Ankyrin repeat family A protein 2

Overview
NameAnkyrin repeat family A protein 2
Smed IDSMED30031212
Length (bp)716
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ankyrin repeat family A protein 2 (SMED30031212) t-SNE clustered cells

Violin plots show distribution of expression levels for Ankyrin repeat family A protein 2 (SMED30031212) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ankyrin repeat family A protein 2 (SMED30031212) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ankyrin repeat family A protein 2 (SMED30031212) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031212

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031212h1SMcG0003806 SmedASXL_004365SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Human
Match: ANKRA2 (ankyrin repeat family A member 2 [Source:HGNC Symbol;Acc:HGNC:13208])

HSP 1 Score: 114.005 bits (284), Expect = 1.238e-29
Identity = 65/185 (35.14%), Postives = 101/185 (54.59%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIED 699
            K  T LTN  R N  +     ++ +S+ Q+A QGE++ L  ++ +    I+ +D+ GFTPLMWA A+ Q   VE L   GA+  +  K  E+AL LA   G+ DIV  LL  G+DVN  D    T L++    NH  C K+LLE GAD T++    + +  +A+     +   VI  +L +++++
Sbjct:  127 KQSTTLTNKHRGNEVSTTPLLANSLSVHQLAAQGEMLYLATRIEQENV-INHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQN 310          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Human
Match: RFXANK (regulatory factor X associated ankyrin containing protein [Source:HGNC Symbol;Acc:HGNC:9987])

HSP 1 Score: 107.457 bits (267), Expect = 1.493e-27
Identity = 65/187 (34.76%), Postives = 96/187 (51.34%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNL 705
            K  T LTN QR N  +        +SI Q+A QGE+  L E L +    ++  D+ GFTPL+WA+A  + + V  L   GA+ +I AK  E+AL LA+  G+ DIV  LL   +D+N  D    T L++    NH  C + LL  GADLT +    +    +A+         VI  ++ ++ + NL
Sbjct:   68 KHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSNL 254          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Human
Match: RFXANK (regulatory factor X associated ankyrin containing protein [Source:HGNC Symbol;Acc:HGNC:9987])

HSP 1 Score: 107.457 bits (267), Expect = 1.493e-27
Identity = 65/187 (34.76%), Postives = 96/187 (51.34%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNL 705
            K  T LTN QR N  +        +SI Q+A QGE+  L E L +    ++  D+ GFTPL+WA+A  + + V  L   GA+ +I AK  E+AL LA+  G+ DIV  LL   +D+N  D    T L++    NH  C + LL  GADLT +    +    +A+         VI  ++ ++ + NL
Sbjct:   68 KHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSNL 254          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Human
Match: RFXANK (regulatory factor X associated ankyrin containing protein [Source:HGNC Symbol;Acc:HGNC:9987])

HSP 1 Score: 86.2705 bits (212), Expect = 8.005e-20
Identity = 47/138 (34.06%), Postives = 73/138 (52.90%), Query Frame = 1
Query:  292 IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNL 705
            ++  D+ GFTPL+WA+A  + + V  L   GA+ +I AK  E+AL LA+  G+ DIV  LL   +D+N  D    T L++    NH  C + LL  GADLT +    +    +A+         VI  ++ ++ + NL
Sbjct:   94 VNKPDERGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSNL 231          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Human
Match: RFXANK (regulatory factor X associated ankyrin containing protein [Source:HGNC Symbol;Acc:HGNC:9987])

HSP 1 Score: 86.2705 bits (212), Expect = 8.674e-20
Identity = 47/138 (34.06%), Postives = 73/138 (52.90%), Query Frame = 1
Query:  292 IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNL 705
            ++  D+ GFTPL+WA+A  + + V  L   GA+ +I AK  E+AL LA+  G+ DIV  LL   +D+N  D    T L++    NH  C + LL  GADLT +    +    +A+         VI  ++ ++ + NL
Sbjct:   95 VNKPDERGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSNL 232          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 69.707 bits (169), Expect = 1.637e-13
Identity = 47/138 (34.06%), Postives = 65/138 (47.10%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLL--RAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            G  ID   K+  TPL  A  +   Q V+LL  +GA ++   KNG   L +AAQ  H D    LL  RA +D    D L  T L   +   H    KLLL+  AD   +  + F   H+A K+N +  V ++ +Y   I
Sbjct:  283 GAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAI 418          

HSP 2 Score: 65.4698 bits (158), Expect = 4.432e-12
Identity = 43/144 (29.86%), Postives = 68/144 (47.22%), Query Frame = 1
Query:  238 GQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            G  E++ L   L E GT +D+  KN  TPL  A   N  +   LL   GA+   +AKNG   L +AA+    +I   LL+   D N       T L  ++   H +   LL+E G+D+  K ++   A H+  + ++V    ++
Sbjct:  568 GNLEVVRL---LLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 3 Score: 63.929 bits (154), Expect = 1.885e-11
Identity = 39/129 (30.23%), Postives = 61/129 (47.29%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            GTDI+ S+ NG   L  A+     + V  L  R A ++ + + G  AL +A+  G   IV  L+  G +VN       T L   +  NH +  K LL+ GA+  +   D F    VA+++ +   V V+
Sbjct:   56 GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 4 Score: 62.7734 bits (151), Expect = 3.622e-11
Identity = 55/199 (27.64%), Postives = 88/199 (44.22%), Query Frame = 1
Query:  157 VLTNVQRRNFQTVA--QQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLR---------AGMDVNYSDE--------LEN------------TSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK--RNNVA 654
            V+  + +R  Q  A  ++ ++ + I  +AGQ  I+ +   L E G +++V   NGFTPL  A   N ++ V+ L   GAN  +S ++G   L +A Q GH  +V  LL            + +    +        L+N            T L   +   H +  +LLLE GA++  +   N    HVA K  R N+A
Sbjct:   81 VVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTI---LVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMA 276          

HSP 5 Score: 59.3066 bits (142), Expect = 6.910e-10
Identity = 37/121 (30.58%), Postives = 56/121 (46.28%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVA 633
            L E G     + KNG+TPL  A   NQ +    L    A+ N  ++ G   L L+AQ GHK+I   L+  G DV        T++   +  +H    ++L   GA++  K +  +   HVA
Sbjct:  609 LLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA 729          

HSP 6 Score: 58.5362 bits (140), Expect = 1.151e-9
Identity = 38/128 (29.69%), Postives = 60/128 (46.88%), Query Frame = 1
Query:  292 IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQ 675
            +D + + G T L  A+   Q   V +L   GAN+N+ + NG   L +AAQ  H+++V YLL+ G +   S E   T L       H     +LLE  +    K      A H+A K+++     ++ Q
Sbjct:   92 VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQ 215          

HSP 7 Score: 57.7658 bits (138), Expect = 2.025e-9
Identity = 37/126 (29.37%), Postives = 55/126 (43.65%), Query Frame = 1
Query:  292 IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            I+ + ++G TPL  A        V  L  +GAN ++    GE  L LAA+    D+V  L+R G  V+       T L   S   + D   LLL+ GA+      DN+   H+A K        ++
Sbjct:  418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGIL 543          

HSP 8 Score: 55.8398 bits (133), Expect = 7.672e-9
Identity = 43/158 (27.22%), Postives = 66/158 (41.77%), Query Frame = 1
Query:  181 NFQTVAQQNSSEISIFQMAGQGEI--ILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNN 648
            N     + N S + I    GQ E+  ILLD        D  +  K GFTPL  A+     + V LL  RG  ++I  KN    L +AA   +  + + LL  G     + +   T L   +  N  +    LL++ AD   K+   F   H++ +  +
Sbjct:  516 NSNATTRDNYSPLHIAAKEGQEEVAGILLDHN-----ADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 9 Score: 55.8398 bits (133), Expect = 9.314e-9
Identity = 41/171 (23.98%), Postives = 77/171 (45.03%), Query Frame = 1
Query:  166 NVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            + Q R  QT        + I    G  +I++L   L + G + + + ++ ++PL  A    Q++   +L    A+  +  K G   L LA++ G+ ++V  LL  G  V+   + + T L   +  N+     LLLE GA       + +   H+A K+N +   + + Q+
Sbjct:  485 DAQARELQT-------PLHIASRLGNTDIVIL---LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQF 645          

HSP 10 Score: 53.1434 bits (126), Expect = 7.684e-8
Identity = 32/118 (27.12%), Postives = 64/118 (54.24%), Query Frame = 1
Query:  325 LMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            L  A A + ++ +ELL   G ++N S  NG N+L LA++ GH ++V  L++    V+ +    NT+L   S    +    +L+E GA++ +++ + F   ++A + N+   V  + ++
Sbjct:   38 LRAARAGDLEKVLELLRA-GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH 154          

HSP 11 Score: 52.7582 bits (125), Expect = 8.347e-8
Identity = 33/119 (27.73%), Postives = 59/119 (49.58%), Query Frame = 1
Query:  295 DVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNV 651
            DV+ K+GFTPL  A     +   +LL  +GAN+N  A++  + L +A + G  ++   LL  G  ++   +   T L   + + H     LL+  GA ++ K  +     H+A + ++V
Sbjct:  221 DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHV 339          

HSP 12 Score: 52.373 bits (124), Expect = 1.346e-7
Identity = 32/120 (26.67%), Postives = 51/120 (42.50%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNN 648
            D +   + GFTPL  +     K+   LL   G+++   A NG  A+ L AQ  H  +   L   G ++N       T L         +  K L+E GAD+  K   ++   H A ++ +
Sbjct:  648 DPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGH 767          

HSP 13 Score: 48.521 bits (114), Expect = 2.176e-6
Identity = 33/134 (24.63%), Postives = 54/134 (40.30%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIR 672
            L E G+D+     NG T +      +     ++L   GA +N     G   L +A   G  ++V +L+  G DV        T L   +   H +C + LLE GA    + +       +A +   V+ V  +R
Sbjct:  675 LIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 69.707 bits (169), Expect = 1.637e-13
Identity = 47/138 (34.06%), Postives = 65/138 (47.10%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLL--RAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            G  ID   K+  TPL  A  +   Q V+LL  +GA ++   KNG   L +AAQ  H D    LL  RA +D    D L  T L   +   H    KLLL+  AD   +  + F   H+A K+N +  V ++ +Y   I
Sbjct:  283 GAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAI 418          

HSP 2 Score: 65.4698 bits (158), Expect = 4.432e-12
Identity = 43/144 (29.86%), Postives = 68/144 (47.22%), Query Frame = 1
Query:  238 GQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            G  E++ L   L E GT +D+  KN  TPL  A   N  +   LL   GA+   +AKNG   L +AA+    +I   LL+   D N       T L  ++   H +   LL+E G+D+  K ++   A H+  + ++V    ++
Sbjct:  568 GNLEVVRL---LLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 3 Score: 63.929 bits (154), Expect = 1.885e-11
Identity = 39/129 (30.23%), Postives = 61/129 (47.29%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            GTDI+ S+ NG   L  A+     + V  L  R A ++ + + G  AL +A+  G   IV  L+  G +VN       T L   +  NH +  K LL+ GA+  +   D F    VA+++ +   V V+
Sbjct:   56 GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 4 Score: 62.7734 bits (151), Expect = 3.622e-11
Identity = 55/199 (27.64%), Postives = 88/199 (44.22%), Query Frame = 1
Query:  157 VLTNVQRRNFQTVA--QQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLR---------AGMDVNYSDE--------LEN------------TSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK--RNNVA 654
            V+  + +R  Q  A  ++ ++ + I  +AGQ  I+ +   L E G +++V   NGFTPL  A   N ++ V+ L   GAN  +S ++G   L +A Q GH  +V  LL            + +    +        L+N            T L   +   H +  +LLLE GA++  +   N    HVA K  R N+A
Sbjct:   81 VVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTI---LVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMA 276          

HSP 5 Score: 59.3066 bits (142), Expect = 6.910e-10
Identity = 37/121 (30.58%), Postives = 56/121 (46.28%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVA 633
            L E G     + KNG+TPL  A   NQ +    L    A+ N  ++ G   L L+AQ GHK+I   L+  G DV        T++   +  +H    ++L   GA++  K +  +   HVA
Sbjct:  609 LLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA 729          

HSP 6 Score: 58.5362 bits (140), Expect = 1.151e-9
Identity = 38/128 (29.69%), Postives = 60/128 (46.88%), Query Frame = 1
Query:  292 IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQ 675
            +D + + G T L  A+   Q   V +L   GAN+N+ + NG   L +AAQ  H+++V YLL+ G +   S E   T L       H     +LLE  +    K      A H+A K+++     ++ Q
Sbjct:   92 VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQ 215          

HSP 7 Score: 57.7658 bits (138), Expect = 2.025e-9
Identity = 37/126 (29.37%), Postives = 55/126 (43.65%), Query Frame = 1
Query:  292 IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            I+ + ++G TPL  A        V  L  +GAN ++    GE  L LAA+    D+V  L+R G  V+       T L   S   + D   LLL+ GA+      DN+   H+A K        ++
Sbjct:  418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGIL 543          

HSP 8 Score: 55.8398 bits (133), Expect = 7.672e-9
Identity = 43/158 (27.22%), Postives = 66/158 (41.77%), Query Frame = 1
Query:  181 NFQTVAQQNSSEISIFQMAGQGEI--ILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNN 648
            N     + N S + I    GQ E+  ILLD        D  +  K GFTPL  A+     + V LL  RG  ++I  KN    L +AA   +  + + LL  G     + +   T L   +  N  +    LL++ AD   K+   F   H++ +  +
Sbjct:  516 NSNATTRDNYSPLHIAAKEGQEEVAGILLDHN-----ADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 9 Score: 55.8398 bits (133), Expect = 9.314e-9
Identity = 41/171 (23.98%), Postives = 77/171 (45.03%), Query Frame = 1
Query:  166 NVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            + Q R  QT        + I    G  +I++L   L + G + + + ++ ++PL  A    Q++   +L    A+  +  K G   L LA++ G+ ++V  LL  G  V+   + + T L   +  N+     LLLE GA       + +   H+A K+N +   + + Q+
Sbjct:  485 DAQARELQT-------PLHIASRLGNTDIVIL---LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQF 645          

HSP 10 Score: 53.1434 bits (126), Expect = 7.684e-8
Identity = 32/118 (27.12%), Postives = 64/118 (54.24%), Query Frame = 1
Query:  325 LMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            L  A A + ++ +ELL   G ++N S  NG N+L LA++ GH ++V  L++    V+ +    NT+L   S    +    +L+E GA++ +++ + F   ++A + N+   V  + ++
Sbjct:   38 LRAARAGDLEKVLELLRA-GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH 154          

HSP 11 Score: 52.7582 bits (125), Expect = 8.347e-8
Identity = 33/119 (27.73%), Postives = 59/119 (49.58%), Query Frame = 1
Query:  295 DVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNV 651
            DV+ K+GFTPL  A     +   +LL  +GAN+N  A++  + L +A + G  ++   LL  G  ++   +   T L   + + H     LL+  GA ++ K  +     H+A + ++V
Sbjct:  221 DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHV 339          

HSP 12 Score: 52.373 bits (124), Expect = 1.346e-7
Identity = 32/120 (26.67%), Postives = 51/120 (42.50%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNN 648
            D +   + GFTPL  +     K+   LL   G+++   A NG  A+ L AQ  H  +   L   G ++N       T L         +  K L+E GAD+  K   ++   H A ++ +
Sbjct:  648 DPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGH 767          

HSP 13 Score: 48.521 bits (114), Expect = 2.176e-6
Identity = 33/134 (24.63%), Postives = 54/134 (40.30%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIR 672
            L E G+D+     NG T +      +     ++L   GA +N     G   L +A   G  ++V +L+  G DV        T L   +   H +C + LLE GA    + +       +A +   V+ V  +R
Sbjct:  675 LIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 69.707 bits (169), Expect = 1.680e-13
Identity = 47/138 (34.06%), Postives = 65/138 (47.10%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLL--RAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            G  ID   K+  TPL  A  +   Q V+LL  +GA ++   KNG   L +AAQ  H D    LL  RA +D    D L  T L   +   H    KLLL+  AD   +  + F   H+A K+N +  V ++ +Y   I
Sbjct:  283 GAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAI 418          

HSP 2 Score: 65.4698 bits (158), Expect = 4.546e-12
Identity = 43/144 (29.86%), Postives = 68/144 (47.22%), Query Frame = 1
Query:  238 GQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            G  E++ L   L E GT +D+  KN  TPL  A   N  +   LL   GA+   +AKNG   L +AA+    +I   LL+   D N       T L  ++   H +   LL+E G+D+  K ++   A H+  + ++V    ++
Sbjct:  568 GNLEVVRL---LLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 3 Score: 63.929 bits (154), Expect = 1.863e-11
Identity = 39/129 (30.23%), Postives = 61/129 (47.29%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            GTDI+ S+ NG   L  A+     + V  L  R A ++ + + G  AL +A+  G   IV  L+  G +VN       T L   +  NH +  K LL+ GA+  +   D F    VA+++ +   V V+
Sbjct:   56 GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 4 Score: 62.7734 bits (151), Expect = 3.646e-11
Identity = 55/199 (27.64%), Postives = 88/199 (44.22%), Query Frame = 1
Query:  157 VLTNVQRRNFQTVA--QQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLR---------AGMDVNYSDE--------LEN------------TSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK--RNNVA 654
            V+  + +R  Q  A  ++ ++ + I  +AGQ  I+ +   L E G +++V   NGFTPL  A   N ++ V+ L   GAN  +S ++G   L +A Q GH  +V  LL            + +    +        L+N            T L   +   H +  +LLLE GA++  +   N    HVA K  R N+A
Sbjct:   81 VVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTI---LVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMA 276          

