPPAA+ H +S +GW+ WQE T+SSKFRGKYL+IIP+G  H  F  S NHYTW+KVT+TVHNIIVG+LWID  G++DI NH TG+ C L + AYSYFS++  R+V+GV+ D +G   Y+L+GTWD   + AK++         +   + V++T PA+ LW R   PE +  MY FT  AL LNE EE VAPTDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR RE E+            +H   +P+WF    D  T+  + +Y G YWETK    W
Sbjct:  314 DLKHASSSSSLGQEMVVK--KQRRARIPDKPNYSLNLWSIMKNCIGKDLSKIPMPVNFNEPLSMLQRLTEDLEYFDLLDKAAKCESSLEQLCYVAAFSVSSYSTTVYRTGKPFNPLLGETFELDRLEECGYRSICEQVSHHPPAAAHHVDSRRGWRLWQEITVSSKFRGKYLSIIPLGTIHCEFPSSGNHYTWKKVTTTVHNIIVGRLWIDQSGDIDIVNHHTGDKCQLKFIAYSYFSRDIPRKVSGVVMDAEGNAHYILSGTWDEKMEYAKIVQSSKGSSGSEGRQKTVYQTQPAKHLWKRYPLPENSDNMYYFTELALTLNETEEGVAPTDSRLRPDQRLMENGKWDEANAEKQRLEEKQRLVRRRREAELASAAEPNGDAGRKHQSYRPMWFERKEDPFTREVSCVYRGGYWETKEKQEW 734          

HSP 2 Score: 152.14 bits (383), Expect = 3.502e-38
Identity = 70/109 (64.22%), Postives = 86/109 (78.90%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSE 406
            D +KG+L+KWTNYIKGYQKRWFVLSNGLLSYYR + E++HTCRGTINL+ + I  +DS +IV+SN   QT+HLKA SE E  +W+TAL LAK  AI + +A  DDSD E
Sbjct:    1 DTYKGWLFKWTNYIKGYQKRWFVLSNGLLSYYRTQAEMAHTCRGTINLAGAYIDTEDSCNIVVSNGGTQTYHLKASSEVERQRWVTALELAKAKAIRMMQAESDDSDDE 109          

HSP 3 Score: 55.0694 bits (131), Expect = 6.957e-8
Identity = 29/72 (40.28%), Postives = 44/72 (61.11%), Query Frame = 2
Query:  782 PDLMHKFK---EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEK 988
            P+   K K   E+   F + + A +N+C +F  +A     K+QK +  EREQRLRLE+ +E+LAKQ  +LE+
Sbjct:  162 PEGSEKLKAVNERATLFRITSNAMINACHDFLEQAQSQGKKWQKTVQYEREQRLRLEETLEQLAKQHNSLER 233          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: osbpl6 (oxysterol binding protein-like 6 [Source:ZFIN;Acc:ZDB-GENE-070912-206])

HSP 1 Score: 244.588 bits (623), Expect = 3.678e-68
Identity = 141/365 (38.63%), Postives = 209/365 (57.26%), Query Frame = 2
Query: 1469 VSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRT-GKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGET-CHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHF----QRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPE----ENVAPTDSRLRPDQRLMETGFWDEA 2533
            +S D  + +  K+ QS  + + + E +  R            SI LW I++  IGK+LSK+ +PV  NEPL+++QRL E+ EYSD LD AA+  D  +++  VA F VS+Y++T +R  GKPFNP+LGET+E  R +D G+R +AEQVSHHPP +  HC+S K +  WQ+  + +KF GK + IIP+G  ++   K  + Y W KVTS +HNI+ G+ WI+++GE+ I N K+    C +N+   SY+S E A +V G + D++G   + L G W+       QR+                   A  +W     P+     Y FT FA+ELNE +     ++ PTD+R RPDQR +E G  + A
Sbjct:  490 ISEDTGSRASFKSQQSNGAFTNR-EFQTGRRMHLPAPAADTSSIGLWDILRKNIGKDLSKVAMPVELNEPLNVLQRLCEEMEYSDLLDRAADTDDPAQRMVLVATFAVSTYASTISRAGGKPFNPVLGETYECIR-EDRGFRFIAEQVSHHPPISVCHCDS-KKFVLWQDVRLKNKFWGKSMEIIPVGTVNVKLLKYGDEYEWNKVTSCIHNIMGGQRWIEHYGEVIIKNKKSNVCQCKINFIKASYWSSE-ANQVQGTVMDQNGRVLHRLFGKWNEGMYCGAQRS-------------------ARCIWRPGSLPQDHELYYGFTRFAIELNELDPVLRPHLPPTDTRFRPDQRFLEEGNMESA 831          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: osbpl1a (oxysterol binding protein-like 1A [Source:ZFIN;Acc:ZDB-GENE-050208-657])

HSP 1 Score: 195.667 bits (496), Expect = 8.504e-55
Identity = 158/430 (36.74%), Postives = 219/430 (50.93%), Query Frame = 2
Query: 1583 RPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSS------KFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGV-ITDKDGVTKYVLNGTW--------------------DSHFQRAKVLHIRKDKNNQQVFETGPAE------------------TLWSRRFPPEYTSEMYNFTNFALELNEPEEN----VAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETK 2725
            R N SI  W  ++ CIG ELSKI +PV FNEPLS +QRL E  E++  +  A   + S+E++  VAAF VS+ ++   RTGKPFNPLLGET+E  R +DLG+R ++EQVSHHPP ++   E +      ++F          KF GK +   P GI  L   +    YTW   +  VHN+IVGKLWI+ +G ++I NHK G    L+++A +   ++  R ++   I  K  V+  V+ G W                     S  + AK++       + Q  E   A+                   LW     P  +++MYNFT+FAL LNE E+     +APTD RLRPD + ME G  D A +EK RLEEKQR  R+ R K             EE    WF    +  T T   IY+GNY++ +
Sbjct:   11 RSNFSI--WSFLRRCIGMELSKITMPVIFNEPLSFLQRLCEYMEHTYLIHKANTSSSSIERMQCVAAFAVSAVASNWERTGKPFNPLLGETYEMVR-EDLGFRLVSEQVSHHPPISAFFAEGLN-----KDFVFHGSVYPKLKFWGKSVEAEPRGIITLELPRYGEAYTWTNPSCCVHNVIVGKLWIEQYGTVEITNHKRGFKASLSFRARNITKRKSRRPLSAFRIDSKKKVS--VIYGKWTEVLWSVDPGIYEVGKKNDKKSTEKLAKLVAAESSGPSGQQAEADEADDIPTPEVPETVTVLPGSKLLWRVHPRPANSTQMYNFTSFALTLNEMEKEMEGLLAPTDCRLRPDMKAMEQGDIDLAGEEKNRLEEKQRAARKQRAKTE-----------EEWHTRWFRQDLNPHTSTADWIYAGNYFDRR 419          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: osbpl6 (oxysterol binding protein-like 6 [Source:ZFIN;Acc:ZDB-GENE-070912-206])

HSP 1 Score: 119.013 bits (297), Expect = 2.884e-28
Identity = 76/161 (47.20%), Postives = 111/161 (68.94%), Query Frame = 2
Query: 1577 TPRPNMS-INLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTG-KPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEK 2053
             P P+ S ++LW I++N IGK+L+K+ +PV  NEPL+ +QRL E+ EYS+ L+ A++  D  +++   AAF VS+Y+ T  R+G KPFNP+LGET+E  R +D G+R +AEQVSHHPP ++ HCES K +  WQ+    +KF GK + I+P+G   L   K
Sbjct:  349 APCPDTSGVSLWNILRNNIGKDLAKVSMPVELNEPLNTLQRLCEELEYSELLEQASDTEDPAQRMVLAAAFAVSAYAPTYYRSGNKPFNPVLGETYECIR-EDKGFRFVAEQVSHHPPISACHCES-KTFVLWQDVRWKNKFWGKSMEILPLGTVSLNLPK 507          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: OSBPL8 (oxysterol binding protein like 8 [Source:HGNC Symbol;Acc:HGNC:16396])

HSP 1 Score: 83.5741 bits (205), Expect = 1.223e-16
Identity = 63/236 (26.69%), Postives = 111/236 (47.03%), Query Frame = 2
Query: 1604 LWGIMKNCI-GKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLD-AAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFE---FDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMS-SKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYF-SKEPARRVTGVITDKDGVTKYVLNGTWD 2290
            +WG++K    G +LS++ +P    EP S + +L++ + ++D L   AA   ++  ++  V  + +S +        KP+NP+LGETF    +  + D     +AEQVSHHPP ++++  + K   C      + SKF G  L+ I  G   LT  +    Y      +    I+ G + ++  G++ I   KTG +  + +K        +   +++G I     V    L G WD
Sbjct:  295 IWGLIKQLRPGMDLSRVVLPTFVLEPRSFLDKLSDYYYHADLLSHRAALEENAYGRMKQVVQWYLSGFYKKPQGPKKPYNPILGETFRCMWYHPSTDSKTYYIAEQVSHHPPVSAIYVSNRKDGFCISATVFARSKFYGNSLSAILDGTVRLTLLERGEEYVITMPYAHCKGILYGTMTLELGGKIGIECQKTGYSASIEFKLRPLLGGNDCVNQISGKIQLGKEVL-CTLEGHWD 529          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: OSH2 (Member of an oxysterol-binding protein family with seven members; in S. cerevisiae, family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability; contains FFAT motif; interacts with ER anchor Scs2p at patches at the plasma membrane and at the nuclear envelope; regulated by sterol binding; OSH2 has a paralog, SWH1, that arose from the whole genome duplication [Source:SGD;Acc:S000002177])

