Ankyrin repeat and SOCS box containing 14b

Overview
NameAnkyrin repeat and SOCS box containing 14b
Smed IDSMED30031206
Length (bp)4038
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ankyrin repeat and SOCS box containing 14b (SMED30031206) t-SNE clustered cells

Violin plots show distribution of expression levels for Ankyrin repeat and SOCS box containing 14b (SMED30031206) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ankyrin repeat and SOCS box containing 14b (SMED30031206) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ankyrin repeat and SOCS box containing 14b (SMED30031206) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031206

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30031206SMESG000004641.1 SmedASXL_016041SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30031206SMESG000004641.1 dd_Smed_v6_13156_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30031206SMESG000004641.1 dd_Smed_v4_13156_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 210.69 bits (535), Expect = 4.215e-54
Identity = 204/815 (25.03%), Postives = 381/815 (46.75%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D N      + +L  + ++ H  + + L+  G++++         S  K  N A +H+A +    E  + L+ +GAN+          + +   T L++A   + N ++ + +LLE G N  + T  G TP   A++    +A  +LL    + +    +    L ++A K + +    LLQN  +++ +   G T LH           + + +    +D+   +  T + +A    N +   L        L  G +ID                    VV +L +   P L    N   ++P+ +A + + +  + HL++H A ++ ++  +  T LHVA    +  + K L+   +N + R+  G      P+H+A +    +++E+L+ +G+S+ +     +   + P+H+AA     + V  L  Q  AS ++ + R ++  AL        V  V+ +L  GA V      +R+R   T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G +++  +  + G + S A   G T LH AA  GS+D+ ++LL+  A  ++   +G    + P+H+A+   ++K   LLLE G+  +A      ++  T L+IA  +N+  +   L+  GA  +I     G TPLH+  Q G T  +  L+    +++++   +G++SLHL A++    ++  L +        G   D+ +K      +PL  AC +G++ +V  L+K GA+++ A+T  G+    P+H AA +G  H+I  LL+ G   +    +G T L
Sbjct:   33 GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVD---------SATKKGNTA-LHIASLAGQAEVVKVLVKEGANI--------NAQSQNGFTPLYMAA--QENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKL-------LLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNG--LSPLHMAAQGDHVECVKHLLQHKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNG----FTPLHIACKKNRIKVMELLVKYGASIQAI----TESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVTNIRGET--ALHMAARAGQVEVVRCLLRNGALVD-----ARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDA----ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNG----LTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQ-GVTPLHLASQEGHTDMVTLLLD-KGANIHMSTKSGLTSLHLAAQEDKVNVADILTK-------HGADQDAHTK---LGYTPLIVACHYGNVKMVNFLLKQGANVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 769          

HSP 2 Score: 208.379 bits (529), Expect = 2.221e-53
Identity = 180/720 (25.00%), Postives = 334/720 (46.39%), Query Frame = 1
Query: 1648 ETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            +  +  LHLA   K   +  +  LL  G +++S T KG+T    A    + E   +L+  G + NA +    + L ++A + + +++K+LL+N  + +     G T L  +  Q              N  +A + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +++    L+  GA +++ ++ N  T LHVA +  N  + K L+  G  I  ++R G    + P+H A ++G D+++E+LL  G+ L    + ++   ++PLH+AA  D    VK L  Q  A ++                                DV+   +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G       L+  A ++ ++    G + LH+ A+ G  +++  LL+ +   +  G+            ++PL+ A  + +  V  LL++ GA  H         G  P+H AA + +  +  TLL  G   +   + G+TPLH +  EG  D    L+   AN+++  K G
Sbjct:   41 QNGLNALHLAA--KEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQ------------GHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNAD---VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDF-TARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDG----LTPLHCAARSGHDQVVELLLERGAPL----LARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVD--------------------------------DVTLDYL-------TALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREGQVDVASVLLE-AGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK----------NGLTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSG 666          

HSP 3 Score: 186.422 bits (472), Expect = 1.477e-46
Identity = 160/590 (27.12%), Postives = 275/590 (46.61%), Query Frame = 1
Query: 2209 AVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLT------------------------HQQSASINI-NSTRSDSFNALLTLVSKRNVIGVQSVLMAG---ADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT--------------------------GQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            A    ++  +   ++ G ++N   + N    LH+A +  ++ + +EL+  GS++   ++ G       +H+A   G  E++++L+  G+++N+    +S     PL++AA  +    VK+L                         H Q+ +I + N T+       L + ++++     ++L+     ADV  K         T LHIAA  G+  +  LLL  GA   A   T  R+GI P+H+A++ G+  +VKL  D G  + A    GLT LH AA +G   ++E+LL+ GA + A   +G    + P+HMA++  H + VK LL++ +P++ V      D LTAL++A       V K L+   ANP+ +  N G TPLHI C++   K +M L+    +S+     +G++ +H+ A  GH  +   LL+   +P++T                          G + D+ +++     +PL+ A   G   +V+LL++  A    A T     G  P+H +A  G+  V   LLEAG +     + G TPLH +   G  D  K L+  +A  +   K G  P
Sbjct:   17 AARAGNLDKVVEYLKGGIDIN-TCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGN----TALHIASLAGQAEVVKVLVKEGANINA----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSK------SGFTPLHIAAHYGNVNVATLLLNRGA---AVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNG----LSPLHMAAQGDHVECVKHLLQHKAPVDDV----TLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACKKNRIK-VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ---TPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 570          