HSP 5 Score: 59.3066 bits (142), Expect = 6.703e-10
Identity = 37/121 (30.58%), Postives = 56/121 (46.28%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVA 633
            L E G     + KNG+TPL  A   NQ +    L    A+ N  ++ G   L L+AQ GHK+I   L+  G DV        T++   +  +H    ++L   GA++  K +  +   HVA
Sbjct:  609 LLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA 729          

HSP 6 Score: 58.5362 bits (140), Expect = 1.202e-9
Identity = 38/128 (29.69%), Postives = 60/128 (46.88%), Query Frame = 1
Query:  292 IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQ 675
            +D + + G T L  A+   Q   V +L   GAN+N+ + NG   L +AAQ  H+++V YLL+ G +   S E   T L       H     +LLE  +    K      A H+A K+++     ++ Q
Sbjct:   92 VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQ 215          

HSP 7 Score: 57.7658 bits (138), Expect = 2.136e-9
Identity = 37/126 (29.37%), Postives = 55/126 (43.65%), Query Frame = 1
Query:  292 IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            I+ + ++G TPL  A        V  L  +GAN ++    GE  L LAA+    D+V  L+R G  V+       T L   S   + D   LLL+ GA+      DN+   H+A K        ++
Sbjct:  418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGIL 543          

HSP 8 Score: 55.8398 bits (133), Expect = 7.445e-9
Identity = 43/158 (27.22%), Postives = 66/158 (41.77%), Query Frame = 1
Query:  181 NFQTVAQQNSSEISIFQMAGQGEI--ILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNN 648
            N     + N S + I    GQ E+  ILLD        D  +  K GFTPL  A+     + V LL  RG  ++I  KN    L +AA   +  + + LL  G     + +   T L   +  N  +    LL++ AD   K+   F   H++ +  +
Sbjct:  516 NSNATTRDNYSPLHIAAKEGQEEVAGILLDHN-----ADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 9 Score: 55.8398 bits (133), Expect = 9.207e-9
Identity = 41/171 (23.98%), Postives = 77/171 (45.03%), Query Frame = 1
Query:  166 NVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            + Q R  QT        + I    G  +I++L   L + G + + + ++ ++PL  A    Q++   +L    A+  +  K G   L LA++ G+ ++V  LL  G  V+   + + T L   +  N+     LLLE GA       + +   H+A K+N +   + + Q+
Sbjct:  485 DAQARELQT-------PLHIASRLGNTDIVIL---LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQF 645          

HSP 10 Score: 53.1434 bits (126), Expect = 7.666e-8
Identity = 32/118 (27.12%), Postives = 64/118 (54.24%), Query Frame = 1
Query:  325 LMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            L  A A + ++ +ELL   G ++N S  NG N+L LA++ GH ++V  L++    V+ +    NT+L   S    +    +L+E GA++ +++ + F   ++A + N+   V  + ++
Sbjct:   38 LRAARAGDLEKVLELLRA-GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH 154          

HSP 11 Score: 53.1434 bits (126), Expect = 7.737e-8
Identity = 33/119 (27.73%), Postives = 59/119 (49.58%), Query Frame = 1
Query:  295 DVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNV 651
            DV+ K+GFTPL  A     +   +LL  +GAN+N  A++  + L +A + G  ++   LL  G  ++   +   T L   + + H     LL+  GA ++ K  +     H+A + ++V
Sbjct:  221 DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHV 339          

HSP 12 Score: 52.373 bits (124), Expect = 1.355e-7
Identity = 32/120 (26.67%), Postives = 51/120 (42.50%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNN 648
            D +   + GFTPL  +     K+   LL   G+++   A NG  A+ L AQ  H  +   L   G ++N       T L         +  K L+E GAD+  K   ++   H A ++ +
Sbjct:  648 DPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGH 767          

HSP 13 Score: 48.521 bits (114), Expect = 2.132e-6
Identity = 33/134 (24.63%), Postives = 54/134 (40.30%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIR 672
            L E G+D+     NG T +      +     ++L   GA +N     G   L +A   G  ++V +L+  G DV        T L   +   H +C + LLE GA    + +       +A +   V+ V  +R
Sbjct:  675 LIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 69.707 bits (169), Expect = 1.680e-13
Identity = 47/138 (34.06%), Postives = 65/138 (47.10%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLL--RAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            G  ID   K+  TPL  A  +   Q V+LL  +GA ++   KNG   L +AAQ  H D    LL  RA +D    D L  T L   +   H    KLLL+  AD   +  + F   H+A K+N +  V ++ +Y   I
Sbjct:  283 GAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAI 418          

HSP 2 Score: 65.4698 bits (158), Expect = 4.546e-12
Identity = 43/144 (29.86%), Postives = 68/144 (47.22%), Query Frame = 1
Query:  238 GQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            G  E++ L   L E GT +D+  KN  TPL  A   N  +   LL   GA+   +AKNG   L +AA+    +I   LL+   D N       T L  ++   H +   LL+E G+D+  K ++   A H+  + ++V    ++
Sbjct:  568 GNLEVVRL---LLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 3 Score: 63.929 bits (154), Expect = 1.863e-11
Identity = 39/129 (30.23%), Postives = 61/129 (47.29%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            GTDI+ S+ NG   L  A+     + V  L  R A ++ + + G  AL +A+  G   IV  L+  G +VN       T L   +  NH +  K LL+ GA+  +   D F    VA+++ +   V V+
Sbjct:   56 GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 4 Score: 62.7734 bits (151), Expect = 3.646e-11
Identity = 55/199 (27.64%), Postives = 88/199 (44.22%), Query Frame = 1
Query:  157 VLTNVQRRNFQTVA--QQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLR---------AGMDVNYSDE--------LEN------------TSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK--RNNVA 654
            V+  + +R  Q  A  ++ ++ + I  +AGQ  I+ +   L E G +++V   NGFTPL  A   N ++ V+ L   GAN  +S ++G   L +A Q GH  +V  LL            + +    +        L+N            T L   +   H +  +LLLE GA++  +   N    HVA K  R N+A
Sbjct:   81 VVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTI---LVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMA 276          

HSP 5 Score: 59.3066 bits (142), Expect = 6.703e-10
Identity = 37/121 (30.58%), Postives = 56/121 (46.28%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVA 633
            L E G     + KNG+TPL  A   NQ +    L    A+ N  ++ G   L L+AQ GHK+I   L+  G DV        T++   +  +H    ++L   GA++  K +  +   HVA
Sbjct:  609 LLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA 729          

HSP 6 Score: 58.5362 bits (140), Expect = 1.202e-9
Identity = 38/128 (29.69%), Postives = 60/128 (46.88%), Query Frame = 1
Query:  292 IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQ 675
            +D + + G T L  A+   Q   V +L   GAN+N+ + NG   L +AAQ  H+++V YLL+ G +   S E   T L       H     +LLE  +    K      A H+A K+++     ++ Q
Sbjct:   92 VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQ 215          

HSP 7 Score: 57.7658 bits (138), Expect = 2.136e-9
Identity = 37/126 (29.37%), Postives = 55/126 (43.65%), Query Frame = 1
Query:  292 IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            I+ + ++G TPL  A        V  L  +GAN ++    GE  L LAA+    D+V  L+R G  V+       T L   S   + D   LLL+ GA+      DN+   H+A K        ++
Sbjct:  418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGIL 543          

HSP 8 Score: 55.8398 bits (133), Expect = 7.445e-9
Identity = 43/158 (27.22%), Postives = 66/158 (41.77%), Query Frame = 1
Query:  181 NFQTVAQQNSSEISIFQMAGQGEI--ILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNN 648
            N     + N S + I    GQ E+  ILLD        D  +  K GFTPL  A+     + V LL  RG  ++I  KN    L +AA   +  + + LL  G     + +   T L   +  N  +    LL++ AD   K+   F   H++ +  +
Sbjct:  516 NSNATTRDNYSPLHIAAKEGQEEVAGILLDHN-----ADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 9 Score: 55.8398 bits (133), Expect = 9.207e-9
Identity = 41/171 (23.98%), Postives = 77/171 (45.03%), Query Frame = 1
Query:  166 NVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            + Q R  QT        + I    G  +I++L   L + G + + + ++ ++PL  A    Q++   +L    A+  +  K G   L LA++ G+ ++V  LL  G  V+   + + T L   +  N+     LLLE GA       + +   H+A K+N +   + + Q+
Sbjct:  485 DAQARELQT-------PLHIASRLGNTDIVIL---LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQF 645          

HSP 10 Score: 53.1434 bits (126), Expect = 7.666e-8
Identity = 32/118 (27.12%), Postives = 64/118 (54.24%), Query Frame = 1
Query:  325 LMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            L  A A + ++ +ELL   G ++N S  NG N+L LA++ GH ++V  L++    V+ +    NT+L   S    +    +L+E GA++ +++ + F   ++A + N+   V  + ++
Sbjct:   38 LRAARAGDLEKVLELLRA-GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH 154          

HSP 11 Score: 53.1434 bits (126), Expect = 7.737e-8
Identity = 33/119 (27.73%), Postives = 59/119 (49.58%), Query Frame = 1
Query:  295 DVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNV 651
            DV+ K+GFTPL  A     +   +LL  +GAN+N  A++  + L +A + G  ++   LL  G  ++   +   T L   + + H     LL+  GA ++ K  +     H+A + ++V
Sbjct:  221 DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHV 339          

HSP 12 Score: 52.373 bits (124), Expect = 1.355e-7
Identity = 32/120 (26.67%), Postives = 51/120 (42.50%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNN 648
            D +   + GFTPL  +     K+   LL   G+++   A NG  A+ L AQ  H  +   L   G ++N       T L         +  K L+E GAD+  K   ++   H A ++ +
Sbjct:  648 DPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGH 767          

HSP 13 Score: 48.521 bits (114), Expect = 2.132e-6
Identity = 33/134 (24.63%), Postives = 54/134 (40.30%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIR 672
            L E G+D+     NG T +      +     ++L   GA +N     G   L +A   G  ++V +L+  G DV        T L   +   H +C + LLE GA    + +       +A +   V+ V  +R
Sbjct:  675 LIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 69.707 bits (169), Expect = 1.954e-13
Identity = 47/138 (34.06%), Postives = 65/138 (47.10%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLL--RAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            G  ID   K+  TPL  A  +   Q V+LL  +GA ++   KNG   L +AAQ  H D    LL  RA +D    D L  T L   +   H    KLLL+  AD   +  + F   H+A K+N +  V ++ +Y   I
Sbjct:  283 GAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL--TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAI 418          

HSP 2 Score: 65.4698 bits (158), Expect = 5.188e-12
Identity = 43/144 (29.86%), Postives = 68/144 (47.22%), Query Frame = 1
Query:  238 GQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            G  E++ L   L E GT +D+  KN  TPL  A   N  +   LL   GA+   +AKNG   L +AA+    +I   LL+   D N       T L  ++   H +   LL+E G+D+  K ++   A H+  + ++V    ++
Sbjct:  568 GNLEVVRL---LLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 3 Score: 63.5438 bits (153), Expect = 2.010e-11
Identity = 39/129 (30.23%), Postives = 61/129 (47.29%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            GTDI+ S+ NG   L  A+     + V  L  R A ++ + + G  AL +A+  G   IV  L+  G +VN       T L   +  NH +  K LL+ GA+  +   D F    VA+++ +   V V+
Sbjct:   56 GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVL 184          

HSP 4 Score: 62.7734 bits (151), Expect = 4.045e-11
Identity = 55/199 (27.64%), Postives = 88/199 (44.22%), Query Frame = 1
Query:  157 VLTNVQRRNFQTVA--QQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLR---------AGMDVNYSDE--------LEN------------TSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK--RNNVA 654
            V+  + +R  Q  A  ++ ++ + I  +AGQ  I+ +   L E G +++V   NGFTPL  A   N ++ V+ L   GAN  +S ++G   L +A Q GH  +V  LL            + +    +        L+N            T L   +   H +  +LLLE GA++  +   N    HVA K  R N+A
Sbjct:   81 VVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTI---LVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMA 276          

HSP 5 Score: 58.9214 bits (141), Expect = 7.572e-10
Identity = 37/121 (30.58%), Postives = 56/121 (46.28%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVA 633
            L E G     + KNG+TPL  A   NQ +    L    A+ N  ++ G   L L+AQ GHK+I   L+  G DV        T++   +  +H    ++L   GA++  K +  +   HVA
Sbjct:  609 LLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVA 729          

HSP 6 Score: 58.5362 bits (140), Expect = 1.238e-9
Identity = 38/128 (29.69%), Postives = 60/128 (46.88%), Query Frame = 1
Query:  292 IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQ 675
            +D + + G T L  A+   Q   V +L   GAN+N+ + NG   L +AAQ  H+++V YLL+ G +   S E   T L       H     +LLE  +    K      A H+A K+++     ++ Q
Sbjct:   92 VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQ 215          

HSP 7 Score: 57.7658 bits (138), Expect = 2.219e-9
Identity = 37/126 (29.37%), Postives = 55/126 (43.65%), Query Frame = 1
Query:  292 IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            I+ + ++G TPL  A        V  L  +GAN ++    GE  L LAA+    D+V  L+R G  V+       T L   S   + D   LLL+ GA+      DN+   H+A K        ++
Sbjct:  418 IEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGIL 543          

HSP 8 Score: 55.8398 bits (133), Expect = 8.561e-9
Identity = 43/158 (27.22%), Postives = 66/158 (41.77%), Query Frame = 1
Query:  181 NFQTVAQQNSSEISIFQMAGQGEI--ILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNN 648
            N     + N S + I    GQ E+  ILLD        D  +  K GFTPL  A+     + V LL  RG  ++I  KN    L +AA   +  + + LL  G     + +   T L   +  N  +    LL++ AD   K+   F   H++ +  +
Sbjct:  516 NSNATTRDNYSPLHIAAKEGQEEVAGILLDHN-----ADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGH 668          

HSP 9 Score: 55.4546 bits (132), Expect = 1.049e-8
Identity = 41/171 (23.98%), Postives = 77/171 (45.03%), Query Frame = 1
Query:  166 NVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            + Q R  QT        + I    G  +I++L   L + G + + + ++ ++PL  A    Q++   +L    A+  +  K G   L LA++ G+ ++V  LL  G  V+   + + T L   +  N+     LLLE GA       + +   H+A K+N +   + + Q+
Sbjct:  485 DAQARELQT-------PLHIASRLGNTDIVIL---LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQF 645          

HSP 10 Score: 52.7582 bits (125), Expect = 7.890e-8
Identity = 32/118 (27.12%), Postives = 64/118 (54.24%), Query Frame = 1
Query:  325 LMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            L  A A + ++ +ELL   G ++N S  NG N+L LA++ GH ++V  L++    V+ +    NT+L   S    +    +L+E GA++ +++ + F   ++A + N+   V  + ++
Sbjct:   38 LRAARAGDLEKVLELLRA-GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH 154          

HSP 11 Score: 52.7582 bits (125), Expect = 8.338e-8
Identity = 33/119 (27.73%), Postives = 59/119 (49.58%), Query Frame = 1
Query:  295 DVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNV 651
            DV+ K+GFTPL  A     +   +LL  +GAN+N  A++  + L +A + G  ++   LL  G  ++   +   T L   + + H     LL+  GA ++ K  +     H+A + ++V
Sbjct:  221 DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHV 339          

HSP 12 Score: 51.9878 bits (123), Expect = 1.474e-7
Identity = 32/120 (26.67%), Postives = 51/120 (42.50%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNN 648
            D +   + GFTPL  +     K+   LL   G+++   A NG  A+ L AQ  H  +   L   G ++N       T L         +  K L+E GAD+  K   ++   H A ++ +
Sbjct:  648 DPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGH 767          

HSP 13 Score: 48.521 bits (114), Expect = 2.154e-6
Identity = 33/134 (24.63%), Postives = 54/134 (40.30%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIR 672
            L E G+D+     NG T +      +     ++L   GA +N     G   L +A   G  ++V +L+  G DV        T L   +   H +C + LLE GA    + +       +A +   V+ V  +R
Sbjct:  675 LIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Fly
Match: CG5846 (gene:FBgn0032171 transcript:FBtr0346717)