HSP 1 Score: 243.432 bits (620), Expect = 6.244e-67
Identity = 157/396 (39.65%), Postives = 222/396 (56.06%), Query Frame = 2
Query: 1583 RPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNH----YTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKV-----LHIRKDKNNQQVFETGPAE-----TLWSRRFPPEYTSEMYNFTNFALELNEPEEN----VAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYW 2716
            RP +S  LW ++K+ +GK+++++ +PV FNEP S++QR+ ED EYS+ LD AA   DS  +  +VAAFT SSY++TT R  KPFNPLLGETFE+ R D   +R   EQVSHHPP ++   ES + W  W E  + +KF G+   +  +G+ H+    ++N     YTW+K  +TV  I++G   +DNHGE+++ NH TG+ C L +KA  + S   A  +TG + +K     ++L G W+      KV     L + K +        GP +      +W     PE   E +N T FA+ LN P+ +    + PTD+RLRPDQR ME G +DEA  EK R+EEKQR  RR RE+              E+ P WF       TK     Y+G YW
Sbjct:  893 RPKIS--LWAVLKSMVGKDMTRMTLPVTFNEPTSLLQRVAEDLEYSELLDQAATFEDSTLRTLYVAAFTASSYASTTKRVAKPFNPLLGETFEYSRPDK-QYRFFTEQVSHHPPISATWTESPR-WDFWGESFVDTKFNGRSFNVKHLGLWHIKLRPNDNEKEELYTWKKPNNTVIGILIGNPQVDNHGEVNVVNHTTGDHCKLYFKARGWRS-SGAYEITGEVYNKKKQKVWILGGHWNEAIFAKKVVKDGDLSLEKTRTAASAG-NGPTDDGTKFLIWKANDRPE---EPFNLTPFAITLNAPQPHLLPWLPPTDTRLRPDQRAMEDGRYDEAGDEKFRVEEKQRAARRKREENNL-----------EYHPQWFVRDTHPITKAKYWRYTGKYW 1268          

HSP 2 Score: 65.0846 bits (157), Expect = 5.245e-11
Identity = 39/108 (36.11%), Postives = 60/108 (55.56%), Query Frame = 2
Query:   71 SRPDCHKGYLYKWTNYIKGYQKRWFVLS-NGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDS----FSIVISNDSNQTFHLKAQSESETNQWL----TALHLAKDTAI 367
            S+P  +KG+L KWTN+  GY+ RWF+LS +G LSYY++++ V    RGT+ +ST  +    S    F ++        + LK     ET +W+    +A+  AKD  I
Sbjct:  287 SKPPTYKGFLKKWTNFAHGYKLRWFILSGDGNLSYYKDQSHVDRP-RGTLKVSTCRLHIDSSEKLNFELLGGITGTTRWRLKGNHPIETTRWVNAIQSAIRFAKDKEI 393          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: SWH1 (Protein similar to mammalian oxysterol-binding protein; contains ankyrin repeats and FFAT motif; interacts with ER anchor Scs2p at the nucleus-vacuole junction; regulated by sterol binding; SWH1 has a paralog, OSH2, that arose from the whole genome duplication [Source:SGD;Acc:S000000081])

HSP 1 Score: 236.113 bits (601), Expect = 1.364e-64
Identity = 155/393 (39.44%), Postives = 225/393 (57.25%), Query Frame = 2
Query: 1598 INLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNN------HYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVL----HIRKDKNNQQVFETGPAETLWSRRF---PPEYTSEMYNFTNFALELNEPEEN----VAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETK 2725
            I LW ++K+ +G++L+K+ +PV+FNEP S++QR++ED EYS  LD AA   DS  ++ +VAAFT S Y++TTNR  KPFNPLLGETFE+ RTD   +R   EQVSHHPP ++   ES K W  + E  + S F G+  A+  +G+ ++T    +N       Y+W+K  +TV  I++GK  +DN G++ + NH TG+ C L+YKA+ + S   A  V G + +KD    +VL G W+      KV      +  D+       TG  +   S+       E  S  +N T+FAL LN    +    +APTDSRLRPDQR ME G +D+A  EK R+E KQR  ++ RE++            EE++P WF       TK+    ++G YW  +
Sbjct:  798 IGLWSVLKSMVGQDLTKLTLPVSFNEPTSLLQRVSEDIEYSHILDQAATFEDSSLRMLYVAAFTASMYASTTNRVSKPFNPLLGETFEYARTDG-QYRFFTEQVSHHPPISATWTESPK-WDFYGECNVDSSFNGRTFAVQHLGLWYITIRPDHNISVPEETYSWKKPNNTVIGILMGKPQVDNSGDVKVTNHTTGDYCMLHYKAHGWTSA-GAYEVRGEVFNKDDKKLWVLGGHWNDSIYGKKVTARGGELTLDRIKTANSATGGPKLDGSKFLIWKANERPSVPFNLTSFALTLNALPPHLIPYLAPTDSRLRPDQRAMENGEYDKAAAEKHRVEVKQRAAKKEREQKG-----------EEYRPKWFVQEEHPVTKSLYWKFNGEYWNKR 1176          

HSP 2 Score: 80.1073 bits (196), Expect = 1.301e-15
Identity = 42/106 (39.62%), Postives = 63/106 (59.43%), Query Frame = 2
Query:   83 CHKGYLYKWTNYIKGYQKRWFVL-SNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDS----FSIVISNDSNQTFHLKAQSESETNQWL----TALHLAKDTAISL 373
             +KGYL KWTN+ +GY+ RWF+L S+G LSYY ++ +  + CRG++N+S+  +    S    F I+  N+    +HLK     ETN+W+     A+  AKD  I L
Sbjct:  283 TYKGYLKKWTNFAQGYKLRWFILSSDGKLSYYIDQADTKNACRGSLNMSSCSLHLDSSEKLKFEIIGGNNGVIRWHLKGNHPIETNRWVWAIQGAIRYAKDREILL 388          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: OSH3 (Member of an oxysterol-binding protein family; this family has seven members in S. cerevisiae; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability; contains FFAT motif; interacts with ER anchor Scs2p at patches at the plasma membrane; regulated by sterol binding [Source:SGD;Acc:S000001115])

HSP 1 Score: 158.303 bits (399), Expect = 6.147e-40
Identity = 105/329 (31.91%), Postives = 159/329 (48.33%), Query Frame = 2
Query: 1562 RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFS-KEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEE----NVAPTDSRLRPDQRLMETGFWDEA 2533
            RR  I        +L   ++  +GK+LS I +PV  NEP+S++Q ++E FEY+  L  A +  D +  +S  A   +S Y   T    KPFNPLL ETFE  R +D+G+R ++E+VSH PP  +   E +  W+C    T S KF GK + +   GI  L F+ +   + W + T+ + N+I G+ +++   E ++++ K G+  H+ +     FS +    +V+ +        K  L G W                  Q +      ET+W          + Y FT F   LNE  E    N+ PTDSRLRPD R  E G  D+A
Sbjct:  629 RRNDIPEAAASPPSLLSFLRKNVGKDLSSIAMPVTSNEPISILQLISETFEYAPLLTKATQRPDPITFVSAFAISFLSIYRDKTRTLRKPFNPLLAETFELIR-EDMGFRLISEKVSHRPPVFAFFAEHL-DWECSYTVTPSQKFWGKSIELNNEGILRLKFKTTGELFEWTQPTTILKNLIAGERYMEPVNEFEVHSSK-GDKSHILFDKAGMFSGRSEGFKVSIIPPPSSNRKKETLAGKW-----------------TQSLANETTHETIWEVGDLVSNPKKKYGFTKFTANLNEITEIEKGNLPPTDSRLRPDIRAYEEGNVDKA 937          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: OSH7 (Oxysterol-binding protein; part of family with seven members in S. cerevisiae; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability; OSH7 has a paralog, OSH6, that arose from the whole genome duplication [Source:SGD;Acc:S000001043])