HSP 4 Score: 175.637 bits (444), Expect = 2.658e-43
Identity = 170/728 (23.35%), Postives = 317/728 (43.54%), Query Frame = 1
Query: 1639 REVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            ++ ++N + L  A   ++ +L+ +   L+ G++I +    G      A +   +     LL RG   ++      + L ++++    E++K L++   + N +   G T L+ +  ++    + Y + +  N           S + + G+  L  ALQ G+   V  +L+             V +  + +A   +   +   L+++  N + + S +  T LH+A    N+ +A  L+  G+ +   +R G    + P+HVA + G   ++++LL  G  +++    K+ + + PLH AA +     V+ L  + +  +   +   +  + L       +V  V+ +L   A V    +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G                       ++S+ L A   H                        S  T    +PL+ A  +G L V KLL++  A    A    G  G+ P+H AA      V   LLE G S     ++G TPLH +  +        L+   A  NI+ K G  P
Sbjct:    6 QKSDSNASFLRAA---RAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN----------QSTATEDGFTPLAVALQQGHNQAVAILLENDTK-------GKVRLPALHIAARKDDTKSAALLLQNDHNAD-VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNG----ITPLHVASKRGNTNMVKLLLDRGGQIDA----KTRDGLTPLHCAARSGHDQVVELLLERGAPLL---ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL----DYLTALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREG--------------------QVDVASVLLEAGAAH------------------------SLATKKGFTPLHVAAKYGSLDVAKLLLQRRA----AADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTP 636          

HSP 5 Score: 167.933 bits (424), Expect = 6.536e-41
Identity = 185/745 (24.83%), Postives = 324/745 (43.49%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH-HSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITG-----------------------------DRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            + E++ +L+    NIN  +    + L++A Q N + +V  LL  G++ +       T L  ++Q+ H +   +L+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++GA +  T            +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R    +   LLL RG    A      S L ++A   + E +K LLQ++   +      LTALH  +    +R+         T + + K   N ++ +L     ++     N I V+ +L K  A    +       +TPI +A  M  ++ +  L+++GA+ + +++   ET LH+A R   + + + L+  G+ +  R+R    EE  P+H+A + G  EI+++LL   +  ++     +     PLH++A          L    +A    +S  +      L + +K   + V  +L+   A AD +GK         T LH+AA   + ++  LLLE GA P A    G                              + G+ P+HLA++ GH ++V L  D G ++  +   GLT LH AA    V++ +IL K GAD +A    G      P+ +A   G+ K V  LL+ G+ +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+   +
Sbjct:   88 QAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA--------RNGITPLHVAS--KRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRV---------TKLLLDK-RANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAI---TESGLTPIHVAAFMGHLNIVLLLLQNGASPD-VTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAR----EEQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQVDVASVLLEAGAA----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK------NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLG----YTPLIVACHYGNVKMVNFLLKQGANVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAN-GNTALAIAKRLGYISVV 781          

HSP 6 Score: 129.798 bits (325), Expect = 2.402e-29
Identity = 124/481 (25.78%), Postives = 207/481 (43.04%), Query Frame = 1
Query: 2485 STMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIG-VQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADI------------------HWAET-----------FEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTA 3837
            +TM+ KS    + L  A   +L   V++L       I+IN+   +  NAL  L +K   +G VQ +L  G+ V      +  +  T LHIA+  G  E+V++L++ GA+  A+     ++G  P+++A +  H+++VK   + G + S A + G T L  A   G    + ILL        E     + ++  +H+A+ K   KS  LLL+     +      ++   T L+IA      NV   L+  GA  D    N G TPLH+  +RG T  +  L+      ++     G++ LH  A  GH+++   LL  +  P L          +T   +SPL+ A    H+  VK L++  A +                  H+  T                G  P+H A  + +  V+  L++ G SI    E GLTP+H +   G  +    L+   A+ ++ +  G+     A  A
Sbjct:    2 TTMLQKSDSNASFLRAARAGNLDKVVEYL----KGGIDINTCNQNGLNAL-HLAAKEGHVGLVQELLGRGSSVDS----ATKKGNTALHIASLAGQAEVVKVLVKEGANINAQ----SQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL--------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADV----QSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-GITPLHVASKRGNTNMVKLLLD-RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLE-RGAPLLA---------RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARA 445          