HSP 1 Score: 111.309 bits (277), Expect = 1.038e-29
Identity = 69/205 (33.66%), Postives = 105/205 (51.22%), Query Frame = 1
Query:   88 PQCLDIISDKSSNGYKFNNKPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEII---LLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQII 693
            P  + ++  K  + +       TVLTN+QR N +         +S  + AGQGEI    +  E+  +   +ID  D +GFT L WA +  Q  +V+LL   GAN+N  A +  + LLLAA  GH +IV +LL  G D  + D + NT+L++ +  NH   C  LL    DL+  N D   A+ +A++        ++ QY+T II
Sbjct:   24 PTSMLVLDAKRKSAFLPYRPQSTVLTNLQRGNTEATFCPVEVSLSFHERAGQGEITEEQVAAERARQ--QNIDYKDAHGFTALHWAASYGQLVSVQLLVAAGANVNTMAPDLISPLLLAAAGGHNEIVRFLLEHGADSGHMDIVGNTALMYAAAGNHPHTCNELLAKDLDLSATNEDGDTAYSLAVEHGAHLAQALLEQYMTAII 226          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Fly
Match: CG5846 (gene:FBgn0032171 transcript:FBtr0079891)

HSP 1 Score: 111.309 bits (277), Expect = 1.038e-29
Identity = 69/205 (33.66%), Postives = 105/205 (51.22%), Query Frame = 1
Query:   88 PQCLDIISDKSSNGYKFNNKPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEII---LLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQII 693
            P  + ++  K  + +       TVLTN+QR N +         +S  + AGQGEI    +  E+  +   +ID  D +GFT L WA +  Q  +V+LL   GAN+N  A +  + LLLAA  GH +IV +LL  G D  + D + NT+L++ +  NH   C  LL    DL+  N D   A+ +A++        ++ QY+T II
Sbjct:   24 PTSMLVLDAKRKSAFLPYRPQSTVLTNLQRGNTEATFCPVEVSLSFHERAGQGEITEEQVAAERARQ--QNIDYKDAHGFTALHWAASYGQLVSVQLLVAAGANVNTMAPDLISPLLLAAAGGHNEIVRFLLEHGADSGHMDIVGNTALMYAAAGNHPHTCNELLAKDLDLSATNEDGDTAYSLAVEHGAHLAQALLEQYMTAII 226          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 74.3294 bits (181), Expect = 6.149e-15
Identity = 52/167 (31.14%), Postives = 82/167 (49.10%), Query Frame = 1
Query:  196 AQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLL--RAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            A+ N S + +    G+  ++ L   L E G +I+   ++G TPL  A  +  +Q V++L  RGA ++   KNG   L +AAQ  H D    LL  RA +D    D L  T+L   +   H    KLLL+  AD   +  + F   H+A K+N +  V ++ ++   I
Sbjct:  235 AKHNISPLHVAAKWGKTNMVSL---LLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYL--TALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASI 396          

HSP 2 Score: 67.0106 bits (162), Expect = 1.989e-12
Identity = 40/129 (31.01%), Postives = 60/129 (46.51%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQ 675
            D+D   KNG TPL  A   N +Q   LL  +GA+ + +AKNG   L +AA+    DI   LL  G   N   +   T L  +S   HA+   LL+E  A +     +     H+  + +NV    ++ +
Sbjct:  560 DVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEK 688          

HSP 3 Score: 63.5438 bits (153), Expect = 2.349e-11
Identity = 39/127 (30.71%), Postives = 64/127 (50.39%), Query Frame = 1
Query:  310 NGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            NGFTPL  A   N+ + VELL   GA+++ + ++G   L +AA  G  +IV+YLL+     +       T L   +  N  D  ++LL  GA +  +  +     H+A +  NV  V ++ Q+  Q+
Sbjct:  369 NGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQV 495          

HSP 4 Score: 62.003 bits (149), Expect = 8.508e-11
Identity = 38/134 (28.36%), Postives = 66/134 (49.25%), Query Frame = 1
Query:  295 DVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIE 696
            DV+ K+GFTPL  A+    +    LL  +GA++N SAK+  + L +AA+ G  ++V  LL  G ++        T L   + + H     +LLE GA ++ K  +     H+A +  +V    ++  +   + E
Sbjct:  199 DVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDE 332          

HSP 5 Score: 61.2326 bits (147), Expect = 1.474e-10
Identity = 39/127 (30.71%), Postives = 61/127 (48.03%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            DI+ S+ NG   L  A+ +     V  L  RGA ++ + K G  AL +A+  G +++V  LL     VN   +   T L   +  NH    +LLL  GA+ ++   D F    VAM++ +   V V+
Sbjct:   36 DINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVL 162          

HSP 6 Score: 58.151 bits (139), Expect = 1.713e-9
Identity = 38/156 (24.36%), Postives = 70/156 (44.87%), Query Frame = 1
Query:  211 SEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            + + I    GQ E+  +   L E G  +D + K GFTPL         +  +LL  + A+++   KNG   L +A    ++ + L LL  G   + + +  +T L   +  N  D    LLE+GA    ++   F   H++ +  +    N++ ++
Sbjct:  504 TALHIAAKEGQDEVAAV---LIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEH 656          

HSP 7 Score: 57.7658 bits (138), Expect = 2.392e-9
Identity = 41/161 (25.47%), Postives = 70/161 (43.48%), Query Frame = 1
Query:  196 AQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            A++  + + I    G  +I++L   L + G  +D + K+ +T L  A    Q +   +L   GA L+ + K G   L L A+ GH  +   LL+   DV+   +   T L      N+     LLLE GA       +     H+A ++N +     + +Y
Sbjct:  466 AREQQTPLHIASRLGNVDIVML---LLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEY 623          

HSP 8 Score: 56.6102 bits (135), Expect = 5.817e-9
Identity = 39/149 (26.17%), Postives = 71/149 (47.65%), Query Frame = 1
Query:  238 GQGEI--ILLDEK--LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIR 672
            G  EI  +L++ K  +N P        KNG TP+      +     E+L   GAN++++ K G   L +A+  G  ++V +LL+ G +V+ +  +  T L  T+   H     LLLE  A+   +  +     H+A K   ++ ++ ++
Sbjct:  645 GHAEISNLLIEHKAAVNHPA-------KNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLK 786          

HSP 9 Score: 56.6102 bits (135), Expect = 5.871e-9
Identity = 42/134 (31.34%), Postives = 59/134 (44.03%), Query Frame = 1
Query:  265 EKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK--RNNVATV 660
            E L   G  I  + ++G TPL  A        V  L    A+ ++    GE  L LAA+    DI+  LLR G  V+     + T L   S   + D   LLL+ GA +     D + A H+A K  ++ VA V
Sbjct:  387 ELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAV 520          

HSP 10 Score: 55.0694 bits (131), Expect = 1.934e-8
Identity = 42/156 (26.92%), Postives = 74/156 (47.44%), Query Frame = 1
Query:  205 NSSEISIFQMAGQ-GEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            N++ ++   +A + G I ++ E L   G  +D + K G T L  A+   Q++ V+LL    A++N+ ++NG   L +AAQ  H  +V  LL  G + + + E   T L       H     +LLE       +      A H+A K+++V    ++
Sbjct:   41 NANGLNALHLASKDGHIHVVSELLRR-GAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLL 191          

HSP 11 Score: 54.6842 bits (130), Expect = 2.201e-8
Identity = 35/133 (26.32%), Postives = 59/133 (44.36%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            L + G D++ S K+  +PL  A    +   V LL  +G N+    ++G   L  AA++GH+ +V  LL  G  ++   +     L   +   H D  ++LL   A +     D   A HVA    +V    ++
Sbjct:  224 LIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLL 356          

HSP 12 Score: 50.447 bits (119), Expect = 6.087e-7
Identity = 37/134 (27.61%), Postives = 60/134 (44.78%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIR 672
            L E G     + KNG TPL  A   NQ      L   GA  N  +K G   L L++Q GH +I   L+     VN+  +   T +   +  ++ +  ++L + GA++ M     +   HVA   ++    N++R
Sbjct:  587 LLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVA---SHFGQANMVR 717          

HSP 13 Score: 50.0618 bits (118), Expect = 8.388e-7
Identity = 33/122 (27.05%), Postives = 55/122 (45.08%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNN 648
            G  +D   +   TPL  A+       V LL   GA ++ + K+   AL +AA+ G  ++   L+  G  ++ + +   T L  T+   H    +LLL+  AD+  +  +     HVA   NN
Sbjct:  459 GAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNN 580          

HSP 14 Score: 49.6766 bits (117), Expect = 1.188e-6
Identity = 34/136 (25.00%), Postives = 62/136 (45.59%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            L E G   +   K GFTPL  ++     +   LL    A +N  AKNG   + L AQ  + ++   L + G +++ + +   T L   S    A+  + LL+ GA++    S  +   H   ++ +   VN++ ++
Sbjct:  620 LLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEH 755          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303120)

HSP 1 Score: 73.559 bits (179), Expect = 1.025e-14
Identity = 52/167 (31.14%), Postives = 82/167 (49.10%), Query Frame = 1
Query:  196 AQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLL--RAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            A+ N S + +    G+  ++ L   L E G +I+   ++G TPL  A  +  +Q V++L  RGA ++   KNG   L +AAQ  H D    LL  RA +D    D L  T+L   +   H    KLLL+  AD   +  + F   H+A K+N +  V ++ ++   I
Sbjct:  385 AKHNISPLHVAAKWGKTNMVSL---LLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYL--TALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASI 546          

HSP 2 Score: 62.3882 bits (150), Expect = 5.180e-11
Identity = 39/127 (30.71%), Postives = 64/127 (50.39%), Query Frame = 1
Query:  310 NGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            NGFTPL  A   N+ + VELL   GA+++ + ++G   L +AA  G  +IV+YLL+     +       T L   +  N  D  ++LL  GA +  +  +     H+A +  NV  V ++ Q+  Q+
Sbjct:  519 NGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQV 645          

HSP 3 Score: 61.2326 bits (147), Expect = 1.316e-10
Identity = 42/148 (28.38%), Postives = 71/148 (47.97%), Query Frame = 1
Query:  253 ILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIE 696
            +LLD   N      DV+ K+GFTPL  A+    +    LL  +GA++N SAK+  + L +AA+ G  ++V  LL  G ++        T L   + + H     +LLE GA ++ K  +     H+A +  +V    ++  +   + E
Sbjct:  340 LLLDNDHNP-----DVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDE 482          

HSP 4 Score: 60.8474 bits (146), Expect = 2.117e-10
Identity = 39/127 (30.71%), Postives = 61/127 (48.03%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            DI+ S+ NG   L  A+ +     V  L  RGA ++ + K G  AL +A+  G +++V  LL     VN   +   T L   +  NH    +LLL  GA+ ++   D F    VAM++ +   V V+
Sbjct:  186 DINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVL 312          

HSP 5 Score: 57.7658 bits (138), Expect = 2.286e-9
Identity = 44/148 (29.73%), Postives = 64/148 (43.24%), Query Frame = 1
Query:  265 EKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNLY 708
            E L   G  I  + ++G TPL  A        V  L    A+ ++    GE  L LAA+    DI+  LLR G  V+     + T L   S   + D   LLL+ GA +     D + A H+A K       ++I + +T  I D +Y
Sbjct:  537 ELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVKDLIAKKITDHI-DTVY 683          

HSP 6 Score: 54.6842 bits (130), Expect = 2.423e-8
Identity = 42/156 (26.92%), Postives = 74/156 (47.44%), Query Frame = 1
Query:  205 NSSEISIFQMAGQ-GEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            N++ ++   +A + G I ++ E L   G  +D + K G T L  A+   Q++ V+LL    A++N+ ++NG   L +AAQ  H  +V  LL  G + + + E   T L       H     +LLE       +      A H+A K+++V    ++
Sbjct:  191 NANGLNALHLASKDGHIHVVSELLRR-GAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLL 341          

HSP 7 Score: 53.9138 bits (128), Expect = 3.915e-8
Identity = 35/133 (26.32%), Postives = 59/133 (44.36%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            L + G D++ S K+  +PL  A    +   V LL  +G N+    ++G   L  AA++GH+ +V  LL  G  ++   +     L   +   H D  ++LL   A +     D   A HVA    +V    ++
Sbjct:  374 LIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLL 506          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Fly
Match: Ilk (gene:FBgn0028427 transcript:FBtr0078305)

HSP 1 Score: 73.1738 bits (178), Expect = 1.034e-14
Identity = 44/137 (32.12%), Postives = 67/137 (48.91%), Query Frame = 1
Query:  223 IFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVA 633
            IF    +G  I +   L+E   D ++ D +GF+PL W       + VE L  RG+ +N +    +  L LAA +GH+D+V  L++   DVN  +E  NT L +  F  +   C+ LL  GA + + N D       A
Sbjct:    4 IFHWCREGNSIQVRLWLDETEHDNNLGDDHGFSPLHWVAKEGHAKLVETLLQRGSRVNATNMGDDIPLHLAAAHGHRDVVQMLIKERSDVNAVNEHGNTPLHYACFWGYDMICEDLLNAGAQVGIANKDGHTPLEKA 140          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Zebrafish
Match: ankra2 (ankyrin repeat, family A (RFXANK-like), 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2141])

HSP 1 Score: 114.775 bits (286), Expect = 3.025e-30
Identity = 65/184 (35.33%), Postives = 100/184 (54.35%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIE 696
            K  T LTN  R N  +        +SI Q+A QGE++ L  ++ +    I++ D+ GFTPLMWA A+ Q   VE L   GA+ ++ AK  E+AL LA   G+ DIV  L+  G+DVN  D      L++    NH  C ++LLE G+D TM++   F A  +A+   +     V+  +L ++++
Sbjct:  110 KQSTTLTNKHRGNEVSSTPLLVHSLSIHQLAAQGEMVFLASRIEQESV-INLQDEEGFTPLMWAAAHGQIAVVEFLLQSGADPHLLAKGRESALSLACSKGYTDIVRMLIDCGVDVNEYDWNGGAPLLYAVHGNHVRCVEILLESGSDPTMESDSGFNAMDMAVAMGHRNVQQVLEAHLLKLLQ 292          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Zebrafish
Match: ankra2 (ankyrin repeat, family A (RFXANK-like), 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2141])

HSP 1 Score: 114.775 bits (286), Expect = 3.025e-30
Identity = 65/184 (35.33%), Postives = 100/184 (54.35%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIE 696
            K  T LTN  R N  +        +SI Q+A QGE++ L  ++ +    I++ D+ GFTPLMWA A+ Q   VE L   GA+ ++ AK  E+AL LA   G+ DIV  L+  G+DVN  D      L++    NH  C ++LLE G+D TM++   F A  +A+   +     V+  +L ++++
Sbjct:  110 KQSTTLTNKHRGNEVSSTPLLVHSLSIHQLAAQGEMVFLASRIEQESV-INLQDEEGFTPLMWAAAHGQIAVVEFLLQSGADPHLLAKGRESALSLACSKGYTDIVRMLIDCGVDVNEYDWNGGAPLLYAVHGNHVRCVEILLESGSDPTMESDSGFNAMDMAVAMGHRNVQQVLEAHLLKLLQ 292          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Zebrafish
Match: ankra2 (ankyrin repeat, family A (RFXANK-like), 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2141])

HSP 1 Score: 114.775 bits (286), Expect = 3.708e-30
Identity = 65/184 (35.33%), Postives = 100/184 (54.35%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIE 696
            K  T LTN  R N  +        +SI Q+A QGE++ L  ++ +    I++ D+ GFTPLMWA A+ Q   VE L   GA+ ++ AK  E+AL LA   G+ DIV  L+  G+DVN  D      L++    NH  C ++LLE G+D TM++   F A  +A+   +     V+  +L ++++
Sbjct:  115 KQSTTLTNKHRGNEVSSTPLLVHSLSIHQLAAQGEMVFLASRIEQESV-INLQDEEGFTPLMWAAAHGQIAVVEFLLQSGADPHLLAKGRESALSLACSKGYTDIVRMLIDCGVDVNEYDWNGGAPLLYAVHGNHVRCVEILLESGSDPTMESDSGFNAMDMAVAMGHRNVQQVLEAHLLKLLQ 297          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Zebrafish
Match: rfxank (regulatory factor X-associated ankyrin-containing protein [Source:ZFIN;Acc:ZDB-GENE-050208-596])

HSP 1 Score: 101.293 bits (251), Expect = 5.171e-26
Identity = 63/168 (37.50%), Postives = 89/168 (52.98%), Query Frame = 1
Query:  154 TVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNF--CAFHVAMKRNNV 651
            T LTN QR N  TV       +SI Q+A  GEI  L+  L++  + ++  D+ GFTPLMWA A  +   VE L  +GA+    A+  E+AL LA+  G  DIV  LL+ G+D++  D    T L++    NH  C + LL  GAD+T +    +   A  VA+    V
Sbjct:   14 TTLTNKQRGNEVTVRPATLDNLSIHQLAAHGEIPQLEIHLSKDNSLLNNQDERGFTPLMWAAAFGEITMVEFLLQKGADPKTLARERESALSLASAGGFADIVNILLQHGVDIDSYDWNGGTPLLYAVRGNHMKCVEALLRCGADITFEADSGYSPVALAVALGHKKV 181          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Zebrafish
Match: rfxank (regulatory factor X-associated ankyrin-containing protein [Source:ZFIN;Acc:ZDB-GENE-050208-596])