HSP 1 Score: 74.7146 bits (182), Expect = 1.970e-14
Identity = 66/240 (27.50%), Postives = 103/240 (42.92%), Query Frame = 2
Query: 1613 IMKNCI-----GKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFE--FDRTDDLGWRSLAEQVSHHPP-AASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTF---EKSNN---HYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWD 2290
            I+ N I     G +LS+I +P    E  SM++R+T   ++ D L  A    D L++   V A+ ++ +        KP NP+LGE F   +D  +      +AEQ SHHPP +A  +       +        SKF G   A +  G+  L F   + +N     YT  +       I+ GK+ I+    M I   K      + +K   + S      + G I D DG   Y ++G W+
Sbjct:   50 ILLNIISQLKPGCDLSRITLPTFILEKKSMLERITNQLQFPDVLLEAHSNKDGLQRFVKVVAWYLAGWHIGPRAVKKPLNPILGEHFTAYWDLPNKQQAFYIAEQTSHHPPESAYFYMIPESNIRVDGVVVPKSKFLGNSSAAMMEGLTVLQFLDIKDANGKPEKYTLSQPNVYARGILFGKMRIELGDHMVIMGPKY--QVDIEFKTKGFISGT-YDAIEGTIKDYDGKEYYQISGKWN 286          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: OSH6 (Member of an oxysterol-binding protein family; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability; GFP-fusion protein localizes to the cell periphery; overexpression extends lifespan by promoting vacuolar fusion; OSH6 has a paralog, OSH7, that arose from the whole genome duplication [Source:SGD;Acc:S000001711])

HSP 1 Score: 66.6254 bits (161), Expect = 8.845e-12
Identity = 59/243 (24.28%), Postives = 103/243 (42.39%), Query Frame = 2
Query: 1589 NMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFE--FDRTDDLGWRSLAEQVSHHPP-AASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFE--KSNN----HYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWD 2290
            N+ +N+   ++   G +L++I +P    E  SM++R+T   ++ + L  A    D L++  +V  + ++ +        KP NP+LGE F   +D  +      ++EQ SHHPP  A  +       +        S+F G   A +  G   L F   K  N     Y   +    V  I+ GK+ I+    M I +           K Y + + +    + G + D DG   Y ++G W+
Sbjct:   49 NIILNIISQLRP--GCDLTRITLPTFILEKKSMLERVTNQLQFPEFLLQAHSEKDPLKRFLYVMKWYLAGWHIAPKAVKKPLNPVLGEYFTAYWDLPNKQQAYYISEQTSHHPPECAYFYMIPESSIRVDGVVIPKSRFLGNSSAAMMDGSTVLQFLDIKDGNGKPEKYVLTQPNVYVRGILFGKMRIELGDHMIIKSPNFQADIEFKTKGYVFGTYD---AIEGTVKDYDGNAYYEISGKWN 286          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO44125 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7RWH9])

HSP 1 Score: 485.723 bits (1249), Expect = 4.800e-159
Identity = 243/410 (59.27%), Postives = 299/410 (72.93%), Query Frame = 2
Query: 1538 VEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVF-------ETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT 2746
            +++ P +  RT I PRP++SINLW I+KNCIGKEL+KIP+PVNFNEPLSM+QR+TE+ EYS+ LD AA C  SLEQ+ +VAAFTVSSYSTT+NRT KPFNPLLGETFE DR++D GWRSLAEQVSHHPPA++ H E  K W  WQEF+ +SKFRGKYL IIP GIAHL F KS NHYTWRKVT+TVHNIIVGKLWID  GEMDI NH T E CHL Y AY+YF ++  R+VTGV+TD     +YV++GTWD+  + AKV++++      Q         +T P   LW R  PP    +MY  T+FA+ LNEPE++VAPTDSR RPDQRLME   W+EAN+EK R+E++QR +RR RE+E  +  S G+   E + P WF  + DE T    H+Y G YWE K    WG+
Sbjct:  318 IDRTPLKTYRTSIPPRPDISINLWSILKNCIGKELTKIPMPVNFNEPLSMLQRITEELEYSEVLDKAAACTSSLEQMCYVAAFTVSSYSTTSNRTNKPFNPLLGETFECDRSEDYGWRSLAEQVSHHPPASAFHAEH-KDWIFWQEFSATSKFRGKYLQIIPQGIAHLKFIKSGNHYTWRKVTTTVHNIIVGKLWIDQSGEMDIANHTTNENCHLKYDAYNYFGRDTPRKVTGVVTDSTKTVRYVISGTWDNKIEAAKVVYLKSPGVKAQGSSSQKGQPQTLPPVVLWKRVLPPPENEKMYAMTSFAITLNEPEDHVAPTDSRFRPDQRLMENCHWEEANQEKLRIEDQQRTRRRKREQEAAEALSDGI-FYEGYSPSWFEKIVDELTDMPMHVYKGGYWEAKEKKDWGS 725          

HSP 2 Score: 141.739 bits (356), Expect = 1.076e-34
Identity = 75/147 (51.02%), Postives = 94/147 (63.95%), Query Frame = 2
Query:   77 PDCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDI 517
            PD  +G+L KWTNYIKGYQ+RWFVLSNGLLSYYRN+ E++HTCRGTINL+ + I  +D+ S VISN   Q FHL+A +E E  +W+TAL LAK  AI + E     SD E    S             H++NI P+    SS  SD+
Sbjct:    8 PDHFRGWLLKWTNYIKGYQRRWFVLSNGLLSYYRNQAEMAHTCRGTINLAGAFIDTEDACSFVISNGGTQVFHLRASTEVERQRWVTALELAKAKAIKMLE-----SDEEEEGAS------------DHAENIKPL----SSKLSDL 133          

HSP 3 Score: 53.9138 bits (128), Expect = 3.048e-7
Identity = 31/82 (37.80%), Postives = 46/82 (56.10%), Query Frame = 2
Query:  788 LMHKFK---EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLN 1024
            L +K K   EK   F + + A +++C+EF   A     K+QK L  ER QR+ LE+ VE L +Q   LE+K  +QS + G+ 
Sbjct:  163 LFNKLKAVNEKATLFRITSNAMISACAEFLELAQAQEKKWQKSLQYERNQRINLEETVEVLGRQHYLLERKCQRQSGTPGMG 244          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO41441 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7S4A2])

HSP 1 Score: 268.47 bits (685), Expect = 9.788e-81
Identity = 151/398 (37.94%), Postives = 235/398 (59.05%), Query Frame = 2
Query: 1556 RVRRTKI-TPRPNMSI-NLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDK--NNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENV-APTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATG 2734
            R RRT +   R   SI +L   MK  +GK+++K+ +PV+FNEP+S +QRL+ED EY+D L+ A  C ++L +L+ VAAF  S+Y+T  +R  KPFNPLLGETFE+   D+ G+  +AEQVSHHPP ++LH ES   W  WQE+ + +KFRG++  +IP G  HL F+ + +H++W+K  +T+HNI+VG L++D  G+M + NH T ETC +++       ++  +++ G + D +G  +YV+ G+WD   +      I +D   N+  +        LW+    P+ + +MY FT F ++LN+P+  V  PTD R RPD R +E G  D +       E+ + E+++   +     K +   P  + K  WF P  D  T+T  ++Y G YW     G
Sbjct:   38 RPRRTALPATRERSSIRSLISFMKTVVGKDMTKVTMPVHFNEPVSFLQRLSEDLEYADILNRACVCKNNLVKLAHVAAFASSTYATVLSRFWKPFNPLLGETFEYIDNDN-GFALIAEQVSHHPPISALHAES-SHWVFWQEYKLDTKFRGQFFKVIPTGHCHLKFKTNGHHFSWKKPVTTIHNILVGSLYVDQEGDMVVTNHTTKETCTVHFMPVRKV-QDNFKKLKGEVKDPEGKVRYVIEGSWDKSLE-----CIPQDTGFNDDSI-------DLWTAVARPDDSYKMYAFTRFTIQLNDPDYGVTCPTDCRNRPDIRQLELGKIDSS-----AAEKHRLEEKQRASRRERDTKGEAWTPRYDKKDRWFVPKEDPYTRTFDYVYRGGYWTNIMDG 415          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO39767 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7S940])

HSP 1 Score: 221.09 bits (562), Expect = 3.930e-64
Identity = 154/399 (38.60%), Postives = 209/399 (52.38%), Query Frame = 2
Query: 1598 INLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTM------SSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQ--RAKVLHIRKD-KNNQQVFETGPAE------------TLWSRRFPPEYTSEMYNFTNFALELNE----PEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWE 2719
             ++W ++K CIGK+LS+I +PV FNEPL+ +QR+TE  EYS+ L  AA   D   +L                + GKPFNPLLGET+E  R    G+R +AEQVSHHPP  +L CES        +F          KF GK + + P G+  L F K N  YTW  V S VHNIIVG+LWI+ +G+++I +  +G+   +++K   +F KE  +    +   +D   +Y L G W       R++    RK  K  +Q FE                 TLW+    P ++ EMYNFT+FA++LNE     +E + PTDSRLRPD R +E G  D A  EK RLEEKQR  RR R+K             +E  P WF    +  T     +YSG YW+
Sbjct:    7 FSVWTVLKQCIGKDLSRITMPVIFNEPLTFLQRITEYMEYSELLHTAASQDDPTRRL----------------QVGKPFNPLLGETYELVRP---GFRLVAEQVSHHPPITALQCES-------DDFIFHVTVQPKLKFWGKGVEVQPKGMVTLKFPKHNEVYTWNNVNSCVHNIIVGQLWIEQYGQIEISSLSSGDRATIHFKPAGWFGKELNKVEATIHCAQDKKKRYTLKGDWTDKITCYRSETHVTRKQSKRGKQDFEIASTSSSETSLELHSPVTLWTCSHRPPHSKEMYNFTSFAMQLNELLPRDKETLPPTDSRLRPDCRALENGDLDRATAEKIRLEEKQRAARRERQKSD-----------QEWAPRWFKEEMNPYTGQMDWLYSGGYWD 368          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO35914 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7SK18])

HSP 1 Score: 84.3445 bits (207), Expect = 1.045e-16
Identity = 65/243 (26.75%), Postives = 114/243 (46.91%), Query Frame = 2
Query: 1589 NMSINLWGIMKNCI-GKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRS--LAEQVSHHPPAASLHCESIK-GWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKE-PARRVTG-VITDKDGVTKYVLNGTWDSHF 2299
            N SI LW ++K    G +LS++ +P    EP S + +L++ + ++D L  AA   +   ++  V  + +S +        KP+NP++GE F        G R+  ++EQVSHHPP ++ +  + + G+         SKF G   + I  G A L   +    YT     +    I++G L ++  G + I   KTG    + +K   ++ K   +  + G +I  K+ + K  + G WD   
Sbjct:  240 NKSI-LWALLKQVKPGMDLSRVTLPTFILEPRSFLDKLSDFYYHTDILSRAACEENPYSRMKEVIRWYLSGFYKKPKGLKKPYNPIIGEMFRCYWQHPQGSRTFFVSEQVSHHPPVSAFYVSNRQDGFVINGAILAKSKFYGNSSSAILDGAATLALLRFGEEYTMTMPYAHCKGILIGTLTMELGGTVTINCEKTGYKAEIEFKLKPFWKKSGESNYIAGKIIMGKETLCK--IEGKWDGEI 479          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO37291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG84])

HSP 1 Score: 77.411 bits (189), Expect = 1.181e-14
Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 2
Query:   89 KGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIR--KQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAK 355
            +G L+KWTNY+ G+Q R+FVL  G+LSYY+++ EV    RG+I +S   I     D+  I +     Q  +L+A + +E  QW+ A+  AK
Sbjct:    2 EGTLWKWTNYLSGWQPRYFVLEVGVLSYYKSQEEVGLGSRGSIKMSCCEISVHPTDTVRIDLRIPPEQYIYLRAATPAERQQWVVAMGTAK 92          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: si:ch211-106a19.1 (oxysterol-binding protein 2 [Source:NCBI gene;Acc:101175572])

HSP 1 Score: 454.521 bits (1168), Expect = 3.235e-148
Identity = 235/430 (54.65%), Postives = 295/430 (68.60%), Query Frame = 2
Query: 1487 TFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLP-PI------EEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            T +  +++Q   ++  +    P++ RRT++  +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY + LD AA C  SLEQ+  VAAF+VSSYSTT +RT KPFNPLLGET+E DR ++ G+RSL EQVSHHPPAA+ H  S +GW  WQE T++SKFRGKYL+I+P+G  HL F  S NHY WRKVTSTVHNIIVGKLWID  G+++I NH+T E C L +  YSYFS++  R+VTGV+ D  G   Y+L+GTWD   + AK+L         +   + V++T   + LW +   PE    MY F++ AL LNEPEE VA TDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR R         +G P P+      E ++P+WF    D  T  T+ +Y G YWETK +  W
Sbjct:  179 TVTASESSQGTAAVKWRSAPAPSK-RRTRVPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAARCESSLEQMCLVAAFSVSSYSTTVHRTAKPFNPLLGETYELDRLEEFGYRSLCEQVSHHPPAAAHHVISQRGWTLWQEITIASKFRGKYLSIMPLGTIHLQFHSSGNHYVWRKVTSTVHNIIVGKLWIDQSGDIEIVNHRTKEACQLKFSPYSYFSRDVPRKVTGVVADSSGQAHYILSGTWDDKMESAKILQSSRGGSGSEGKQKTVYQTLSPKLLWKKYPLPENAENMYYFSSLALTLNEPEEGVAVTDSRLRPDQRLMEDGRWDEANAEKQRLEEKQRAVRRRR---------EGCPGPLCCASEYEGYQPLWFHQRRDSLTGETSFVYKGGYWETKESQDW 598          

HSP 2 Score: 60.077 bits (144), Expect = 8.886e-9
Identity = 37/113 (32.74%), Postives = 60/113 (53.10%), Query Frame = 2
Query:  806 EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVF 1144
            E+   F + + A +N+C +F + A     ++Q+ L  EREQR  LE+ +E+LAKQ  +LE+      E+  L +S P      K       + ASD+ +D  ++DA+ED   F
Sbjct:   74 ERATLFRITSNAMINACRDFLDLAETHSRRWQRALQYEREQRTHLEETIEQLAKQHNSLER---AWREAPTLASSSPSAPTTNKG------EPASDEDEDTEYFDAMEDSPAF 177          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: si:ch211-106a19.1 (oxysterol-binding protein 2 [Source:NCBI gene;Acc:101175572])

HSP 1 Score: 458.373 bits (1178), Expect = 3.524e-148
Identity = 234/405 (57.78%), Postives = 286/405 (70.62%), Query Frame = 2
Query: 1541 EKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            E +P R RRT++  +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY + LD AA C  SLEQ+  VAAF+VSSYSTT +RT KPFNPLLGET+E DR ++ G+RSL EQVSHHPPAA+ H  S +GW  WQE T++SKFRGKYL+I+P+G  HL F  S NHY WRKVTSTVHNIIVGKLWID  G+++I NH+T E C L +  YSYFS++  R+VTGV+ D  G   Y+L+GTWD   + AK+L         +   + V++T   + LW +   PE    MY F++ AL LNEPEE VA TDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR RE E  +   +     E ++P+WF    D  T  T+ +Y G YWETK +  W
Sbjct:  310 ELQPRRERRTRVPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAARCESSLEQMCLVAAFSVSSYSTTVHRTAKPFNPLLGETYELDRLEEFGYRSLCEQVSHHPPAAAHHVISQRGWTLWQEITIASKFRGKYLSIMPLGTIHLQFHSSGNHYVWRKVTSTVHNIIVGKLWIDQSGDIEIVNHRTKEACQLKFSPYSYFSRDVPRKVTGVVADSSGQAHYILSGTWDDKMESAKILQSSRGGSGSEGKQKTVYQTLSPKLLWKKYPLPENAENMYYFSSLALTLNEPEEGVAVTDSRLRPDQRLMEDGRWDEANAEKQRLEEKQRAVRRRREAEASEALDE---EYEGYQPLWFHQRRDSLTGETSFVYKGGYWETKESQDW 711          

HSP 2 Score: 132.109 bits (331), Expect = 3.306e-31
Identity = 63/111 (56.76%), Postives = 85/111 (76.58%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAP 412
            D +KG+L+KWTNY+KGYQ+RWFVLSNGLLSYYR + E++HTCRGTINL+T+ I  +D+ +IV+S+   +T+HLKA +E E  +W+TAL LAK  AI +   + D S  E P
Sbjct:   16 DTYKGWLFKWTNYLKGYQRRWFVLSNGLLSYYRTQAEMAHTCRGTINLATAHIDTEDACNIVLSS-GGRTYHLKASTEVERQRWVTALELAKAKAIRM---MNDQSGDEEP 122          

HSP 3 Score: 62.3882 bits (150), Expect = 2.018e-9
Identity = 37/113 (32.74%), Postives = 61/113 (53.98%), Query Frame = 2
Query:  806 EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVF 1144
            E+   F + + A +N+C +F + A     ++Q+ L  EREQR  LE+ +E+LAKQ  +LE+      E+  L +S P            N ++ASD+ +D  ++DA+ED   F
Sbjct:  184 ERATLFRITSNAMINACRDFLDLAETHSRRWQRALQYEREQRTHLEETIEQLAKQHNSLER---AWREAPTLASSSPSERS--------NKEEASDEDEDTEYFDAMEDSPAF 285          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: si:ch211-106a19.1 (oxysterol-binding protein 2 [Source:NCBI gene;Acc:101175572])