HSP 1 Score: 88.5817 bits (218), Expect = 1.042e-21
Identity = 53/137 (38.69%), Postives = 75/137 (54.74%), Query Frame = 1
Query:  154 TVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCK 564
            T LTN QR N  TV       +SI Q+A  GEI  L+  L++  + ++  D+ GFTPLMWA A  +   VE L  +GA+    A+  E+AL LA+  G  DIV  LL+ G+D++  D    T L++    NH  C +
Sbjct:   14 TTLTNKQRGNEVTVRPATLDNLSIHQLAAHGEIPQLEIHLSKDNSLLNNQDERGFTPLMWAAAFGEITMVEFLLQKGADPKTLARERESALSLASAGGFADIVNILLQHGVDIDSYDWNGGTPLLYAVRGNHMKCVE 150          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Xenopus
Match: s100a11 (S100 calcium binding protein A11 [Source:Xenbase;Acc:XB-GENE-5784685])

HSP 1 Score: 115.546 bits (288), Expect = 6.860e-31
Identity = 69/199 (34.67%), Postives = 101/199 (50.75%), Query Frame = 1
Query:  109 SDKSSNGYKFNNKP---RTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIE 696
            SD   +    N  P    T LTN QR N  +V       +S+ Q+A QGE+  L E + +    I+  D+ GFTPLMWA A  + + V  L   GA+ +I AK  E+AL LA+  G+ DIV  LL   +D+N  D    T L++    NH  C ++LLE GADLTM+    +    +A+         VI  ++ ++ +
Sbjct:   37 SDVEEDVLPLNAGPLQYSTTLTNRQRGNMVSVLPATLDSLSVQQLAAQGELTQLKEYIQKDKALINCPDERGFTPLMWAAAFGEIETVRYLLELGADPHILAKERESALSLASTGGYSDIVTLLLSKKVDINIYDWNGGTPLLYAVRGNHMKCVEVLLERGADLTMEADSGYTPMDLAVALGYKKVQQVIEHHILKLFQ 235          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Xenopus
Match: apoe (apolipoprotein E [Source:Xenbase;Acc:XB-GENE-853213])

HSP 1 Score: 115.546 bits (288), Expect = 2.004e-30
Identity = 64/184 (34.78%), Postives = 101/184 (54.89%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIE 696
            K  T LTN  R N  +      + +S+ Q+A QGE++ L  +L +    ++++D+ GFTPLMWA A+ Q   VE L   GA+  +  K  E+AL LA   G+ DIV  L+  G+DVN  D    T L++    NH  C K+LLE GAD T++    + +  +++   + +   VI  +L Q+++
Sbjct:  109 KQSTTLTNKHRGNEVSTTPLLVNSLSVHQLAAQGEMVYLASRLEQENV-VNLTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQVLGKGRESALSLACSKGYTDIVKMLVECGVDVNEYDWNGGTPLLYAVHGNHVKCVKILLENGADPTIETDSGYNSMDLSVALGHRSVQQVIETHLLQLLQ 291          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Xenopus
Match: apoe (apolipoprotein E [Source:Xenbase;Acc:XB-GENE-853213])

HSP 1 Score: 115.546 bits (288), Expect = 2.829e-30
Identity = 64/184 (34.78%), Postives = 101/184 (54.89%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIE 696
            K  T LTN  R N  +      + +S+ Q+A QGE++ L  +L +    ++++D+ GFTPLMWA A+ Q   VE L   GA+  +  K  E+AL LA   G+ DIV  L+  G+DVN  D    T L++    NH  C K+LLE GAD T++    + +  +++   + +   VI  +L Q+++
Sbjct:  119 KQSTTLTNKHRGNEVSTTPLLVNSLSVHQLAAQGEMVYLASRLEQENV-VNLTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQVLGKGRESALSLACSKGYTDIVKMLVECGVDVNEYDWNGGTPLLYAVHGNHVKCVKILLENGADPTIETDSGYNSMDLSVALGHRSVQQVIETHLLQLLQ 301          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Xenopus
Match: apoe (apolipoprotein E [Source:Xenbase;Acc:XB-GENE-853213])

HSP 1 Score: 115.546 bits (288), Expect = 3.103e-30
Identity = 64/184 (34.78%), Postives = 101/184 (54.89%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIE 696
            K  T LTN  R N  +      + +S+ Q+A QGE++ L  +L +    ++++D+ GFTPLMWA A+ Q   VE L   GA+  +  K  E+AL LA   G+ DIV  L+  G+DVN  D    T L++    NH  C K+LLE GAD T++    + +  +++   + +   VI  +L Q+++
Sbjct:  126 KQSTTLTNKHRGNEVSTTPLLVNSLSVHQLAAQGEMVYLASRLEQENV-VNLTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQVLGKGRESALSLACSKGYTDIVKMLVECGVDVNEYDWNGGTPLLYAVHGNHVKCVKILLENGADPTIETDSGYNSMDLSVALGHRSVQQVIETHLLQLLQ 308          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Xenopus
Match: apoe (apolipoprotein E [Source:Xenbase;Acc:XB-GENE-853213])

HSP 1 Score: 115.546 bits (288), Expect = 3.289e-30
Identity = 64/184 (34.78%), Postives = 101/184 (54.89%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIE 696
            K  T LTN  R N  +      + +S+ Q+A QGE++ L  +L +    ++++D+ GFTPLMWA A+ Q   VE L   GA+  +  K  E+AL LA   G+ DIV  L+  G+DVN  D    T L++    NH  C K+LLE GAD T++    + +  +++   + +   VI  +L Q+++
Sbjct:  133 KQSTTLTNKHRGNEVSTTPLLVNSLSVHQLAAQGEMVYLASRLEQENV-VNLTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQVLGKGRESALSLACSKGYTDIVKMLVECGVDVNEYDWNGGTPLLYAVHGNHVKCVKILLENGADPTIETDSGYNSMDLSVALGHRSVQQVIETHLLQLLQ 315          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Mouse
Match: Ankra2 (ankyrin repeat, family A (RFXANK-like), 2 [Source:MGI Symbol;Acc:MGI:1915808])

HSP 1 Score: 109.383 bits (272), Expect = 4.009e-28
Identity = 64/185 (34.59%), Postives = 98/185 (52.97%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIED 699
            K  T LTN  R N  +     ++ +S  Q+A QGE++ L  ++ +    I+ +D+ GFTPLMWA A+ Q   VE L   GA+  +  K  E+AL LA   G+ DIV  LL  G+DVN  D    T L++    NH  C K+LLE GAD T++    + +  +A+          I  +L +++++
Sbjct:  126 KQSTTLTNKHRGNEVSTTPLLANSLSAHQLAAQGEMLYLATRIEQENV-INHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLENGADPTIETDSGYNSMDLAVALGYRGVQQAIESHLLKLLQN 309          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Mouse
Match: Ankra2 (ankyrin repeat, family A (RFXANK-like), 2 [Source:MGI Symbol;Acc:MGI:1915808])

HSP 1 Score: 106.686 bits (265), Expect = 3.619e-27
Identity = 62/164 (37.80%), Postives = 90/164 (54.88%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAM 636
            K  T LTN  R N  +     ++ +S  Q+A QGE++ L  ++ +    I+ +D+ GFTPLMWA A+ Q   VE L   GA+  +  K  E+AL LA   G+ DIV  LL  G+DVN  D    T L++    NH  C K+LLE GAD T++    + +  +A+
Sbjct:  126 KQSTTLTNKHRGNEVSTTPLLANSLSAHQLAAQGEMLYLATRIEQENV-INHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLENGADPTIETDSGYNSMDLAV 288          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Mouse
Match: Ankra2 (ankyrin repeat, family A (RFXANK-like), 2 [Source:MGI Symbol;Acc:MGI:1915808])

HSP 1 Score: 106.686 bits (265), Expect = 4.251e-27
Identity = 62/164 (37.80%), Postives = 90/164 (54.88%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAM 636
            K  T LTN  R N  +     ++ +S  Q+A QGE++ L  ++ +    I+ +D+ GFTPLMWA A+ Q   VE L   GA+  +  K  E+AL LA   G+ DIV  LL  G+DVN  D    T L++    NH  C K+LLE GAD T++    + +  +A+
Sbjct:  126 KQSTTLTNKHRGNEVSTTPLLANSLSAHQLAAQGEMLYLATRIEQENV-INHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLENGADPTIETDSGYNSMDLAV 288          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Mouse
Match: Rfxank (regulatory factor X-associated ankyrin-containing protein [Source:MGI Symbol;Acc:MGI:1333865])

HSP 1 Score: 103.219 bits (256), Expect = 3.348e-26
Identity = 63/187 (33.69%), Postives = 95/187 (50.80%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNL 705
            K  T LTN QR N  +        +SI Q+A QGE+  L + L +    I+  D+ GFTPL+WA+A  + + V  L   GA+ +I AK  E+AL LA+  G+ DIV  LL   +D+N  D    T L++    NH  C + LL  GADLT +    +    +A+         V+  ++ ++ +  L
Sbjct:   67 KHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELSQLKDHLRKGNNLINKPDERGFTPLIWASAFGEIETVRFLLDWGADPHILAKERESALSLASMGGYTDIVRLLLDRDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQVMESHILRLFQSTL 253          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Mouse
Match: Rfxank (regulatory factor X-associated ankyrin-containing protein [Source:MGI Symbol;Acc:MGI:1333865])

HSP 1 Score: 97.4413 bits (241), Expect = 6.763e-24
Identity = 63/197 (31.98%), Postives = 95/197 (48.22%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTD----------IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNL 705
            K  T LTN QR N  +        +SI Q+A QGE+  L + L +              I+  D+ GFTPL+WA+A  + + V  L   GA+ +I AK  E+AL LA+  G+ DIV  LL   +D+N  D    T L++    NH  C + LL  GADLT +    +    +A+         V+  ++ ++ +  L
Sbjct:   67 KHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELSQLKDHLRKGACPACTCLSGNNLINKPDERGFTPLIWASAFGEIETVRFLLDWGADPHILAKERESALSLASMGGYTDIVRLLLDRDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQVMESHILRLFQSTL 263          
BLAST of Ankyrin repeat family A protein 2 vs. UniProt/SwissProt
Match: sp|Q9H9E1|ANRA2_HUMAN (Ankyrin repeat family A protein 2 OS=Homo sapiens OX=9606 GN=ANKRA2 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 5.943e-29
Identity = 65/185 (35.14%), Postives = 101/185 (54.59%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIED 699
            K  T LTN  R N  +     ++ +S+ Q+A QGE++ L  ++ +    I+ +D+ GFTPLMWA A+ Q   VE L   GA+  +  K  E+AL LA   G+ DIV  LL  G+DVN  D    T L++    NH  C K+LLE GAD T++    + +  +A+     +   VI  +L +++++
Sbjct:  127 KQSTTLTNKHRGNEVSTTPLLANSLSVHQLAAQGEMLYLATRIEQENV-INHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQN 310          
BLAST of Ankyrin repeat family A protein 2 vs. UniProt/SwissProt
Match: sp|Q2KI79|ANRA2_BOVIN (Ankyrin repeat family A protein 2 OS=Bos taurus OX=9913 GN=ANKRA2 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.302e-28
Identity = 65/185 (35.14%), Postives = 101/185 (54.59%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIED 699
            K  T LTN  R N  +     ++ +S+ Q+A QGE++ L  ++ +    I+ +D+ GFTPLMWA A+ Q   VE L   GA+  +  K  E+AL LA   G+ DIV  LL  G+DVN  D    T L++    NH  C K+LLE GAD T++    + +  +A+     +   VI  +L +++++
Sbjct:  127 KQSTTLTNKHRGNEVSTTPLLANSLSVHQLAAQGEMLYLATRIEQENV-INHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLENGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQN 310          
BLAST of Ankyrin repeat family A protein 2 vs. UniProt/SwissProt
Match: sp|Q99PE2|ANRA2_MOUSE (Ankyrin repeat family A protein 2 OS=Mus musculus OX=10090 GN=Ankra2 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.804e-27
Identity = 64/185 (34.59%), Postives = 98/185 (52.97%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIED 699
            K  T LTN  R N  +     ++ +S  Q+A QGE++ L  ++ +    I+ +D+ GFTPLMWA A+ Q   VE L   GA+  +  K  E+AL LA   G+ DIV  LL  G+DVN  D    T L++    NH  C K+LLE GAD T++    + +  +A+          I  +L +++++
Sbjct:  126 KQSTTLTNKHRGNEVSTTPLLANSLSAHQLAAQGEMLYLATRIEQENV-INHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLENGADPTIETDSGYNSMDLAVALGYRGVQQAIESHLLKLLQN 309          
BLAST of Ankyrin repeat family A protein 2 vs. UniProt/SwissProt
Match: sp|O14593|RFXK_HUMAN (DNA-binding protein RFXANK OS=Homo sapiens OX=9606 GN=RFXANK PE=1 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 7.168e-27
Identity = 65/187 (34.76%), Postives = 96/187 (51.34%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNL 705
            K  T LTN QR N  +        +SI Q+A QGE+  L E L +    ++  D+ GFTPL+WA+A  + + V  L   GA+ +I AK  E+AL LA+  G+ DIV  LL   +D+N  D    T L++    NH  C + LL  GADLT +    +    +A+         VI  ++ ++ + NL
Sbjct:   68 KHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSNL 254          
BLAST of Ankyrin repeat family A protein 2 vs. UniProt/SwissProt
Match: sp|Q9Z205|RFXK_MOUSE (DNA-binding protein RFXANK OS=Mus musculus OX=10090 GN=Rfxank PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 4.731e-23
Identity = 63/197 (31.98%), Postives = 95/197 (48.22%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTD----------IDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNL 705
            K  T LTN QR N  +        +SI Q+A QGE+  L + L +              I+  D+ GFTPL+WA+A  + + V  L   GA+ +I AK  E+AL LA+  G+ DIV  LL   +D+N  D    T L++    NH  C + LL  GADLT +    +    +A+         V+  ++ ++ +  L
Sbjct:   67 KHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELSQLKDHLRKGACPACTCLSGNNLINKPDERGFTPLIWASAFGEIETVRFLLDWGADPHILAKERESALSLASMGGYTDIVRLLLDRDVDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQVMESHILRLFQSTL 263          
BLAST of Ankyrin repeat family A protein 2 vs. TrEMBL
Match: A0A3S5BPY7 (ANK_REP_REGION domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS6332 PE=4 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.323e-63
Identity = 101/205 (49.27%), Postives = 136/205 (66.34%), Query Frame = 1
Query:   82 PRPQCLDIISDKSSNGYKFNNKPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIE 696
            P P  L ++  +        NK  TVLTNVQRRN QT+A     ++++FQMA QGE+I+L  KL  PG  +D  D NGFTP +WA AN QK AVELL Y GA+  ++  NGEN LLLAA  GH D+ LYLLRAG+ V+ SDEL NT+L+F +  NH     LLLEWGADLT++N++ + A+  A+KR + A+  VI +++  I++
Sbjct:   11 PAPDFL-VVKAQKKYASPSPNKISTVLTNVQRRNVQTLAPSACRDLTVFQMAAQGELIMLQSKLGTPGFFVDTQDANGFTPYLWACANGQKAAVELLLYHGADPMLTGDNGENGLLLAASRGHYDVALYLLRAGIPVDVSDELCNTALMFATSANHIAIVSLLLEWGADLTLQNAEGWTAYDFAVKRGSRASQRVIEKHIINILQ 214          
BLAST of Ankyrin repeat family A protein 2 vs. TrEMBL
Match: A0A0R3X9J0 (ANK_REP_REGION domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS10200 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 7.172e-62
Identity = 94/190 (49.47%), Postives = 135/190 (71.05%), Query Frame = 1
Query:  142 NKPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNLYQ 711
            NK  TVLTN+QRRN QT+   +   +SIFQMA QGE++ L  KL+ PG +ID  D+ GF+PL+WA AN QK AVELL +RGAN ++   NGE+ALLLAA  GH D+V YLLRAG+ V+ +DEL+NT+L+F +F+NH     LLL+WGAD+T  N++ + A  +A++R   ++  +I ++L  ++  ++Y 
Sbjct:   29 NKVTTVLTNLQRRNVQTLKVDSQVTLSIFQMAAQGELLQLQAKLDTPGVNIDERDEKGFSPLLWACANGQKAAVELLLFRGANAHVRGVNGESALLLAACRGHYDVVQYLLRAGLPVDIADELDNTALMFAAFHNHVAIVSLLLDWGADVTAVNAEGWDALQIAVRRGARSSQRIIEKHLVTLLTPDMYH 218          
BLAST of Ankyrin repeat family A protein 2 vs. TrEMBL
Match: A0A0R3SFR7 (ANK_REP_REGION domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3701 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 3.889e-61
Identity = 98/189 (51.85%), Postives = 132/189 (69.84%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNLYQ 711
            K  TVLTN+QRRN QT+     + ++IFQMA QGEI LL+ +LN+   +IDV DK GFTPL+WA+AN QK  VELL +RGAN  +   NGE ALLLAA  GH+++V YLLRAG DVN SDEL NT+L+F +FNNH     LLL+WGAD+T +N+D + A  +A +R   A+   I +Y+  ++  + ++
Sbjct:   32 KVTTVLTNLQRRNVQTLKVDTPASLNIFQMAAQGEIFLLETELNKCQANIDVRDKKGFTPLLWASANGQKTVVELLLWRGANAFVRGVNGETALLLAAAKGHQEVVHYLLRAGYDVNDSDELGNTALMFAAFNNHIAMVTLLLDWGADITAQNADGWDALQIARRRKAKASKLAIERYIIGLLSGDRHK 220          
BLAST of Ankyrin repeat family A protein 2 vs. TrEMBL
Match: A0A5K3FP28 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 5.042e-61
Identity = 96/187 (51.34%), Postives = 129/187 (68.98%), Query Frame = 1
Query:  142 NKPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDN 702
            NK  TVLTN+QRRN QT+   + + +SIFQMA QGE++ L  KL  PG D+D  D  GF+PL+WA AN QK AVELL + GAN  I   NGE+ALLL+A  GH D+V YLLRAG+ VN SDEL NT+L+F +F+NH     LLL+WGAD+T  N D + A  +A++R   ++  VI ++L  +++ +
Sbjct:   27 NKVSTVLTNLQRRNVQTLKVDSQAALSIFQMAAQGELLQLQSKLETPGVDVDERDVQGFSPLLWACANGQKSAVELLLFHGANPFIKGVNGESALLLSACRGHYDVVQYLLRAGLPVNTSDELNNTALMFAAFHNHVAIVSLLLDWGADVTATNGDGWDALQLAIRRGARSSQRVIEKHLVSLLQQS 213          
BLAST of Ankyrin repeat family A protein 2 vs. TrEMBL
Match: A0A267GIQ8 (ANK_REP_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034027g1 PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 3.532e-60
Identity = 95/184 (51.63%), Postives = 130/184 (70.65%), Query Frame = 1
Query:  142 NKPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQII 693
            NK  TVLTNVQRRN QT AQ    E+++ Q+A QGE+ LL E++N PG D+D  D+ GF+PL+WA AN Q   VELL Y+GA+LN++A NGE+ LLLAA  GH DIV +LLRAG DVN SDEL NT+L+++++NNH+DC   LL WGADL  +N+D   A+ +  ++        I ++L +++
Sbjct:  102 NKISTVLTNVQRRNIQTTAQFEVRELTLHQLAAQGELNLLQERMNRPGLDLDQQDQKGFSPLLWACANGQTPTVELLLYKGASLNLTADNGESGLLLAACYGHSDIVEHLLRAGADVNQSDELYNTALMYSAYNNHSDCVAKLLRWGADLYAENADRLNAYALCTRKGARQAQLAIEEHLLRLL 285          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Cavefish
Match: ankra2 (ankyrin repeat family A member 2 [Source:NCBI gene;Acc:103023767])