HSP 1 Score: 457.988 bits (1177), Expect = 7.419e-148
Identity = 235/412 (57.04%), Postives = 287/412 (69.66%), Query Frame = 2
Query: 1541 EKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLH-----IRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQG-------LPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            E +P R RRT++  +PN S+NLW IMKNCIGKELSKIP+PVNFNEPLSM+QRLTED EY + LD AA C  SLEQ+  VAAF+VSSYSTT +RT KPFNPLLGET+E DR ++ G+RSL EQVSHHPPAA+ H  S +GW  WQE T++SKFRGKYL+I+P+G  HL F  S NHY WRKVTSTVHNIIVGKLWID  G+++I NH+T E C L +  YSYFS++  R+VTGV+ D  G   Y+L+GTWD   + AK+L         +   + V++T   + LW +   PE    MY F++ AL LNEPEE VA TDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR RE E  +   +G           E ++P+WF    D  T  T+ +Y G YWETK +  W
Sbjct:  321 ELQPRRERRTRVPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAARCESSLEQMCLVAAFSVSSYSTTVHRTAKPFNPLLGETYELDRLEEFGYRSLCEQVSHHPPAAAHHVISQRGWTLWQEITIASKFRGKYLSIMPLGTIHLQFHSSGNHYVWRKVTSTVHNIIVGKLWIDQSGDIEIVNHRTKEACQLKFSPYSYFSRDVPRKVTGVVADSSGQAHYILSGTWDDKMESAKILQSSRGGSGSEGKQKTVYQTLSPKLLWKKYPLPENAENMYYFSSLALTLNEPEEGVAVTDSRLRPDQRLMEDGRWDEANAEKQRLEEKQRAVRRRREAEASEALDEGNTCASSAGREYEGYQPLWFHQRRDSLTGETSFVYKGGYWETKESQDW 732          

HSP 2 Score: 132.88 bits (333), Expect = 2.571e-31
Identity = 63/111 (56.76%), Postives = 85/111 (76.58%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAP 412
            D +KG+L+KWTNY+KGYQ+RWFVLSNGLLSYYR + E++HTCRGTINL+T+ I  +D+ +IV+S+   +T+HLKA +E E  +W+TAL LAK  AI +   + D S  E P
Sbjct:   21 DTYKGWLFKWTNYLKGYQRRWFVLSNGLLSYYRTQAEMAHTCRGTINLATAHIDTEDACNIVLSS-GGRTYHLKASTEVERQRWVTALELAKAKAIRM---MNDQSGDEEP 127          

HSP 3 Score: 64.3142 bits (155), Expect = 5.887e-10
Identity = 39/113 (34.51%), Postives = 63/113 (55.75%), Query Frame = 2
Query:  806 EKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVF 1144
            E+   F + + A +N+C +F + A     ++Q+ L  EREQR  LE+ +E+LAKQ  +LE+      E+  L +S P  S    N    N ++ASD+ +D  ++DA+ED   F
Sbjct:  189 ERATLFRITSNAMINACRDFLDLAETHSRRWQRALQYEREQRTHLEETIEQLAKQHNSLER---AWREAPTLASSSP--SAPTTNKGESNKEEASDEDEDTEYFDAMEDSPAF 296          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: ENSORLT00000007524.2 (oxysterol-binding protein 1 [Source:NCBI gene;Acc:101155887])

HSP 1 Score: 443.736 bits (1140), Expect = 5.445e-142
Identity = 238/403 (59.06%), Postives = 292/403 (72.46%), Query Frame = 2
Query: 1550 PARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNN------QQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            P + RRT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEP+SM+QRL+ED EY + LD AA+  +SLEQ+ +VAAF VS+YSTT  RTGKPFNPLLGET+E DR  + G+RSL EQVSHHPPAA+ H  S +GW   QE T++SKFRGKYL+I+P+G  H  FEKSNNHYTW+KVT+TVHNIIVGKLWID  GE+D+ NH TG+ CHL +  YSYFS++ AR+VTGV+ DK G   YVL+GTWD   + ++V+   +   N      + V++T  A+ LW R   P+    MY FT  AL LNEPE+ VAPTDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR RE+E   ++S  +P  E +K  WF    D+ T    H+Y G YWE K  G W
Sbjct:  355 PLKKRRTRIPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPISMLQRLSEDLEYHELLDKAAKSHNSLEQMCYVAAFCVSAYSTTVYRTGKPFNPLLGETYELDRQRESGYRSLCEQVSHHPPAAAHHAISDRGWTLRQEITVASKFRGKYLSIMPLGTIHAIFEKSNNHYTWKKVTTTVHNIIVGKLWIDQSGEIDVVNHTTGDRCHLKFAPYSYFSRDVARKVTGVVMDKTGKAHYVLSGTWDEKMEFSRVMQSSRGGENGTEGRQKTVYQTLKAKELWRRNPLPDGAETMYYFTALALTLNEPEDGVAPTDSRLRPDQRLMEDGRWDEANAEKQRLEEKQRTARREREREALNQRSSSVPH-ENYKARWFEHTEDKITGEAVHVYKGGYWEAKDQGKW 756          

HSP 2 Score: 127.102 bits (318), Expect = 1.849e-29
Identity = 63/118 (53.39%), Postives = 82/118 (69.49%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLG 433
            D +KG+++KWTNYIKGYQ+RWFVLSNGLLSYYR + E+ HTCRGTINL+T+ I   D+ + +I+N   QT+HLKA  E E  +W+TAL LAK  A  +     D  D  +P  +P  G
Sbjct:   40 DTYKGWVFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMGHTCRGTINLATATITVDDACNFMITNGGAQTYHLKASCEVERQKWITALELAKAKAARMQAESDDSGDDFSPSAAPGQG 157          

HSP 3 Score: 66.2402 bits (160), Expect = 1.426e-10
Identity = 40/129 (31.01%), Postives = 70/129 (54.26%), Query Frame = 2
Query:  773 GPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLP 1159
            G   + + +  E+   F + + A +N+C +F + A     ++QK L  EREQR+RLE+ +E+LAKQ   LE+     +++          S D K++      + SDD D+E F+DA+E+   F +++P
Sbjct:  207 GEAGEKIRQVTERATLFRITSNAMINACRDFLSMAQTHSKRWQKALQAEREQRVRLEETLEQLAKQHNHLERAFRGAAQA--------NASADSKSISGPGKGEVSDDDDNE-FFDAMEEAPEF-ITVP 325          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: ENSORLT00000029679.1 (oxysterol-binding protein 1 [Source:NCBI gene;Acc:101155887])

HSP 1 Score: 441.425 bits (1134), Expect = 7.397e-141
Identity = 239/408 (58.58%), Postives = 294/408 (72.06%), Query Frame = 2
Query: 1550 PARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNN------QQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXS-----QGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 2740
            P + RRT+I  +PN S+NLW IMKNCIGKELSKIP+PVNFNEP+SM+QRL+ED EY + LD AA+  +SLEQ+ +VAAF VS+YSTT  RTGKPFNPLLGET+E DR  + G+RSL EQVSHHPPAA+ H  S +GW   QE T++SKFRGKYL+I+P+G  H  FEKSNNHYTW+KVT+TVHNIIVGKLWID  GE+D+ NH TG+ CHL +  YSYFS++ AR+VTGV+ DK G   YVL+GTWD   + ++V+   +   N      + V++T  A+ LW R   P+    MY FT  AL LNEPE+ VAPTDSRLRPDQRLME G WDEAN EK+RLEEKQR  RR RE+E   ++S     +G+P  E +K  WF    D+ T    H+Y G YWE K  G W
Sbjct:  371 PLKKRRTRIPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPISMLQRLSEDLEYHELLDKAAKSHNSLEQMCYVAAFCVSAYSTTVYRTGKPFNPLLGETYELDRQRESGYRSLCEQVSHHPPAAAHHAISDRGWTLRQEITVASKFRGKYLSIMPLGTIHAIFEKSNNHYTWKKVTTTVHNIIVGKLWIDQSGEIDVVNHTTGDRCHLKFAPYSYFSRDVARKVTGVVMDKTGKAHYVLSGTWDEKMEFSRVMQSSRGGENGTEGRQKTVYQTLKAKELWRRNPLPDGAETMYYFTALALTLNEPEDGVAPTDSRLRPDQRLMEDGRWDEANAEKQRLEEKQRTARREREREALNQRSSSTSEEGVPH-ENYKARWFEHTEDKITGEAVHVYKGGYWEAKDQGKW 777          

HSP 2 Score: 127.102 bits (318), Expect = 1.854e-29
Identity = 63/118 (53.39%), Postives = 82/118 (69.49%), Query Frame = 2
Query:   80 DCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLG 433
            D +KG+++KWTNYIKGYQ+RWFVLSNGLLSYYR + E+ HTCRGTINL+T+ I   D+ + +I+N   QT+HLKA  E E  +W+TAL LAK  A  +     D  D  +P  +P  G
Sbjct:   14 DTYKGWVFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMGHTCRGTINLATATITVDDACNFMITNGGAQTYHLKASCEVERQKWITALELAKAKAARMQAESDDSGDDFSPSAAPGQG 131          

HSP 3 Score: 54.6842 bits (130), Expect = 4.539e-7
Identity = 26/72 (36.11%), Postives = 43/72 (59.72%), Query Frame = 2
Query:  773 GPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEK 988
            G   + + +  E+   F + + A +N+C +F + A     ++QK L  EREQR+RLE+ +E+LAKQ   LE+
Sbjct:  181 GEAGEKIRQVTERATLFRITSNAMINACRDFLSMAQTHSKRWQKALQAEREQRVRLEETLEQLAKQHNHLER 252          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000023068.1 (SMESG000023068.1)

HSP 1 Score: 1660.2 bits (4298), Expect = 0.000e+0
Identity = 892/892 (100.00%), Postives = 892/892 (100.00%), Query Frame = 2
Query:   71 SRPDCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDISLYYKEFEQRLFDLNTSVSLVKKTSESXXXXXXXXXXXXSPHXXXXXXXXXXXXVDMKAHDQXXXXXXXXXXXXIDHRAPSHSSIGPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLPRPISQNNVKLEPKYTINXXXXXXXXXXXXKDNSKGNSIARVIVRSTEXXXXXXXXXXXXXXGDSSQFHRRTVSSGFPSQSLCPSNSLKANKNQCDNLGKDLYNVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT 2746
            SRPDCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDISLYYKEFEQRLFDLNTSVSLVKKTSESLLNVLKDVNKLNSPHIISNYSINSDSSVDMKAHDQSSLNSHSSVLLNIDHRAPSHSSIGPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLPRPISQNNVKLEPKYTINEYESCSSDSEYEKDNSKGNSIARVIVRSTENKSKSNHKNKINNIGDSSQFHRRTVSSGFPSQSLCPSNSLKANKNQCDNLGKDLYNVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEANKEKERLEEKQREKRRNREKEIEQRKSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT
Sbjct:    4 SRPDCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDISLYYKEFEQRLFDLNTSVSLVKKTSESLLNVLKDVNKLNSPHIISNYSINSDSSVDMKAHDQSSLNSHSSVLLNIDHRAPSHSSIGPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLPRPISQNNVKLEPKYTINEYESCSSDSEYEKDNSKGNSIARVIVRSTENKSKSNHKNKINNIGDSSQFHRRTVSSGFPSQSLCPSNSLKANKNQCDNLGKDLYNVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEANKEKERLEEKQREKRRNREKEIEQRKSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT 895          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000023068.1 (SMESG000023068.1)

HSP 1 Score: 1651.34 bits (4275), Expect = 0.000e+0
Identity = 890/892 (99.78%), Postives = 890/892 (99.78%), Query Frame = 2
Query:   71 SRPDCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDISLYYKEFEQRLFDLNTSVSLVKKTSESXXXXXXXXXXXXSPHXXXXXXXXXXXXVDMKAHDQXXXXXXXXXXXXIDHRAPSHSSIGPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLPRPISQNNVKLEPKYTINXXXXXXXXXXXXKDNSKGNSIARVIVRSTEXXXXXXXXXXXXXXGDSSQFHRRTVSSGFPSQSLCPSNSLKANKNQCDNLGKDLYNVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT 2746
            SRPDCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEA  DDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDISLYYKEFEQRLFDLNTSVSLVKKTSESLLNVLKDVNKLNSPHIISNYSINSDSSVDMKAHDQSSLNSHSSVLLNIDHRAPSHSSIGPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLPRPISQNNVKLEPKYTINEYESCSSDSEYEKDNSKGNSIARVIVRSTENKSKSNHKNKINNIGDSSQFHRRTVSSGFPSQSLCPSNSLKANKNQCDNLGKDLYNVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEANKEKERLEEKQREKRRNREKEIEQRKSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT
Sbjct:    4 SRPDCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEA--DDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDISLYYKEFEQRLFDLNTSVSLVKKTSESLLNVLKDVNKLNSPHIISNYSINSDSSVDMKAHDQSSLNSHSSVLLNIDHRAPSHSSIGPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIEDEHVFNVSLPRPISQNNVKLEPKYTINEYESCSSDSEYEKDNSKGNSIARVIVRSTENKSKSNHKNKINNIGDSSQFHRRTVSSGFPSQSLCPSNSLKANKNQCDNLGKDLYNVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEANKEKERLEEKQREKRRNREKEIEQRKSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGT 893          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000008795.1 (SMESG000008795.1)

HSP 1 Score: 491.5 bits (1264), Expect = 7.955e-160
Identity = 288/668 (43.11%), Postives = 392/668 (58.68%), Query Frame = 2
Query:  770 IGPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIE-DEHVFNVSLPRPISQNNVKLEPK---YTINXXXXXXXXXXXXKDNSKGNSIARVIVRSTEXXXXXXXXXXXXXXGDSSQFHRRTVSSGFPSQSLCPSNSLKANKN-QCDNLGKDLY----NVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFP-PEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWG 2743
            +G +   +   KE+   F V+  + + SC+ +A   T    K++K++++EREQR R+E MVE+LAKQ   LE +    S SV     L        N+       A +D  DE FYDA E  E VFNV+LP P     V L  +    ++        +     DN  G + +R             +      IGDSS      VS+    Q L  +  + A +N Q  N  K +     N+   ++  S      ++ + S  +  +  R RRT+I P+PN+++NLW ++KNCIGK+LSKIP+PVNF+EP+SM+QRL EDFEYS  LD AA C + +EQ+S+VAAFTVSSY+ T  R  KPFNPLLGET+E DRTDD GWR  AEQ+ HHPP+ ++HCES   W CW +F+MS+KFRGKY+ I P+G  HL F++S  HY W ++  T+HNIIVG++WIDNHGEMDI N  T + CHL+YK YS FS +  +RVTG ITDK      VLNGTWD   +   V+   +    +    T  +  L  +R+P P    + Y F++FA+ LNE EE++APTDSR RPDQ+LME G WDEANKEK RLEE+QR +R    K    ++      + E+KP+WF PV D E K+ T+ ++G YWE KA   W 
Sbjct:  171 VGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQI---SSSVQNQLKL--------NINPNQEPSADEDVSDEDFYDAFESQEGVFNVTLPSPEINLGVSLPSRCSELSLEYESDVEDELSDLSDNDSGLNCSR-------------NHTDNFFIGDSSTRGFEEVSNKRSLQRLKEARVISAKQNNQLKNRQKLITASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCES-NEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVQGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEF-----VYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWS 808          

HSP 2 Score: 130.954 bits (328), Expect = 8.526e-31
Identity = 69/129 (53.49%), Postives = 88/129 (68.22%), Query Frame = 2
Query:   89 KGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNI 475
            KGYLYKWTNY+KGYQKRWFVL NGLLSYYRN++E++  CRGTIN+  + I   DS S VIS+   QTFHLK+Q+ESE  +W +AL  A+  A  L +   D++DSE  L S  L N      + H ++I
Sbjct:   16 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSALLAAQKKAQDLLKGC-DNNDSE--LDSNELVNGFILKLNGHLEDI 141          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000046022.1 (SMESG000046022.1)

HSP 1 Score: 217.624 bits (553), Expect = 1.352e-58
Identity = 145/400 (36.25%), Postives = 219/400 (54.75%), Query Frame = 2
Query: 1562 RRTKI-TPRPNMS-INLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTG-KPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPA-----RRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEENVAP----TDSRLRPDQRLMETGFWDEAXXXXXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETK 2725
            RR K+   +P++S  +L  ++   IG++LSK+ +PV  NEPLS++Q L E+ EYSD LDAAA+ +DSLE+++++AAF VS+Y++T  R G KPFNP++GET+E+ R D  GW+ +AEQVSHHPP +  +CES + W  WQEF + +KF GK +  IP G   +  +K N    W KVT+ ++NI     +I+++G+M+        T +LN  A   F K  +       VTG I+  D   K  L G W                  + ++    A  +W     P+   + Y FT FA++LN  + ++A     TDSR RPDQR +E G   EA  EK ++EE QR      + ++              KP+WF     E +K+ ++ ++  YW  K
Sbjct:  502 RRDKLPAVQPDISQFSLINLLCKNIGRDLSKVRLPVILNEPLSVLQMLCEELEYSDLLDAAAKSSDSLERMNYIAAFAVSAYASTFYRAGTKPFNPIIGETYEYVRPDK-GWKFIAEQVSHHPPVSVCYCES-ENWSIWQEFRLKNKFWGKSIEAIPTGSLRVYLKKFNETVHWNKVTTCIYNIFGSNRYIEHYGDMNF-------TSNLNSSAKITFHKSNSWVHQKFEVTGTISCPDS-RKSQLFGKW-----------------TEGIYVGDNARCIWRPGAIPKDHDKYYGFTQFAIDLNNLDSDLAATLPKTDSRFRPDQRYLEMGLITEAEAEKTKIEELQRIALAKVKGDV------------NWKPLWFKK--HESSKSESYEFTNEYWSAK 860          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000065901.1 (SMESG000065901.1)