HSP 1 Score: 115.161 bits (287), Expect = 1.899e-30
Identity = 65/184 (35.33%), Postives = 100/184 (54.35%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIE 696
            K  T LTN  R N  +        +SI Q+A QGE++ L  ++ +    I++ D+ GFTPLMWA A+ Q   VE L   GA+ ++ AK  E+AL LA   G+ DIV  L+  G+DVN  D      +++    NH  C ++LLE GAD TM++   F A  +A+   +     V+  +L ++++
Sbjct:  115 KQSTTLTNKHRGNEVSSTPLLVHSLSIHQLAAQGEMVFLASRIEQESV-INLQDEEGFTPLMWAAAHGQIAVVEFLLQTGADPHLLAKGRESALSLACSKGYTDIVRMLIDCGVDVNEYDWNGGAPILYAVHGNHVRCVEILLESGADPTMESDSGFNAMDMAVAMGHRHVQQVMEAHLLKLLQ 297          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Cavefish
Match: rfxank (regulatory factor X associated ankyrin containing protein [Source:NCBI gene;Acc:103042807])

HSP 1 Score: 91.6633 bits (226), Expect = 1.596e-22
Identity = 55/161 (34.16%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  154 TVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAM 636
            T LTN  R N  TV       +SI Q+A  GE+  +   L+   + ++  D+ GFTPLMWA A  + + V+ L  +GA+    A+  E+AL LA+  G  DIV  LL   +D++  D    T L++    NH  C + LL  GAD+T +    +    +A+
Sbjct:   14 TTLTNKHRGNEVTVRPATLDHLSIHQLAAHGEMAQMKMHLDSDMSLLNSQDERGFTPLMWAAAFGEIEMVQFLLEKGADPRTFARERESALSLASACGFADIVNILLEHKVDIDSYDWNGGTPLLYAVRGNHMRCVEYLLGHGADITFEADSGYSPVALAV 174          

HSP 2 Score: 52.7582 bits (125), Expect = 3.756e-8
Identity = 37/107 (34.58%), Postives = 56/107 (52.34%), Query Frame = 1
Query:  187 QTVAQQNSSEISIFQMAGQGEI--ILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHK-------DIVLYLLRA 480
            +T A++  S +S+    G  +I  ILL+ K+     DID  D NG TPL++A   N  + VE L   GA++   A +G + + LA   G+K       D +L LLR+
Sbjct:   94 RTFARERESALSLASACGFADIVNILLEHKV-----DIDSYDWNGGTPLLYAVRGNHMRCVEYLLGHGADITFEADSGYSPVALAVALGYKKMQKLLEDHILKLLRS 195          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Cavefish
Match: ankrd2 (ankyrin repeat domain 2 [Source:NCBI gene;Acc:103042132])

HSP 1 Score: 76.6406 bits (187), Expect = 3.632e-16
Identity = 44/136 (32.35%), Postives = 76/136 (55.88%), Query Frame = 1
Query:  220 SIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFH 627
            ++ + A QG ++++ ++L + G DI+  D+   T L WA    + +A+++L  RGANLNI  K     L +A + GH ++V +LL +G+ +N  D   +T+L      N     KLL+  GAD+ +KN++   A  
Sbjct:  148 ALHRAAFQGHVMII-KRLLDKGADINFQDRLDCTALHWACRGGRLEALKILQGRGANLNIRDKLMSTPLHVATRTGHSEVVEHLLASGVKINAQDREGDTALHDAIRLNRYKIVKLLILAGADMKLKNAEGITAIE 282          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Cavefish
Match: kidins220a (kinase D-interacting substrate of 220 kDa [Source:NCBI gene;Acc:103043425])

HSP 1 Score: 77.411 bits (189), Expect = 6.356e-16
Identity = 43/140 (30.71%), Postives = 77/140 (55.00%), Query Frame = 1
Query:  220 SIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK 639
            ++   A +G + ++ E L+    +++  D  G+T LMWA    + +   LL  +GAN +I+ +     ++ AA  GH +IV  LL+ G  VN SD+   T+LI+ +   H +C   LLE GA++  + +++  A  VA++
Sbjct:   82 ALVSAAKEGHVEVVKELLDN-NANVEHRDMGGWTALMWAAYKGRVEVARLLLEKGANPSITGQYSVYPIIWAAGRGHAEIVRLLLQHGAKVNCSDKYGTTALIWAARKGHYECVMHLLENGANVDQEGANSMTALIVAVR 220          

HSP 2 Score: 67.781 bits (164), Expect = 1.286e-12
Identity = 44/135 (32.59%), Postives = 67/135 (49.63%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQ 675
            L E G ++D    N  T L+ A      + V+ L  R  N+N++ K+G  AL++AA  GH +IV  LL A   VN  D   +T LI      H +  + LL   AD+ +K  D+  A + ++++ N   V  I Q
Sbjct:  197 LLENGANVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAIEGHTEIVEDLLDADTYVNIPDRSGDTVLIAAVRGGHVEIVRALLHKYADIDVKGQDSKTALYWSVEKGNATMVRDILQ 331          

HSP 3 Score: 63.929 bits (154), Expect = 2.168e-11
Identity = 41/145 (28.28%), Postives = 67/145 (46.21%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNL 705
            L E G +  ++ +    P++WA      + V LL   GA +N S K G  AL+ AA+ GH + V++LL  G +V+       T+LI      + +  K LL+   ++ M + D   A  +A    +           T+I+ED L
Sbjct:  131 LLEKGANPSITGQYSVYPIIWAAGRGHAEIVRLLLQHGAKVNCSDKYGTTALIWAARKGHYECVMHLLENGANVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAIEGH-----------TEIVEDLL 264          

HSP 4 Score: 63.1586 bits (152), Expect = 4.013e-11
Identity = 38/134 (28.36%), Postives = 69/134 (51.49%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            ++D   +NG TPLM A      + V+ L  RGAN+N+   +   AL+ AA+ GH ++V  LL    +V + D    T+L++ ++    +  +LLLE GA+ ++    +      A  R +   V ++ Q+  ++
Sbjct:   38 EVDSRSENGQTPLMAAAEQGSLEIVQELIRRGANVNLDDVDCWTALVSAAKEGHVEVVKELLDNNANVEHRDMGGWTALMWAAYKGRVEVARLLLEKGANPSITGQYSVYPIIWAAGRGHAEIVRLLLQHGAKV 171          

HSP 5 Score: 48.521 bits (114), Expect = 2.912e-6
Identity = 33/141 (23.40%), Postives = 70/141 (49.65%), Query Frame = 1
Query:  217 ISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK 639
            + I  + G  EI+   E L +  T +++ D++G T L+ A      + V  L ++ A++++  ++ + AL  + + G+  +V  +L+   D     +   T LI  +   + +  +LLL+ GA ++  +     A H+A+K
Sbjct:  248 LMIAAIEGHTEIV---EDLLDADTYVNIPDRSGDTVLIAAVRGGHVEIVRALLHKYADIDVKGQDSKTALYWSVEKGNATMVRDILQCNPDTEACTKDGETPLIKATKMRNIEIVELLLDKGAKVSAVDKKGDTALHIAIK 385          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Cavefish
Match: kidins220a (kinase D-interacting substrate of 220 kDa [Source:NCBI gene;Acc:103043425])

HSP 1 Score: 77.411 bits (189), Expect = 6.543e-16
Identity = 43/140 (30.71%), Postives = 77/140 (55.00%), Query Frame = 1
Query:  220 SIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK 639
            ++   A +G + ++ E L+    +++  D  G+T LMWA    + +   LL  +GAN +I+ +     ++ AA  GH +IV  LL+ G  VN SD+   T+LI+ +   H +C   LLE GA++  + +++  A  VA++
Sbjct:   82 ALVSAAKEGHVEVVKELLDN-NANVEHRDMGGWTALMWAAYKGRVEVARLLLEKGANPSITGQYSVYPIIWAAGRGHAEIVRLLLQHGAKVNCSDKYGTTALIWAARKGHYECVMHLLENGANVDQEGANSMTALIVAVR 220          

HSP 2 Score: 67.781 bits (164), Expect = 1.299e-12
Identity = 44/135 (32.59%), Postives = 67/135 (49.63%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQ 675
            L E G ++D    N  T L+ A      + V+ L  R  N+N++ K+G  AL++AA  GH +IV  LL A   VN  D   +T LI      H +  + LL   AD+ +K  D+  A + ++++ N   V  I Q
Sbjct:  197 LLENGANVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAIEGHTEIVEDLLDADTYVNIPDRSGDTVLIAAVRGGHVEIVRALLHKYADIDVKGQDSKTALYWSVEKGNATMVRDILQ 331          

HSP 3 Score: 63.929 bits (154), Expect = 2.149e-11
Identity = 41/145 (28.28%), Postives = 67/145 (46.21%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNL 705
            L E G +  ++ +    P++WA      + V LL   GA +N S K G  AL+ AA+ GH + V++LL  G +V+       T+LI      + +  K LL+   ++ M + D   A  +A    +           T+I+ED L
Sbjct:  131 LLEKGANPSITGQYSVYPIIWAAGRGHAEIVRLLLQHGAKVNCSDKYGTTALIWAARKGHYECVMHLLENGANVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALMIAAIEGH-----------TEIVEDLL 264          

HSP 4 Score: 63.1586 bits (152), Expect = 3.978e-11
Identity = 38/134 (28.36%), Postives = 69/134 (51.49%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            ++D   +NG TPLM A      + V+ L  RGAN+N+   +   AL+ AA+ GH ++V  LL    +V + D    T+L++ ++    +  +LLLE GA+ ++    +      A  R +   V ++ Q+  ++
Sbjct:   38 EVDSRSENGQTPLMAAAEQGSLEIVQELIRRGANVNLDDVDCWTALVSAAKEGHVEVVKELLDNNANVEHRDMGGWTALMWAAYKGRVEVARLLLEKGANPSITGQYSVYPIIWAAGRGHAEIVRLLLQHGAKV 171          

HSP 5 Score: 48.521 bits (114), Expect = 3.050e-6
Identity = 33/139 (23.74%), Postives = 69/139 (49.64%), Query Frame = 1
Query:  223 IFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK 639
            I  + G  EI+   E L +  T +++ D++G T L+ A      + V  L ++ A++++  ++ + AL  + + G+  +V  +L+   D     +   T LI  +   + +  +LLL+ GA ++  +     A H+A+K
Sbjct:  250 IAAIEGHTEIV---EDLLDADTYVNIPDRSGDTVLIAAVRGGHVEIVRALLHKYADIDVKGQDSKTALYWSVEKGNATMVRDILQCNPDTEACTKDGETPLIKATKMRNIEIVELLLDKGAKVSAVDKKGDTALHIAIK 385          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Sea Lamprey
Match: ankra2 (ankyrin repeat, family A (RFXANK-like), 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2141])

HSP 1 Score: 109.768 bits (273), Expect = 3.643e-29
Identity = 71/185 (38.38%), Postives = 98/185 (52.97%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIED 699
            K  T LTN QR N  +      +++S+ Q+A QGE+  L  +L++ G  +DV D+ G TPLMWA A+ Q   VELL  +GA     A+  ENAL LA  +GH DI   LL  G DVN  D    T L++    NH  C +LLL  GAD+  +      A  +A    +      I +YL Q+++D
Sbjct:  116 KHSTALTNKQRGNEVSNTPGLLAKLSLHQLAAQGELQNLTIRLDQDGM-VDVMDERGLTPLMWAAAHGQIAVVELLLKKGACAFAVARERENALSLACTSGHADIAHMLLLRGADVNVYDWNGGTPLLYAVHGNHVRCVELLLNSGADVMSETEAGLNALELAAALGHRTAQTAIEKYLLQMLQD 299          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007954.1 (pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gene:ENSPMAG00000007165.1 transcript:ENSPMAT00000007954.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 2.447e-14
Identity = 42/140 (30.00%), Postives = 71/140 (50.71%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDN 702
              D++  DKN  TPL  A+AN   +  + L    +N+N+S + G  AL  AA NG+ ++V  L+  G +VN  D+ E  ++ +  +  H +  K+LL  GAD+  K+   +   H A    +V  V ++     ++ E N
Sbjct:    4 AADVNARDKNWQTPLHVASANRAIKCADALIPLLSNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFN 143          

HSP 2 Score: 64.3142 bits (155), Expect = 3.684e-12
Identity = 42/126 (33.33%), Postives = 61/126 (48.41%), Query Frame = 1
Query:  286 TDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVN 663
            ++++VSD+ G T L  A  N   + V LL  +GAN+N   K    A+  A   GH ++V  LL  G DVN+ D+   T L   + + H    +LLL   A++   N     A HVA      A V+
Sbjct:   38 SNVNVSDRAGRTALHHAAFNGNLEMVNLLISKGANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVS 163          

HSP 3 Score: 61.6178 bits (148), Expect = 2.950e-11
Identity = 40/117 (34.19%), Postives = 58/117 (49.57%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNH-ADCCKLLLEWGADLTMKNSDNFCAFHV 630
            G D++  DK G+TPL  A A+     V LL    A +N     G  AL +A  NG   +V  LL AG D  + +E   T+L F + + H A C +LL+   AD+  ++ D     H+
Sbjct:  103 GADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFAAASTHGAICLELLVNHHADVNAQSYDGKSPLHM 219          

HSP 4 Score: 59.3066 bits (142), Expect = 1.503e-10
Identity = 42/120 (35.00%), Postives = 55/120 (45.83%), Query Frame = 1
Query:  265 EKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAF 624
            + L + G +ID  DK G TPL  A     +  +  L   GA+      +G   L LAA +G  D    LL  G DV+  DE   T L   +   +A+C  LLL  GADL  K+     AF
Sbjct:  230 QTLIQNGGEIDCGDKEGNTPLHIAARYGHELLINTLISNGADAARRGSHGMFPLHLAALSGFSDCCRKLLTPGFDVDAVDEFGRTCLHAAAAGGNAECINLLLSSGADLGKKDRYGSIAF 349          

HSP 5 Score: 54.6842 bits (130), Expect = 5.030e-9
Identity = 35/117 (29.91%), Postives = 52/117 (44.44%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVA 633
            G +++  DK     + WA      + V++L   GA++N   K G   L  AA +GH  +V  LL    ++N  +   NT+L     N        LL+ GAD   +N   F A H A
Sbjct:   70 GANVNAMDKRERRAVHWAGYMGHTEVVKMLLSNGADVNWKDKKGYTPLHAAAASGHVTVVRLLLSLKAEMNEFNGFGNTALHVACHNGQDAVVSELLDAGADAGHRNERGFTALHFA 186          

HSP 6 Score: 48.1358 bits (113), Expect = 8.531e-7
Identity = 37/123 (30.08%), Postives = 57/123 (46.34%), Query Frame = 1
Query:  304 DKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLR-AGMDVNYSDELENTSLIFTSFNNHADCCKLLL---EWGADLTMKNSDNFCAFHVAMKRNNVATV 660
            D  G TPL  A   +  +  +LL   GA ++ + + G   L+  A  G   IV YL+     D++ +D+ +NT+L       H  C  LLL   E  A +   N +     H+A  RN ++TV
Sbjct:  717 DGKGRTPLHAAAFADNVECAQLLLSHGARVDATDRRGRTPLMTGALQGQSGIVEYLVNNTKGDLSLTDDKKNTALHLACGKGHETCALLLLEKVEVVALIDCPNRNQHTPLHLA-ARNGLSTV 838          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 6.292e-14
Identity = 49/157 (31.21%), Postives = 80/157 (50.96%), Query Frame = 1
Query:  193 VAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNI-SAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNF--------CAFHVAM 636
            V  Q+S+  +    A  G  + +   L E G +++  +++G TPLM A +    +   LL  RGA +N  S +  E+AL LA   GH ++V +LL AG D  +  +  +T+L+    + H +  +LLLE GA + M  +D+F        C  HV +
Sbjct:  193 VNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMP-ADSFESPLTLAACGGHVEL 348          

HSP 2 Score: 66.6254 bits (161), Expect = 6.617e-13
Identity = 58/201 (28.86%), Postives = 87/201 (43.28%), Query Frame = 1
Query:  169 VQRRNFQTVAQQN---SSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNI-SAKNGENALLLA------------------------------AQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            V R   ++ AQ N    S  S   +A  G  + L   L E G +++  +  G+TPLM A     ++ V LL  +GAN+N  + +  E AL LA                              AQ GH ++V YLL AG +V+ +    +T+L +   N H D   LLL+ GADL  ++         A +  +V TV  +
Sbjct:  315 VARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFL 515          

HSP 3 Score: 62.3882 bits (150), Expect = 1.739e-11
Identity = 42/160 (26.25%), Postives = 70/160 (43.75%), Query Frame = 1
Query:  214 EISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVN-YSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            +I+    A  G  + +   L   G D++     G T L +A A      V +L   GANL    ++G   L+ AA  GH ++   LL  G  +N +S+E + ++L    +  H +  + LLE GAD   K  +   A   A    +V    ++ +   Q+
Sbjct:  167 DITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQV 326          

HSP 4 Score: 61.6178 bits (148), Expect = 2.620e-11
Identity = 39/139 (28.06%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  196 AQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDN 612
            AQ   ++ +   +A  G  + + + L + G D+++      TPLM A      + V+ L   GAN++ +   G+ AL  A +NGH D+   LL+AG D+ +  E   T L+  +   H    + L+  GAD+    ++N
Sbjct:  394 AQTEETQETALTLACCGGFLEVADFLIKAGADLELGCS---TPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANN 529          

HSP 5 Score: 59.3066 bits (142), Expect = 1.864e-10
Identity = 40/119 (33.61%), Postives = 62/119 (52.10%), Query Frame = 1
Query:  265 EKLNEPGTDIDV-SDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVN--YSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDN 612
            E L + G DI+  S++   TPL  A +  +++ VELL  RGAN      +    L LAA  G+ +I+  LL AG ++N     +L  + L+  + N H    KLLL+ G+D+  +   N
Sbjct:  983 ELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETN 1101          

HSP 6 Score: 58.151 bits (139), Expect = 4.415e-10
Identity = 44/177 (24.86%), Postives = 83/177 (46.89%), Query Frame = 1
Query:  181 NFQTVAQQNSS-EISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISA--KNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDN 702
            N Q    +N++  ++ FQ  G+ E++ L   L E   +++   K G TPLM A +    +   +L  RGA++N +    + + AL +AA  GH      ++  G  ++  ++  NT L   +   H D  +LL+  GAD+   ++        A ++ +V  V  + + + Q   D+
Sbjct: 1095 NAQIETNRNTALTLACFQ--GRHEVVSL---LVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLVKEVNQFPSDS 1266          

HSP 7 Score: 56.225 bits (134), Expect = 1.960e-9
Identity = 33/101 (32.67%), Postives = 51/101 (50.50%), Query Frame = 1
Query:  307 KNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSD 609
            K   TPLM A +      V LL   GA++N  +  G  AL  A   G+ D+V  LL AG ++   +E  +T L+  +   H +  +LLLE GA +   +++
Sbjct:  165 KGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNE 265          

HSP 8 Score: 50.8322 bits (120), Expect = 1.222e-7
Identity = 37/130 (28.46%), Postives = 60/130 (46.15%), Query Frame = 1
Query:  289 DIDV--SDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVN-YSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            DID   ++ N  T L  A A   +  V +L  RGAN+    K G   L+LAA  GH ++V  LL  G D+   S+  ++T L         +  +LL+  GA+   +N  ++    +A     V  + ++
Sbjct:  923 DIDCIHTESNHDTALTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKIL 1052          

HSP 9 Score: 50.447 bits (119), Expect = 1.364e-7
Identity = 41/153 (26.80%), Postives = 67/153 (43.79%), Query Frame = 1
Query:  223 IFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSD-ELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            + + A +G + L+ + L   G ++  +   G T L +A  N      +LL   GA+L   ++ G   L+ AA+ GH   V +L+  G DVN +    ++T L       H    +LLL  GAD   +  D       A K  + + V  +  Y
Sbjct:  434 LMEAAQEGHLELV-KYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLIDY 585          

HSP 10 Score: 50.0618 bits (118), Expect = 2.136e-7
Identity = 42/168 (25.00%), Postives = 75/168 (44.64%), Query Frame = 1
Query:  136 FNNKPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSD--KNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVA 633
            F  +   V   V+R+    V  +  + ++    A  G    +   L E G D++ +    +  T L  A      +  EL+  RGA++++  K G   L LAA  GH D+V  L+ +G DV+ +D  + T L+      H    + L++   ++    SD+ C  ++A
Sbjct: 1111 FQGRHEVVSLLVERK--ANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLVK---EVNQFPSDSECMRYIA 1273          

HSP 11 Score: 48.1358 bits (113), Expect = 8.335e-7
Identity = 38/130 (29.23%), Postives = 63/130 (48.46%), Query Frame = 1
Query:  211 SEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLN--ISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDEL-ENTSLIFTSFNNHADCCKLLLEWGADL 591
            + +S+    G+ E++   E L   G + +  + + +TPL  A +      +++L   GA +N    +K G + L+LAA NGH   V  LL  G D+N   E   NT+L    F    +   LL+E  A++
Sbjct: 1002 TPLSLACSGGRQEVV---ELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANV 1128          

HSP 12 Score: 46.595 bits (109), Expect = 2.650e-6
Identity = 32/108 (29.63%), Postives = 53/108 (49.07%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALL-LAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADL 591
            L + G D++   + G TPLM A        V+ L  +GA++N +  N ++ +L LA   GH  +V  LL  G D N+  +  +T LI  +   H      L+++  +L
Sbjct:  482 LLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLIDYPHNL 589          

HSP 13 Score: 45.8246 bits (107), Expect = 5.483e-6
Identity = 31/113 (27.43%), Postives = 52/113 (46.02%), Query Frame = 1
Query:  271 LNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSD 609
            L E G D +       T LM A  +   +   LL   GA +N+ A + E+ L LAA  GH ++   L+  G ++   ++   T L+  +   H +   LLL  GA++  +  +
Sbjct:  286 LLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEE 398          

HSP 14 Score: 45.0542 bits (105), Expect = 8.475e-6
Identity = 36/129 (27.91%), Postives = 59/129 (45.74%), Query Frame = 1
Query:  220 SIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGE-NALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKN 603
            S+ +    G++  + + L E G  +  + + G + L  A +    +  ++L    AN+      G+   L+ AA  G  DIV  LL  G DVN      NT+L +     + D  ++LLE GA+L   N
Sbjct:  103 SLAEACSDGDVNAVRKLLGE-GRSVHETTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHN 230          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009528.1 (pep scaffold:Pmarinus_7.0:GL478737:432:18044:-1 gene:ENSPMAG00000008612.1 transcript:ENSPMAT00000009528.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 1.805e-13
Identity = 44/130 (33.85%), Postives = 72/130 (55.38%), Query Frame = 1
Query:  235 AGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAG-MDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMK-NSDNFC 618
            A +G + +L   L + G +ID  D++  TPL+ A  +NQ  +   L   GA +      G   L LAA+ G+ ++V YL+  G +++N  D+   T +I+T+   H D  +LLL  GAD+T++ N +N C
Sbjct:  573 AERGHVEVL-HTLVQAGGNIDACDQDQKTPLLQAAESNQLASTRYLVKAGAYVAHKDDEGATCLHLAAKKGNLEVVQYLVSTGKVNINCQDDGGWTPVIWTAEYKHVDVVRLLLSRGADVTLRDNEENIC 701          

HSP 2 Score: 54.6842 bits (130), Expect = 6.322e-9
Identity = 36/140 (25.71%), Postives = 66/140 (47.14%), Query Frame = 1
Query:  193 VAQQNSSEISIFQMAGQ-GEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSD 609
            VA ++    +   +A + G + ++   ++    +I+  D  G+TP++W         V LL  RGA++ +        L  AA  G  DI    + A  D++ ++   +T L   S  NH +C  LLL  GA++ ++N +
Sbjct:  624 VAHKDDEGATCLHLAAKKGNLEVVQYLVSTGKVNINCQDDGGWTPVIWTAEYKHVDVVRLLLSRGADVTLRDNEENICLHWAAFAGSVDIAEEFINAQCDLHAANLHGDTPLHIASRENHYECVVLLLARGANVDVRNKE 763          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 2.119e-13
Identity = 36/127 (28.35%), Postives = 66/127 (51.97%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            D++  DKN  TPL  A AN   +  E +    ++ N+S + G  AL  AA NGH ++V +L+  G ++N  D+ +  ++ + ++  H +  K+L+  GAD+  K+   +   H A     +  V ++
Sbjct:   97 DVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLL 223          

HSP 2 Score: 60.4622 bits (145), Expect = 6.496e-11
Identity = 42/123 (34.15%), Postives = 56/123 (45.53%), Query Frame = 1
Query:  295 DVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVN 663
            +VSD+ G T L  A  N   + V  L  +GAN+N   K    A+  AA  GH ++V  L+  G DV   D+   + L   S +      KLLL+ G D+   NS    A HVA        VN
Sbjct:  132 NVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVN 254          

HSP 3 Score: 60.077 bits (144), Expect = 8.747e-11
Identity = 44/165 (26.67%), Postives = 78/165 (47.27%), Query Frame = 1
Query:  184 FQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGE--NALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNS-DNFCAFHVAMKRNNVATVNVI 669
            + T++ Q  S I +     + +I L  E L     D  + DK G+TP+ +A A   +  +ELL  +        K+G   + L LAA +GH   +  L+R+ +D++  +    T L   +   H DC ++L++ GA + +K   D   A H A    +V  + ++
Sbjct:  509 YNTISVQ--SYIDVHSTCSEAQICL--EHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLL 669          

HSP 4 Score: 58.9214 bits (141), Expect = 2.476e-10
Identity = 43/134 (32.09%), Postives = 62/134 (46.27%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNI-SAKNGENALLLAAQNGHKDIVLYLLRAGMD----VNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQ 675
            D+DV + NG+TPL  A        V +L   GA++ +    +   AL  AA NGH +  L LL    D    V+ SD  E T ++    N H DC  LLL  GA +  K++    A H      +   V+++ Q
Sbjct:  608 DLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVE-CLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQ 740          

HSP 5 Score: 53.5286 bits (127), Expect = 1.515e-8
Identity = 37/139 (26.62%), Postives = 59/139 (42.45%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKR-----------NNVATVNV 666
            G +I+  DK     + WA      + V++L   GA++    K G + L  A+ +G   +V  LL  G+D++  +   NT+L    +N        L++ GA++   N   F   H A              NN A VNV
Sbjct:  161 GANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNV 299          

HSP 6 Score: 53.5286 bits (127), Expect = 1.515e-8
Identity = 38/127 (29.92%), Postives = 59/127 (46.46%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGM----DVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDN-FCAFHVAMKRNN 648
            G  I+  D  G T L    A   ++ V+LL  R  ++++  + G   L +AA  GH  I+  L++A M     +  +D    T L +  +N H  C +LLLE   D+  K   N F   H A+  +N
Sbjct:  709 GASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLE--LDVFQKQEGNAFSPLHCAVLNDN 833          

HSP 7 Score: 51.2174 bits (121), Expect = 7.434e-8
Identity = 35/131 (26.72%), Postives = 68/131 (51.91%), Query Frame = 1
Query:  244 GEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQ-AVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVA 633
            G+ ++++E L + G +++ +++ GFTPL +A A+      +ELL   GA++N+ +K+G++ L + A +G       L++ G +++  D   NT L   +   H      L+  GAD   +        H+A
Sbjct:  248 GQDVVVNE-LIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLA 377          

HSP 8 Score: 50.447 bits (119), Expect = 1.534e-7
Identity = 41/150 (27.33%), Postives = 61/150 (40.67%), Query Frame = 1
Query:  265 EKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVL------------------YLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATV 660
            + L + G +ID  D++G TPL  A     +  +  L   GA+      +G   L LAA +G  D                     ++L AG +++  DE   T L   +   + +C  LLL  GAD+  K+     A H A    NV  V
Sbjct:  321 QTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCV 470          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 53.1434 bits (126), Expect = 1.122e-8
Identity = 39/111 (35.14%), Postives = 52/111 (46.85%), Query Frame = 1
Query:  304 DKNGFTPLMWATANNQKQAVELLTYRGA-NLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYS--DELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFH 627
            D  G T L  A    +   V+ +   G  ++N     G  AL  AA  GH +IV  L+  G DVN    +   +T LI  S N H D  K LL+ GAD T++N+    AF 
Sbjct:  327 DSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFE 437          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 46.9802 bits (110), Expect = 1.204e-6
Identity = 28/108 (25.93%), Postives = 53/108 (49.07%), Query Frame = 1
Query:  319 TPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLL-----RAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFH 627
            TPL WA        V+ L   GA+  ++   G N L L+  + +  +VLY+L     +  +D++  D    TSL++ ++   +     LL++GA + + +++ F   H
Sbjct:  145 TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLH 252          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 67.0106 bits (162), Expect = 7.525e-14
Identity = 45/129 (34.88%), Postives = 66/129 (51.16%), Query Frame = 1
Query:  265 EKLNEPGTDIDVSDKNGF---TPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAG-MDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK 639
            + L + G D+DV          P++ A   N  ++  +L   GA++NI+   G+ AL  A + GH  +V  LLR G MDVN  D    TSL   +        K LL  GA++T K++D F AFH+A +
Sbjct:   46 QMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAR 174          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Nematostella
Match: EDO28178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T774])

HSP 1 Score: 62.003 bits (149), Expect = 7.704e-12
Identity = 50/165 (30.30%), Postives = 73/165 (44.24%), Query Frame = 1
Query:  157 VLTNVQRRNFQTVAQQNSSEISIFQMAGQGEI--ILLDEKLNEPGTDIDV-SDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELEN-TSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK 639
            V TN  R        +N+  +S   +AG  ++  +LLD      G +I+V SD N  +PL +A        VELL  R AN+    K G   L+ AA  GH D+   LL  G  VN      N   L    +  H D  KLLL++ +++  +  D      +A +
Sbjct:   37 VPTNTNREYCHAKILENNKTMSRDALAGHVKVATMLLDH-----GAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTPLMLAAR 196          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Nematostella
Match: EDO30279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T193])

HSP 1 Score: 61.6178 bits (148), Expect = 3.721e-11
Identity = 35/106 (33.02%), Postives = 59/106 (55.66%), Query Frame = 1
Query:  355 QAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIR 672
            + V+LL    A+LNI+ K+G   LL+A Q+GH++IV  LL  G  VN +D  + T+L++ S      C + LL+ GA+  + +S +  A   A    +   + +I+
Sbjct:    6 EVVQLLVGCNASLNITDKDGRTPLLMAIQSGHEEIVCLLLDKGAKVNIADNAKKTALMYASLLGLTKCVETLLKRGANSRLVDSQSHTAEDYARIGGHKEVIAIIK 111          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Nematostella
Match: EDO49837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RER7])

HSP 1 Score: 60.8474 bits (146), Expect = 6.267e-11
Identity = 36/123 (29.27%), Postives = 66/123 (53.66%), Query Frame = 1
Query:  205 NSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNI-SAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLL 570
            N +E  + +   +G +      L+  G +++ +D++G TPLM A    Q + VELL   GA++N  S ++G + L+  A +G+  +V  LL+AG  V+  +++  T+    +F  H D   L+
Sbjct:    5 NETEKQLIKHINKGSVAESKAILSSDGVNVNCTDESGMTPLMHAAYKGQIEIVELLLAHGADINSRSHESGYSTLMFGALSGNIGVVKILLQAGASVSKVNDIGRTAAQMAAFVGHHDVVSLI 127          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Nematostella
Match: EDO43228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ60])