HSP 1 Score: 200.29 bits (508), Expect = 2.045e-55
Identity = 137/430 (31.86%), Postives = 210/430 (48.84%), Query Frame = 2
Query: 1580 PRP---NMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYV---LNGTW--------------DSHFQRAKVLHIRKDKNNQQVF------------ETGPAET-------LWSRRFPPEYTSEMYNFTNFALELNEPEENVA----PTDSRLRPDQRLMETGFWDEAXXX------XXXXXXXXXXXXXXXXXXXXXXXSQGLPPIEEHK--PVWFAPVFDEETKTTTHIYSGNYW 2716
            P+P    ++ ++W  +K CIGKELSKI +P+ FNEP+S +QRLTE  EYS+ LD A    D ++++  + AF VS  ++   R GKPFNPLLGET+E  R +   ++ ++EQ+ HHPP ++ H ES   +K +        F GK + I P G   L     N  YTW+ V  TVHN+I+GK+WI++ G M I NH       L + +  +F K    RV G I      +++V   + G W              DS   +  V    + +N+++              +  P +        +W  +  P+ ++  YNFT+F + LN+  ++ +    PTDSR R D R ME G  DEA         K+R +    +   +++   +   S  +  I   K  PVWFA   +  T      ++G YW
Sbjct:   32 PKPMPSKLNFSVWTFLKQCIGKELSKITMPIVFNEPISFLQRLTEYIEYSELLDQAVAEIDPIKRMEKICAFAVSGGASNWGRIGKPFNPLLGETYELHRPN---FKYVSEQICHHPPVSAFHVES-PTFKFYGAIHPKLNFWGKSVVITPKGNITLELLPWNEVYTWQNVVCTVHNVIIGKIWIEHSGPMRIINHSNNCIADLTFHSVGWFGKN-MHRVDGDIYYGQRKSRHVERKVYGKWTEALFSVSPEVWNDDSSTSKRHVNSTDQIENDEKGDNNNNDIDDPLPQDNTPCDMKLLNQRLIWKAKPRPDNSAIFYNFTSFTMGLNQITDSFSRELPPTDSRFRQDMRYMEEGLLDEAANAKNYLEEKQRAKRVALKSSNSKKNMNKSSSSHEITDIRNQKEGPVWFAEKLNSYTNKMEWQFTGEYW 456          
The following BLAST results are available for this feature:
BLAST of Oxysterol-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OSBP22.082e-14555.21oxysterol binding protein 2 [Source:HGNC Symbol;Ac... [more]
OSBP27.457e-14555.32oxysterol binding protein 2 [Source:HGNC Symbol;Ac... [more]
OSBP29.028e-14555.21oxysterol binding protein 2 [Source:HGNC Symbol;Ac... [more]
OSBP22.420e-14455.21oxysterol binding protein 2 [Source:HGNC Symbol;Ac... [more]
OSBP22.533e-14455.21oxysterol binding protein 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
obr-13.229e-13455.75Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-15.538e-13455.75Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-11.426e-13355.75Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-14.912e-13355.75Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-18.984e-13355.75Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Osbp1.765e-13757.14gene:FBgn0020626 transcript:FBtr0084801[more]
CG38603.071e-5544.35gene:FBgn0034951 transcript:FBtr0343288[more]
CG38603.137e-5544.35gene:FBgn0034951 transcript:FBtr0072201[more]
CG426682.050e-1928.39gene:FBgn0261550 transcript:FBtr0302666[more]
CG426683.003e-1928.39gene:FBgn0261550 transcript:FBtr0306633[more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-106a19.18.787e-15157.78si:ch211-106a19.1 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
si:ch211-106a19.14.050e-15057.78si:ch211-106a19.1 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
si:ch211-106a19.17.865e-14958.02si:ch211-106a19.1 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
si:ch211-106a19.11.572e-14858.04si:ch211-106a19.1 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
osbp3.123e-14657.21oxysterol binding protein [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc62.596e-14457.46coiled-coil domain containing 6 [Source:Xenbase;Ac... [more]
ccdc63.269e-14353.90coiled-coil domain containing 6 [Source:Xenbase;Ac... [more]
OSBP1.154e-13257.97oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
OSBP1.790e-13257.97oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
OSBP5.497e-13257.97oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Osbp24.214e-14552.08oxysterol binding protein 2 [Source:MGI Symbol;Acc... [more]
Osbp23.607e-14452.08oxysterol binding protein 2 [Source:MGI Symbol;Acc... [more]
Osbp28.875e-14152.08oxysterol binding protein 2 [Source:MGI Symbol;Acc... [more]
Osbp4.095e-13057.64oxysterol binding protein [Source:MGI Symbol;Acc:M... [more]
Osbpl36.214e-6839.20oxysterol binding protein-like 3 [Source:MGI Symbo... [more]
back to top
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q969R2|OSBP2_HUMAN5.731e-14055.21Oxysterol-binding protein 2 OS=Homo sapiens OX=960... [more]
sp|Q5QNQ6|OSBP2_MOUSE6.208e-14052.08Oxysterol-binding protein 2 OS=Mus musculus OX=100... [more]
sp|P22059|OSBP1_HUMAN2.718e-12957.64Oxysterol-binding protein 1 OS=Homo sapiens OX=960... [more]
sp|Q3B7Z2|OSBP1_MOUSE2.864e-12957.64Oxysterol-binding protein 1 OS=Mus musculus OX=100... [more]
sp|P16258|OSBP1_RABIT5.669e-12957.64Oxysterol-binding protein 1 OS=Oryctolagus cunicul... [more]
back to top
BLAST of Oxysterol-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J5410.000e+043.87Oxysterol-binding protein OS=Lingula unguis OX=757... [more]
Q7QGU90.000e+042.06Oxysterol-binding protein (Fragment) OS=Anopheles ... [more]
A0A4Y2GK208.353e-17545.78Oxysterol-binding protein 1 OS=Araneus ventricosus... [more]
A0A1S3J6B24.001e-17346.99Oxysterol-binding protein OS=Lingula unguis OX=757... [more]
A0A2R2MKW83.666e-17146.83Oxysterol-binding protein OS=Lingula unguis OX=757... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osbp5.455e-15860.34oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
osbp6.276e-15758.28oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
osbp3.811e-15556.56oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
osbp2.589e-15254.59oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
osbp1.165e-14560.06oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osbp1.343e-15157.21oxysterol binding protein [Source:ZFIN;Acc:ZDB-GEN... [more]
osbpl63.678e-6838.63oxysterol binding protein-like 6 [Source:ZFIN;Acc:... [more]
osbpl1a8.504e-5536.74oxysterol binding protein-like 1A [Source:ZFIN;Acc... [more]
osbpl62.884e-2847.20oxysterol binding protein-like 6 [Source:ZFIN;Acc:... [more]
OSBPL81.223e-1626.69oxysterol binding protein like 8 [Source:HGNC Symb... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
OSH26.244e-6739.65Member of an oxysterol-binding protein family with... [more]
SWH11.364e-6439.44Protein similar to mammalian oxysterol-binding pro... [more]
OSH36.147e-4031.91Member of an oxysterol-binding protein family; thi... [more]
OSH71.970e-1427.50Oxysterol-binding protein; part of family with sev... [more]
OSH68.845e-1224.28Member of an oxysterol-binding protein family; fam... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO441254.800e-15959.27Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
EDO414419.788e-8137.94Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
EDO397673.930e-6438.60Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
EDO359141.045e-1626.75Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
EDO372911.181e-1439.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-106a19.13.235e-14854.65oxysterol-binding protein 2 [Source:NCBI gene;Acc:... [more]
si:ch211-106a19.13.524e-14857.78oxysterol-binding protein 2 [Source:NCBI gene;Acc:... [more]
si:ch211-106a19.17.419e-14857.04oxysterol-binding protein 2 [Source:NCBI gene;Acc:... [more]
ENSORLT00000007524.25.445e-14259.06oxysterol-binding protein 1 [Source:NCBI gene;Acc:... [more]
ENSORLT00000029679.17.397e-14158.58oxysterol-binding protein 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023068.10.000e+0100.00SMESG000023068.1[more]
SMESG000023068.10.000e+099.78SMESG000023068.1[more]
SMESG000008795.17.955e-16043.11SMESG000008795.1[more]
SMESG000046022.11.352e-5836.25SMESG000046022.1[more]
SMESG000065901.12.045e-5531.86SMESG000065901.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031216 ID=SMED30031216|Name=Oxysterol-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2977bp
TGAATATTTCAGAACGTTTCACAAGTCAACAGATATTAATATTATATTTT
AAATTCATTTTATGAATAATTCACGACCTGATTGCCATAAAGGTTACCTT
TATAAGTGGACAAATTATATAAAAGGATACCAAAAGCGATGGTTTGTTCT
TTCAAATGGATTATTATCATACTATAGGAACAAAAATGAAGTTTCACACA
CATGTCGTGGCACAATTAATTTATCAACATCTATAATACGGAAGCAGGAT
TCATTTTCTATTGTTATTTCTAATGATTCAAATCAAACTTTTCATCTCAA
AGCTCAATCGGAAAGTGAAACCAATCAGTGGCTTACAGCTTTACATTTGG
CCAAAGATACAGCTATCAGTTTGTCTGAAGCAGTTTTAGATGATTCAGAT
TCCGAGGCTCCTCTTGGATCTCCATATTTAGGAAACTCATTAACAAAGCC
CCATCATTCCCATAGCCAAAATATTTTACCAATAGATCGGTTGCACTCTT
CCGATGCTTCAGATATTTCTTTATATTACAAAGAATTCGAACAGAGATTA
TTCGATTTAAATACCAGCGTGTCACTAGTGAAGAAAACCAGTGAATCGTT
GTTAAATGTATTAAAAGATGTCAACAAACTGAATTCTCCACACATCATTT
CCAATTATAGCATCAATAGTGATTCGTCAGTTGATATGAAAGCCCATGAC
CAATCGTCTCTTAACAGCCATTCTTCTGTGCTTTTGAATATCGATCACCG
AGCCCCGTCTCATTCCAGCATAGGTCCAGTGCCAGATTTAATGCACAAAT
TCAAGGAGAAAAATAAAACTTTTTTTGTCGCTACTCAAGCCTGTGTAAAC
TCCTGCTCAGAATTCGCAAATCGAGCTACATGTATCTTTTCGAAATATCA
GAAATTATTAAATACCGAACGAGAACAAAGATTGAGATTGGAGAAAATGG
TTGAAGAATTAGCTAAGCAGTTGGGAGCTTTGGAGAAAAAAGCCGTCAAA
CAATCTGAATCAGTTGGATTGAATACTTCTCTTCCACAACATTCGGATGA
TGAAAAAAATGTTCGAGTGAAAAATACAGACCAAGCTTCAGATGATTCAG
ATGATGAATATTTTTACGACGCTATTGAAGATGAACATGTATTTAATGTC
TCTTTACCGAGGCCAATATCACAGAATAACGTGAAACTCGAACCAAAATA
CACAATTAATGAATACGAATCGTGCAGCAGTGATTCTGAGTATGAAAAAG
ACAATTCTAAAGGAAATTCTATTGCTCGAGTAATCGTTCGATCAACAGAG
AATAAGTCCAAATCTAATCATAAAAACAAAATAAATAACATCGGTGATTC
ATCTCAATTTCACAGAAGAACCGTGAGCTCTGGATTTCCTTCCCAGTCAT
TATGTCCCTCGAATTCCTTGAAAGCCAATAAAAACCAATGTGACAATCTG
GGGAAAGATTTGTACAATGTATCTGGTGATGTTAGTACGTTTTCTGAACT
AAAAACTGCCCAAAGTGTTCCTTCACTGTCAACTAAAGTTGAGAAGAAAC
CAGCTCGCGTTCGACGAACGAAAATCACACCCAGACCCAATATGAGTATT
AACCTATGGGGAATTATGAAGAATTGTATTGGTAAAGAATTGTCAAAAAT
ACCTGTTCCTGTTAATTTTAATGAGCCTCTTTCGATGATTCAGCGTTTGA
CAGAAGATTTTGAGTATTCAGATTGCCTTGATGCAGCAGCTGAATGTGCT
GACAGTCTGGAACAATTATCATGGGTTGCTGCTTTCACAGTCAGTTCATA
TTCTACCACCACCAATCGAACTGGTAAACCTTTCAACCCTCTGCTTGGAG
AAACATTTGAATTCGATCGCACAGATGATCTTGGTTGGCGAAGTCTTGCT
GAGCAGGTAAGTCATCATCCTCCTGCAGCTTCTCTTCACTGTGAGTCTAT
CAAAGGATGGAAATGCTGGCAGGAATTCACAATGTCCAGTAAATTTCGAG
GCAAATACCTAGCTATTATACCTATGGGTATTGCCCATTTGACATTCGAG
AAATCTAACAACCATTACACATGGAGAAAAGTGACCAGCACAGTCCACAA
TATCATTGTGGGTAAATTATGGATTGACAACCACGGAGAAATGGATATCT
ACAATCATAAAACTGGAGAGACCTGTCATCTCAATTATAAGGCATATTCC
TATTTCTCCAAGGAACCCGCTAGACGTGTCACTGGAGTGATCACAGATAA
AGACGGTGTCACCAAATATGTATTAAACGGAACCTGGGATTCACACTTTC
AGAGAGCGAAAGTTCTACATATCCGAAAAGATAAAAACAATCAGCAAGTG
TTTGAAACTGGTCCCGCAGAAACCTTGTGGTCGAGACGATTTCCCCCCGA
GTATACTTCTGAAATGTATAATTTTACTAACTTTGCATTGGAACTCAATG
AACCTGAAGAAAATGTAGCACCGACGGACAGCCGGTTACGCCCCGACCAG
CGATTAATGGAAACAGGATTTTGGGATGAAGCCAATAAAGAAAAAGAGCG
TTTAGAAGAGAAGCAACGTGAGAAACGGAGAAATCGTGAAAAGGAAATCG
AGCAGAGGAAAAGTCAAGGCCTGCCACCGATCGAGGAGCACAAGCCTGTA
TGGTTCGCACCGGTATTTGATGAGGAAACCAAAACGACTACTCATATTTA
CTCTGGTAACTACTGGGAAACCAAGGCCACGGGCGCTTGGGGTACCGATT
TGCCAGATATATTTTGATTGATTTTATTTTTAAAAAATGATTATAAACGA
AAAAAAATGTTTTACTATTCAAAGGCTCATCTTTAGATTTCTTAAAAATT
TATTGCTTCTTCACTAGATATTTTGGAAAATGTTGATTTACTTTTTGAAA
ATTAATCAATGTGTTTCCCATCAATATCGGAATATTTTTCACTTGGCAAT
AATTATCAATAAATATGCGCATTGATT
back to top