HSP 1 Score: 56.6102 bits (135), Expect = 1.926e-10
Identity = 35/102 (34.31%), Postives = 54/102 (52.94%), Query Frame = 1
Query:  307 KNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDN 612
            KNGF P +           E L   G+ +N+    G NAL LAA+ G ++I+ YLL+ G +    D+   + L+   ++    C K+LLE+GAD T K+ D+
Sbjct:   19 KNGFLPTV----------QEHLRKPGSEVNMVIDAGRNALHLAAEAGRENILRYLLQHGANPLVEDDTGVSPLLIAIWHGDVTCVKVLLEFGADPTGKSPDD 110          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Medaka
Match: ankra2 (ankyrin repeat family A member 2 [Source:NCBI gene;Acc:101158120])

HSP 1 Score: 118.242 bits (295), Expect = 1.530e-31
Identity = 70/183 (38.25%), Postives = 101/183 (55.19%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQII 693
            K  T LTN  R N  +        +SI Q+A QGE++ L  ++ E  T I++ D+ GFTPLMWA A+ Q   VE L   GA+ ++ AK  E+AL LA   G+ DIV  L+  G+DVN  D    T L++    NH  C ++LLE GAD TM++   F A  +A+   +     VI  +L +++
Sbjct:  125 KQSTTLTNKHRGNEVSSTPLLVHSLSIHQLAAQGEMVFLASRI-EQETVINLKDEEGFTPLMWAAAHGQIAVVEFLLQNGADPHLLAKGRESALSLACTKGYTDIVKMLIDCGVDVNEYDWNGGTPLLYAVHGNHVRCVEILLESGADPTMESDSGFNAMDMAVAMGHRNVQQVIEGHLLKLL 306          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Medaka
Match: rfxank (regulatory factor X associated ankyrin containing protein [Source:NCBI gene;Acc:101167861])

HSP 1 Score: 110.538 bits (275), Expect = 1.051e-29
Identity = 60/170 (35.29%), Postives = 95/170 (55.88%), Query Frame = 1
Query:  154 TVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVN 663
            T LTN QR N  +V       +S+ Q+A QGE+  +  +L++  + +   D+ GFTPLMWA A  +K  V+ L  +GA+    A+  E+AL LA+  G+ DIV  LLR G+D+N  D    T L++    NH  C + LL  GAD+T+++   +    +A+   +  ++N
Sbjct:   14 TALTNKQRGNEVSVRPATLDSLSMHQLAAQGEVSQVAARLSKDSSLLSRQDERGFTPLMWAAAFGEKAVVDFLLEKGADPKTIARERESALTLASSGGYVDIVESLLRHGVDINTYDWNGGTPLLYAVRGNHVKCVEALLAKGADMTIESDSGYSPMALAVALGHKKSMN 183          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Medaka
Match: rfxank (regulatory factor X associated ankyrin containing protein [Source:NCBI gene;Acc:101167861])

HSP 1 Score: 100.908 bits (250), Expect = 4.362e-26
Identity = 63/183 (34.43%), Postives = 104/183 (56.83%), Query Frame = 1
Query:  145 KPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSD-ELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAM----KRNNVATVNVIRQY 678
            K  T LTN QR N  +V +  + ++S+ Q+A QGE+  +  +L++    +   D+ GFTPLMWA A  +K  V+ L  +GA+    A+  E+AL LA+  G+ DIV  LLR G+D+N  D +   T L++    NH  C + LL+ GAD+T+++   +    +A+    K+  V   ++++ Y
Sbjct:    4 KHSTALTNKQRGNEVSV-RPATLDLSMHQLAAQGEVSQVAARLSKSSL-LSRQDERGFTPLMWAAAFGEKAVVDFLLEKGADPKTIARERESALTLASSGGYVDIVESLLRHGVDINTYDWQNGGTPLLYAVRGNHVKCVEALLK-GADMTIESDSGYSPMALAVALGHKKQKVLEDHILKLY 183          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Medaka
Match: ENSORLT00000022720.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 81.2629 bits (199), Expect = 3.099e-17
Identity = 48/140 (34.29%), Postives = 75/140 (53.57%), Query Frame = 1
Query:  220 SIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK 639
            ++   A +G I ++ E L E   +++  D  G+T LMWA    +    ELL  +GAN NI+ +     ++ AA  GH +IV  LL+ G  VN SD+   T LI+ +   H DC   LL  GAD+  + +++  A  VA++
Sbjct:   82 ALISAAKEGHIEVVRELL-ENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVR 220          

HSP 2 Score: 70.0922 bits (170), Expect = 1.836e-13
Identity = 44/131 (33.59%), Postives = 64/131 (48.85%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQ 675
            G D+D    N  T L+ A      + V+ L  R  N+N++ K+G  AL +AA+ GH +IV  LL AG  VN  D    T LI      H +  + LL   AD+ ++  D   A + A+++ N   V  I Q
Sbjct:  201 GADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQ 331          

HSP 3 Score: 69.3218 bits (168), Expect = 3.891e-13
Identity = 40/132 (30.30%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  265 EKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATV 660
            E L E G + +++ +    P++WA      + V LL   GA +N S K G   L+ AA+ GH D V++LL  G DV+       T+LI      + +  K LL+   ++ M + D   A  +A K  +   V
Sbjct:  129 ELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIV 260          

HSP 4 Score: 59.3066 bits (142), Expect = 8.691e-10
Identity = 37/134 (27.61%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            D+D    NG TPLM A      + V+    RGAN+++   +   AL+ AA+ GH ++V  LL    ++ + D    T+L++ ++    D  +LLLE GA+  +    +      A  R +   V+++ Q+  ++
Sbjct:   38 DVDSRSDNGQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCWTALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKV 171          

HSP 5 Score: 50.447 bits (119), Expect = 7.631e-7
Identity = 34/143 (23.78%), Postives = 71/143 (49.65%), Query Frame = 1
Query:  211 SEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK 639
            + ++I    G  EI+   + L + GT +++ D+NG T L+ A      + V  L  + A++++  ++G+ AL  A + G+  +V  +L+   D     +   T LI  +   + +  +LLL+ GA ++  +       H+A++
Sbjct:  246 TALAIAAKEGHTEIV---QDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIAIR 385          

HSP 6 Score: 48.521 bits (114), Expect = 3.447e-6
Identity = 30/103 (29.13%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADL 591
            G ++D+ D + +T L+ A      + V  L    ANL      G  AL+ AA  G  D+   LL  G + N + +     +I+ +   HA+   LLL+ GA +
Sbjct:   69 GANVDLDDVDCWTALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKV 171          

HSP 7 Score: 48.1358 bits (113), Expect = 4.491e-6
Identity = 38/159 (23.90%), Postives = 74/159 (46.54%), Query Frame = 1
Query:  193 VAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            V Q+ ++ ++   +A +G    + ++L +   +++++DK+G T L  A      + V+ L   G  +NI  +NGE  L+ A + GH +IV  LL    DV+   +   T+L +     +A   + +L+   D      +       A K  N+  V ++
Sbjct:  204 VDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELL 362          
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Medaka
Match: ENSORLT00000033617.1 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 81.2629 bits (199), Expect = 3.125e-17
Identity = 48/140 (34.29%), Postives = 75/140 (53.57%), Query Frame = 1
Query:  220 SIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK 639
            ++   A +G I ++ E L E   +++  D  G+T LMWA    +    ELL  +GAN NI+ +     ++ AA  GH +IV  LL+ G  VN SD+   T LI+ +   H DC   LL  GAD+  + +++  A  VA++
Sbjct:   82 ALISAAKEGHIEVVRELL-ENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVR 220          

HSP 2 Score: 70.0922 bits (170), Expect = 1.922e-13
Identity = 44/131 (33.59%), Postives = 64/131 (48.85%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQ 675
            G D+D    N  T L+ A      + V+ L  R  N+N++ K+G  AL +AA+ GH +IV  LL AG  VN  D    T LI      H +  + LL   AD+ ++  D   A + A+++ N   V  I Q
Sbjct:  201 GADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQ 331          

HSP 3 Score: 69.3218 bits (168), Expect = 3.997e-13
Identity = 40/132 (30.30%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  265 EKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATV 660
            E L E G + +++ +    P++WA      + V LL   GA +N S K G   L+ AA+ GH D V++LL  G DV+       T+LI      + +  K LL+   ++ M + D   A  +A K  +   V
Sbjct:  129 ELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKVNCSDKYGTTPLIWAARKGHYDCVMHLLANGADVDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIV 260          

HSP 4 Score: 59.3066 bits (142), Expect = 9.525e-10
Identity = 37/134 (27.61%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  289 DIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQI 690
            D+D    NG TPLM A      + V+    RGAN+++   +   AL+ AA+ GH ++V  LL    ++ + D    T+L++ ++    D  +LLLE GA+  +    +      A  R +   V+++ Q+  ++
Sbjct:   38 DVDSRSDNGQTPLMVAAELGNLEIVQEFIRRGANVDLDDVDCWTALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKV 171          

HSP 5 Score: 50.447 bits (119), Expect = 7.835e-7
Identity = 34/143 (23.78%), Postives = 71/143 (49.65%), Query Frame = 1
Query:  211 SEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMK 639
            + ++I    G  EI+   + L + GT +++ D+NG T L+ A      + V  L  + A++++  ++G+ AL  A + G+  +V  +L+   D     +   T LI  +   + +  +LLL+ GA ++  +       H+A++
Sbjct:  246 TALAIAAKEGHTEIV---QDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELLLDKGAKVSAVDRKGDTPLHIAIR 385          

HSP 6 Score: 48.521 bits (114), Expect = 3.605e-6
Identity = 30/103 (29.13%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  283 GTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADL 591
            G ++D+ D + +T L+ A      + V  L    ANL      G  AL+ AA  G  D+   LL  G + N + +     +I+ +   HA+   LLL+ GA +
Sbjct:   69 GANVDLDDVDCWTALISAAKEGHIEVVRELLENHANLEHRDLGGWTALMWAAYKGRTDVAELLLEKGANPNITGQYSVYPIIWAAGRGHAEIVHLLLQHGAKV 171          

HSP 7 Score: 48.1358 bits (113), Expect = 4.739e-6
Identity = 38/159 (23.90%), Postives = 74/159 (46.54%), Query Frame = 1
Query:  193 VAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            V Q+ ++ ++   +A +G    + ++L +   +++++DK+G T L  A      + V+ L   G  +NI  +NGE  L+ A + GH +IV  LL    DV+   +   T+L +     +A   + +L+   D      +       A K  N+  V ++
Sbjct:  204 VDQEGANSMTALIVAVRGGYTEVVKELLKRNPNVNMTDKDGNTALAIAAKEGHTEIVQDLLDAGTYVNIPDRNGETMLIGAVRGGHVEIVRALLNKYADVDVRGQDGKTALYWAVEKGNAIMVRDILQCNPDTESCTKEGETPLIKATKMRNIEIVELL 362          
BLAST of Ankyrin repeat family A protein 2 vs. Planmine SMEST
Match: SMESG000016522.1 (SMESG000016522.1)

HSP 1 Score: 436.417 bits (1121), Expect = 8.545e-158
Identity = 210/210 (100.00%), Postives = 210/210 (100.00%), Query Frame = 1
Query:   82 PRPQCLDIISDKSSNGYKFNNKPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNLYQ 711
            PRPQCLDIISDKSSNGYKFNNKPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNLYQ
Sbjct:   10 PRPQCLDIISDKSSNGYKFNNKPRTVLTNVQRRNFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYLTQIIEDNLYQ 219          
BLAST of Ankyrin repeat family A protein 2 vs. Planmine SMEST
Match: SMESG000068744.1 (SMESG000068744.1)

HSP 1 Score: 74.3294 bits (181), Expect = 4.464e-15
Identity = 47/121 (38.84%), Postives = 64/121 (52.89%), Query Frame = 1
Query:  295 DVSDKNGF----TPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRN 645
            DV+ K+ F    TPL +A+   +K+ VE L  RGAN++I  + G   L  A   GH D+V  L+ AG D N  D    T L   +    AD C +LL+  AD+ +KNSD   AF +A   N
Sbjct:   78 DVNSKDNFGRKSTPLHFASGFGRKEMVEFLISRGANVSIKDEGGLIPLHNACSFGHADVVKVLISAGSDPNAKDVWNYTPLHEAAVKGKADVCIVLLQAKADVNLKNSDGLTAFDLATDNN 198          

HSP 2 Score: 53.9138 bits (128), Expect = 3.947e-8
Identity = 37/108 (34.26%), Postives = 52/108 (48.15%), Query Frame = 1
Query:  286 TDIDVSDKNG--FTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKN 603
             +I+  D  G   TPL  A+  N  +  E L  +GA++N   K G   L  A+  GH D+   LL+   +VN +D+   T L   +  N    C LLL  GAD  +KN
Sbjct:  785 VNINCRDTQGRNSTPLHLASGYNNLEIAEFLLEQGADVNAQDKGGLIPLHNASSYGHADMAALLLKYSANVNSADKWGYTPLHEAAQKNRTQLCSLLLAHGADAKLKN 892          

HSP 3 Score: 51.6026 bits (122), Expect = 2.306e-7
Identity = 37/111 (33.33%), Postives = 49/111 (44.14%), Query Frame = 1
Query:  301 SDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVA 633
            SD    TPL  A   N+ + V+LL   GA ++   K G   L  A   GH ++   LL  G  VN  D  + T L   +     + C LLL +GAD T  N  N     +A
Sbjct:  238 SDGRKSTPLHLAAGYNRCRIVQLLLEMGAQVHAKDKGGLVPLHNACSYGHIEVAKSLLERGAMVNAPDLWQYTPLHEAASKGRTEVCSLLLAYGADPTHLNCHNKSPLELA 348          
BLAST of Ankyrin repeat family A protein 2 vs. Planmine SMEST
Match: SMESG000037862.1 (SMESG000037862.1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.790e-14
Identity = 47/151 (31.13%), Postives = 78/151 (51.66%), Query Frame = 1
Query:  220 SIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELE-NTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            + +  A QG I+LL E       D+++SDK+  T L+ A+ANNQ + V +L   GA+ N+   +G   L  A Q+G+  I   L++    +N  +  +  T L+  S N H  C  LLL  GA++  +  D   A  +A +  ++ TV+ +
Sbjct:    6 TFYLSALQGNIVLLREIHKCHSIDLNISDKDNTTALILASANNQYEMVRVLLEMGADPNLVRISGTGPLFFACQSGYTKIAELLIQYNARINQQNRRDYGTPLLVASQNGHTACVNLLLNHGANVNHQLKDGATALFLAAQGGHMYTVDTL 156          

HSP 2 Score: 59.6918 bits (143), Expect = 3.721e-10
Identity = 38/117 (32.48%), Postives = 54/117 (46.15%), Query Frame = 1
Query:  319 TPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            TPL+ A+ N     V LL   GAN+N   K+G  AL LAAQ GH   V  L+RA  DVN       T +   S   H    K+L+  GA++     D   +   A ++ +   +  +
Sbjct:  106 TPLLVASQNGHTACVNLLLNHGANVNHQLKDGATALFLAAQGGHMYTVDTLIRAHADVNLFKNDLATPIYIASQMGHHKIVKMLINSGAEVDAAREDGSTSLFKAAQKGHRLVIEAL 222          

HSP 3 Score: 47.3654 bits (111), Expect = 4.366e-6
Identity = 35/134 (26.12%), Postives = 61/134 (45.52%), Query Frame = 1
Query:  232 MAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVA 633
            +A QG  +   + L     D+++   +  TP+  A+     + V++L   GA ++ + ++G  +L  AAQ GH+ ++  LL  G         E T+L   +         LLL  GA+  MKN D   +  +A
Sbjct:  143 LAAQGGHMYTVDTLIRAHADVNLFKNDLATPIYIASQMGHHKIVKMLINSGAEVDAAREDGSTSLFKAAQKGHRLVIEALLSGGASTGLLGNGE-TALHMAALFGRTRITHLLLVNGANPMMKNKDGLTSCDLA 275          
BLAST of Ankyrin repeat family A protein 2 vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.595e-13
Identity = 41/121 (33.88%), Postives = 63/121 (52.07%), Query Frame = 1
Query:  307 KNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            KNG+TPL      N  +  +LL  RGAN+N  ++ G   L L +  G+K+I+  LL A  DVN+  E   T+L   +  N  D  + LL+  AD++ K    + A H A+    + TV ++
Sbjct:  663 KNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKML 783          

HSP 2 Score: 66.2402 bits (160), Expect = 2.680e-12
Identity = 35/125 (28.00%), Postives = 65/125 (52.00%), Query Frame = 1
Query:  295 DVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            D+S+ NG   +  A     ++ V+LL   G +++I+ + G  +L +A+  G  ++V  LL +  ++N   +   T L   +  NH D  K+LLE+GA+  +   D F    VA+++ N   V ++
Sbjct:   99 DMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQIL 223          

HSP 3 Score: 65.0846 bits (157), Expect = 6.336e-12
Identity = 42/159 (26.42%), Postives = 79/159 (49.69%), Query Frame = 1
Query:  193 VAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            V  Q++S  +   +A     + + + L E   D++   KN  TPL  A    +++ ++LL  + AN+N   ++G + +  AA++G ++I+L LL  G D+ +  +   T+L   +  + A+ C+ L+  G D+     D   A HVA    N+    V+
Sbjct:  260 VDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVL 418          

HSP 4 Score: 61.6178 bits (148), Expect = 1.100e-10
Identity = 39/148 (26.35%), Postives = 74/148 (50.00%), Query Frame = 1
Query:  226 FQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
              +  +  +I + + L + G +++   + GFTPL   +    K+ +ELL    A++N  A+NG  AL LAA+    DIV  LL+   D++   ++  T+L            K+LLE   D+  + +    + H+A ++ ++A V ++
Sbjct:  669 LHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLL 816          

HSP 5 Score: 56.6102 bits (135), Expect = 4.544e-9
Identity = 30/95 (31.58%), Postives = 55/95 (57.89%), Query Frame = 1
Query:  394 NISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            ++S  NG NA+ LAA+ G++++V  L+  G+ V+ +    NTSL   S     +   LLLE  A++ +K+ + F   ++A + N++  V V+ +Y
Sbjct:   99 DMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEY 193          

HSP 6 Score: 55.8398 bits (133), Expect = 9.173e-9
Identity = 45/155 (29.03%), Postives = 67/155 (43.23%), Query Frame = 1
Query:  181 NFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRN 645
            N    +Q+  + + +  MAG  EI+   E L +   D++   +NG T L  A   N+   VE L    A+++   + G  AL  A   G    V  LL    DVN    L  TSL   +   H    +LLL+   D+  +N     A  VA K++
Sbjct:  690 NVNAQSQKGFTPLHLNSMAGNKEIM---ELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQH 841          

HSP 7 Score: 55.0694 bits (131), Expect = 1.581e-8
Identity = 37/124 (29.84%), Postives = 60/124 (48.39%), Query Frame = 1
Query:  310 NGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYL 681
            +G TPL  AT  N  + +ELL    AN+N   KNG   L L A+    ++   L+  G +VN   +   T L   S   + +  +LLL+  AD+  +  +   A H+A ++N     +++ Q L
Sbjct:  631 HGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNR---TDIVEQLL 751          

HSP 8 Score: 55.0694 bits (131), Expect = 1.596e-8
Identity = 38/118 (32.20%), Postives = 59/118 (50.00%), Query Frame = 1
Query:  310 NGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCK-LLLEWGADLTMKNSDNFCAFHVAMKRNNVATV 660
            NGFTPL  A    Q + VELL    A++N + + G   L +AA  G K+IV  LL+ G  ++ +      +L   + NN  +  K LLL   A+   +  +N    H+A++  N + V
Sbjct:  431 NGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIV 548          

HSP 9 Score: 48.1358 bits (113), Expect = 2.847e-6
Identity = 38/120 (31.67%), Postives = 53/120 (44.17%), Query Frame = 1
Query:  325 LMWATANNQKQAVE-LLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYL 681
            L  A  NNQ++  + LL +  AN N  A+  +  L +A + G+  IV  LL AG D N   +   T+L   +     +  +LLLE       K    F   H+A K      V V RQ L
Sbjct:  502 LHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASK---YGRVQVARQLL 618          
BLAST of Ankyrin repeat family A protein 2 vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 69.707 bits (169), Expect = 1.787e-13
Identity = 41/121 (33.88%), Postives = 63/121 (52.07%), Query Frame = 1
Query:  307 KNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            KNG+TPL      N  +  +LL  RGAN+N  ++ G   L L +  G+K+I+  LL A  DVN+  E   T+L   +  N  D  + LL+  AD++ K    + A H A+    + TV ++
Sbjct:  683 KNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKML 803          

HSP 2 Score: 66.2402 bits (160), Expect = 2.734e-12
Identity = 35/125 (28.00%), Postives = 65/125 (52.00%), Query Frame = 1
Query:  295 DVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            D+S+ NG   +  A     ++ V+LL   G +++I+ + G  +L +A+  G  ++V  LL +  ++N   +   T L   +  NH D  K+LLE+GA+  +   D F    VA+++ N   V ++
Sbjct:  119 DMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQIL 243          

HSP 3 Score: 65.0846 bits (157), Expect = 6.709e-12
Identity = 42/159 (26.42%), Postives = 79/159 (49.69%), Query Frame = 1
Query:  193 VAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
            V  Q++S  +   +A     + + + L E   D++   KN  TPL  A    +++ ++LL  + AN+N   ++G + +  AA++G ++I+L LL  G D+ +  +   T+L   +  + A+ C+ L+  G D+     D   A HVA    N+    V+
Sbjct:  280 VDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVL 438          

HSP 4 Score: 61.6178 bits (148), Expect = 1.091e-10
Identity = 39/148 (26.35%), Postives = 74/148 (50.00%), Query Frame = 1
Query:  226 FQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVI 669
              +  +  +I + + L + G +++   + GFTPL   +    K+ +ELL    A++N  A+NG  AL LAA+    DIV  LL+   D++   ++  T+L            K+LLE   D+  + +    + H+A ++ ++A V ++
Sbjct:  689 LHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLL 836          

HSP 5 Score: 56.6102 bits (135), Expect = 4.944e-9
Identity = 30/95 (31.58%), Postives = 55/95 (57.89%), Query Frame = 1
Query:  394 NISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQY 678
            ++S  NG NA+ LAA+ G++++V  L+  G+ V+ +    NTSL   S     +   LLLE  A++ +K+ + F   ++A + N++  V V+ +Y
Sbjct:  119 DMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEY 213          

HSP 6 Score: 55.8398 bits (133), Expect = 9.098e-9
Identity = 45/155 (29.03%), Postives = 67/155 (43.23%), Query Frame = 1
Query:  181 NFQTVAQQNSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRN 645
            N    +Q+  + + +  MAG  EI+   E L +   D++   +NG T L  A   N+   VE L    A+++   + G  AL  A   G    V  LL    DVN    L  TSL   +   H    +LLL+   D+  +N     A  VA K++
Sbjct:  710 NVNAQSQKGFTPLHLNSMAGNKEIM---ELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQH 861          

HSP 7 Score: 55.0694 bits (131), Expect = 1.613e-8
Identity = 38/118 (32.20%), Postives = 59/118 (50.00%), Query Frame = 1
Query:  310 NGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCK-LLLEWGADLTMKNSDNFCAFHVAMKRNNVATV 660
            NGFTPL  A    Q + VELL    A++N + + G   L +AA  G K+IV  LL+ G  ++ +      +L   + NN  +  K LLL   A+   +  +N    H+A++  N + V
Sbjct:  451 NGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIV 568          

HSP 8 Score: 55.0694 bits (131), Expect = 1.658e-8
Identity = 37/124 (29.84%), Postives = 60/124 (48.39%), Query Frame = 1
Query:  310 NGFTPLMWATANNQKQAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYL 681
            +G TPL  AT  N  + +ELL    AN+N   KNG   L L A+    ++   L+  G +VN   +   T L   S   + +  +LLL+  AD+  +  +   A H+A ++N     +++ Q L
Sbjct:  651 HGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNR---TDIVEQLL 771          

HSP 9 Score: 48.1358 bits (113), Expect = 2.955e-6
Identity = 38/120 (31.67%), Postives = 53/120 (44.17%), Query Frame = 1
Query:  325 LMWATANNQKQAVE-LLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSDELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVATVNVIRQYL 681
            L  A  NNQ++  + LL +  AN N  A+  +  L +A + G+  IV  LL AG D N   +   T+L   +     +  +LLLE       K    F   H+A K      V V RQ L
Sbjct:  522 LHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASK---YGRVQVARQLL 638          
The following BLAST results are available for this feature:
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRA21.238e-2935.14ankyrin repeat family A member 2 [Source:HGNC Symb... [more]
RFXANK1.493e-2734.76regulatory factor X associated ankyrin containing ... [more]
RFXANK1.493e-2734.76regulatory factor X associated ankyrin containing ... [more]
RFXANK8.005e-2034.06regulatory factor X associated ankyrin containing ... [more]
RFXANK8.674e-2034.06regulatory factor X associated ankyrin containing ... [more]
back to top
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-441.637e-1334.06AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.637e-1334.06AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.680e-1334.06AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.680e-1334.06AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.954e-1334.06AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG58461.038e-2933.66gene:FBgn0032171 transcript:FBtr0346717[more]
CG58461.038e-2933.66gene:FBgn0032171 transcript:FBtr0079891[more]
Ank26.149e-1531.14gene:FBgn0261788 transcript:FBtr0303119[more]
Ank21.025e-1431.14gene:FBgn0261788 transcript:FBtr0303120[more]
Ilk1.034e-1432.12gene:FBgn0028427 transcript:FBtr0078305[more]
back to top
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankra23.025e-3035.33ankyrin repeat, family A (RFXANK-like), 2 [Source:... [more]
ankra23.025e-3035.33ankyrin repeat, family A (RFXANK-like), 2 [Source:... [more]
ankra23.708e-3035.33ankyrin repeat, family A (RFXANK-like), 2 [Source:... [more]
rfxank5.171e-2637.50regulatory factor X-associated ankyrin-containing ... [more]
rfxank1.042e-2138.69regulatory factor X-associated ankyrin-containing ... [more]
back to top
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
s100a116.860e-3134.67S100 calcium binding protein A11 [Source:Xenbase;A... [more]
apoe2.004e-3034.78apolipoprotein E [Source:Xenbase;Acc:XB-GENE-85321... [more]
apoe2.829e-3034.78apolipoprotein E [Source:Xenbase;Acc:XB-GENE-85321... [more]
apoe3.103e-3034.78apolipoprotein E [Source:Xenbase;Acc:XB-GENE-85321... [more]
apoe3.289e-3034.78apolipoprotein E [Source:Xenbase;Acc:XB-GENE-85321... [more]
back to top
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankra24.009e-2834.59ankyrin repeat, family A (RFXANK-like), 2 [Source:... [more]
Ankra23.619e-2737.80ankyrin repeat, family A (RFXANK-like), 2 [Source:... [more]
Ankra24.251e-2737.80ankyrin repeat, family A (RFXANK-like), 2 [Source:... [more]
Rfxank3.348e-2633.69regulatory factor X-associated ankyrin-containing ... [more]
Rfxank6.763e-2431.98regulatory factor X-associated ankyrin-containing ... [more]
back to top
BLAST of Ankyrin repeat family A protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H9E1|ANRA2_HUMAN5.943e-2935.14Ankyrin repeat family A protein 2 OS=Homo sapiens ... [more]
sp|Q2KI79|ANRA2_BOVIN1.302e-2835.14Ankyrin repeat family A protein 2 OS=Bos taurus OX... [more]
sp|Q99PE2|ANRA2_MOUSE2.804e-2734.59Ankyrin repeat family A protein 2 OS=Mus musculus ... [more]
sp|O14593|RFXK_HUMAN7.168e-2734.76DNA-binding protein RFXANK OS=Homo sapiens OX=9606... [more]
sp|Q9Z205|RFXK_MOUSE4.731e-2331.98DNA-binding protein RFXANK OS=Mus musculus OX=1009... [more]
back to top
BLAST of Ankyrin repeat family A protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S5BPY71.323e-6349.27ANK_REP_REGION domain-containing protein OS=Protop... [more]
A0A0R3X9J07.172e-6249.47ANK_REP_REGION domain-containing protein OS=Hydati... [more]
A0A0R3SFR73.889e-6151.85ANK_REP_REGION domain-containing protein OS=Hymeno... [more]
A0A5K3FP285.042e-6151.34Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A267GIQ83.532e-6051.63ANK_REP_REGION domain-containing protein (Fragment... [more]
back to top
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankra21.899e-3035.33ankyrin repeat family A member 2 [Source:NCBI gene... [more]
rfxank1.596e-2234.16regulatory factor X associated ankyrin containing ... [more]
ankrd23.632e-1632.35ankyrin repeat domain 2 [Source:NCBI gene;Acc:1030... [more]
kidins220a6.356e-1630.71kinase D-interacting substrate of 220 kDa [Source:... [more]
kidins220a6.543e-1630.71kinase D-interacting substrate of 220 kDa [Source:... [more]
back to top
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankra23.643e-2938.38ankyrin repeat, family A (RFXANK-like), 2 [Source:... [more]
ENSPMAT00000007954.12.447e-1430.00pep scaffold:Pmarinus_7.0:GL479092:583:36301:1 gen... [more]
ENSPMAT00000002048.16.292e-1431.21pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 g... [more]
ENSPMAT00000009528.11.805e-1333.85pep scaffold:Pmarinus_7.0:GL478737:432:18044:-1 ge... [more]
ENSPMAT00000003991.12.119e-1328.35pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
back to top
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HOS41.122e-835.14Subunit of the Set3 complex; complex is a meiotic-... [more]
AKR11.204e-625.93Palmitoyl transferase involved in protein palmitoy... [more]
back to top
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO391137.525e-1434.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281787.704e-1230.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302793.721e-1133.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498376.267e-1129.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432281.926e-1034.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ankyrin repeat family A protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankra21.530e-3138.25ankyrin repeat family A member 2 [Source:NCBI gene... [more]
rfxank1.051e-2935.29regulatory factor X associated ankyrin containing ... [more]
rfxank4.362e-2634.43regulatory factor X associated ankyrin containing ... [more]
ENSORLT00000022720.23.099e-1734.29kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000033617.13.125e-1734.29kinase D interacting substrate 220 [Source:NCBI ge... [more]
back to top
BLAST of Ankyrin repeat family A protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016522.18.545e-158100.00SMESG000016522.1[more]
SMESG000068744.14.464e-1538.84SMESG000068744.1[more]
SMESG000037862.11.790e-1431.13SMESG000037862.1[more]
SMESG000026655.11.595e-1333.88SMESG000026655.1[more]
SMESG000026655.11.787e-1333.88SMESG000026655.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031212 ID=SMED30031212|Name=Ankyrin repeat family A protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=716bp
ATTATAATTTGAAATAAGTTTAATTAGAATAAACTAATTCAATTTATCAT
AATTATGATTGATGATAAAAAATTTAAGATTCCAAGGCCACAATGTCTAG
ATATTATTTCAGATAAATCTTCTAATGGATATAAGTTTAATAATAAACCT
AGAACTGTATTAACAAATGTTCAGCGACGGAATTTTCAAACCGTAGCACA
ACAAAATTCTAGTGAAATTTCTATATTTCAAATGGCTGGTCAGGGAGAAA
TTATTCTATTAGATGAAAAATTAAATGAACCAGGAACAGATATAGATGTT
TCCGACAAAAATGGATTTACTCCTCTCATGTGGGCAACCGCTAATAACCA
GAAGCAAGCTGTTGAGCTTCTGACTTACCGAGGTGCAAATTTAAACATAA
GCGCGAAGAATGGAGAAAATGCTCTATTGTTAGCAGCACAGAACGGACAT
AAAGATATTGTTTTATATTTATTAAGGGCTGGAATGGATGTTAATTACAG
TGATGAATTGGAAAATACTAGTTTAATTTTTACATCATTTAATAATCACG
CGGATTGTTGCAAATTACTCCTGGAATGGGGTGCTGATTTAACAATGAAA
AACAGTGATAATTTTTGTGCATTTCACGTAGCAATGAAAAGAAATAATGT
TGCTACTGTAAATGTTATTCGACAATATTTAACTCAGATTATTGAAGATA
ATTTATATCAATGAGG
back to top

protein sequence of SMED30031212-orf-1

>SMED30031212-orf-1 ID=SMED30031212-orf-1|Name=SMED30031212-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=220bp
MIDDKKFKIPRPQCLDIISDKSSNGYKFNNKPRTVLTNVQRRNFQTVAQQ
NSSEISIFQMAGQGEIILLDEKLNEPGTDIDVSDKNGFTPLMWATANNQK
QAVELLTYRGANLNISAKNGENALLLAAQNGHKDIVLYLLRAGMDVNYSD
ELENTSLIFTSFNNHADCCKLLLEWGADLTMKNSDNFCAFHVAMKRNNVA
TVNVIRQYLTQIIEDNLYQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003712transcription cofactor activity
GO:0031625ubiquitin protein ligase binding
GO:0042826histone deacetylase binding
GO:0050750low-density lipoprotein particle receptor binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0008150biological_process
GO:0043254regulation of protein complex assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 119..148
e-value: 7.3E-5
score: 32.2
coord: 152..181
e-value: 230.0
score: 9.7
coord: 185..215
e-value: 2400.0
score: 2.1
coord: 86..115
e-value: 2.9E-4
score: 30.2
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 86..118
score: 11.06
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 119..151
score: 12.823
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 114..183
e-value: 8.2E-11
score: 42.3
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 50..205
score: 34.668
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 51..217
e-value: 5.3E-42
score: 145.0
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 14..205
NoneNo IPR availablePANTHERPTHR24124FAMILY NOT NAMEDcoord: 32..203