protein sequence of SMED30031216-orf-1

>SMED30031216-orf-1 ID=SMED30031216-orf-1|Name=SMED30031216-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=902bp
MNNSRPDCHKGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRG
TINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDT
AISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDAS
DISLYYKEFEQRLFDLNTSVSLVKKTSESLLNVLKDVNKLNSPHIISNYS
INSDSSVDMKAHDQSSLNSHSSVLLNIDHRAPSHSSIGPVPDLMHKFKEK
NKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEEL
AKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEY
FYDAIEDEHVFNVSLPRPISQNNVKLEPKYTINEYESCSSDSEYEKDNSK
GNSIARVIVRSTENKSKSNHKNKINNIGDSSQFHRRTVSSGFPSQSLCPS
NSLKANKNQCDNLGKDLYNVSGDVSTFSELKTAQSVPSLSTKVEKKPARV
RRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDF
EYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFE
FDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYL
AIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHK
TGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAK
VLHIRKDKNNQQVFETGPAETLWSRRFPPEYTSEMYNFTNFALELNEPEE
NVAPTDSRLRPDQRLMETGFWDEANKEKERLEEKQREKRRNREKEIEQRK
SQGLPPIEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAWGTDLPDI
F*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037239OSBP_sf
IPR001849PH_domain
IPR000648Oxysterol-bd
IPR011993PH-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006869lipid transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 821..848
NoneNo IPR availableCOILSCoilCoilcoord: 283..317
NoneNo IPR availableGENE3DG3DSA:2.40.160.120coord: 599..771
e-value: 8.2E-24
score: 85.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 413..433
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 818..857
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 328..344
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 317..346
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 818..856
NoneNo IPR availablePANTHERPTHR10972:SF103OXYSTEROL-BINDING PROTEINcoord: 145..892
NoneNo IPR availablePANTHERPTHR10972:SF103OXYSTEROL-BINDING PROTEINcoord: 6..112
NoneNo IPR availableCDDcd13284PH_OSBP_ORP4coord: 10..107
e-value: 4.82834E-51
score: 172.177
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 8..107
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 7..101
e-value: 1.9E-19
score: 80.6
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 9..97
e-value: 8.5E-16
score: 58.4
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 6..99
score: 14.641
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 3..103
e-value: 3.8E-26
score: 93.1
IPR000648Oxysterol-binding proteinPFAMPF01237Oxysterol_BPcoord: 514..886
e-value: 1.7E-137
score: 458.2
IPR000648Oxysterol-binding proteinPANTHERPTHR10972OXYSTEROL-BINDING PROTEIN-RELATEDcoord: 145..892
coord: 6..112
IPR037239Oxysterol-binding protein superfamilySUPERFAMILYSSF144000Oxysterol-binding protein-likecoord: 509..896