HSP 7 Score: 98.9821 bits (245), Expect = 6.681e-20
Identity = 122/539 (22.63%), Postives = 230/539 (42.67%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSL--KSGY--LIYALQYGNEIDVVRVLKQ---AADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            +T+L  +    H ++T+LL++  AN N             L     +H+A   +  +  + L+  GA++        +   E+ +T +H+A  +    LN +  LL+ G + +    +G+T    A R  ++E    LL  G   +A     ++ L +++     EI++ LLQ+    +     G T LH S  ++ ++       D  ++ +    +  ++HSL  K G+  L  A +YG+ +DV ++L Q   AAD           +TP+ +A   ++      L+  GA+  + ++ N  T LH+A +   + IA  L+  G+  ++ ++ G    V P+H+A Q G  +++ +LL  G++++    + +   +  LHLAA  D  +    LT                                      GAD      +      T L +A   G+ ++V  LL+ GA+  A+     ++G  P+H A + GH  I+ +    G   +A    G T L  A   G + +++ L
Sbjct:  337 LTALHVAAHCGHYRVTKLLLDKRANPNARA----------LNGFTPLHIACKKNRIKVMELLVKYGASI--------QAITESGLTPIHVAAFM--GHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHIS-AREGQV-------DVASVLL----EAGAAHSLATKKGFTPLHVAAKYGS-LDVAKLLLQRRAAADS-----AGKNGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQG----VTPLHLASQEGHTDMVTLLLDKGANIH----MSTKSGLTSLHLAAQEDKVNVADILTKH------------------------------------GADQDAHTKLGY----TPLIVACHYGNVKMVNFLLKQGANVNAKT----KNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 784          

HSP 8 Score: 63.5438 bits (153), Expect = 8.315e-20
Identity = 86/395 (21.77%), Postives = 166/395 (42.03%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQ---LIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRK-------ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH  IV +LL+ GA+P +   R + T LH +  +  ++ +   ++   L+ +              + + +I        + ++L+     D    N +   ++    E +VD+ SV    G +++       +  KK   PL         ++  +LL  R   +       + L +A   +   +   LL +G+ P+       T L  + +K   ++   L+NYGA  N       +++   +T    +H+A      +    L+DKGAN+ ++         ++ +T LHLA   + + +N  + L + G + ++ T  G TP + A  Y  ++  N LL +G + NA      + L  +A + +  I+  LLQ+    N     G TAL
Sbjct:  412 MGHLNIVLLLLQNGASPDVTNIRGE-TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEI--------VQLLLQHMAHPDAATTNGY-TPLHISAREGQVDVASVLLEAGAAHS-------LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETN-------IVTKQGVT---PLHLASQEGHTDMVTLLLDKGANIHMS--------TKSGLTSLHLAA--QEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 769          

HSP 9 Score: 55.4546 bits (132), Expect = 8.315e-20
Identity = 48/201 (23.88%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            K+G++ LH A    +V++A  L+N     ++F   +       + P+H+A + G T+++K+LL R           + P  C      + +  ++L + + P+  +  N           +PLH+    DH++C+K L+Q  K  ++  ++    TAL +A          +LL+  ANPN   ++  +PL  A K+   +
Sbjct:  202 KSGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARN------GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGA-PLLARTKN---------GLSPLHMAAQGDHVECVKHLLQH-KAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIK 383          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 206.838 bits (525), Expect = 6.704e-53
Identity = 190/723 (26.28%), Postives = 335/723 (46.33%), Query Frame = 1
Query: 1648 ETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            +  +  LHLA   K   +  +  LL  G +++S T KG+T    A    + E   +L+  G + NA +    + L ++A + + +++K+LL+N  + +     G T L  +  Q              N  +A + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +++    L+  GA +++ ++ N  T LHVA +  N  + K L+  G  I  ++R G    + P+H A ++G D+++E+LL  G+ L    + ++   ++PLH+AA  D    VK L   ++    ++    D   AL       +    + +L   A+ + + +       T LHIA +    ++++LL++YGA    + IT    G+ P+H+A   GHL IV L    G S       G T LH AA AG V+++  LL+ GA V+A A    R +  P+H+AS  G  + V+LLL++ +  +A  +    +  T L+I+  E + +V   L+++GA   +     G TPLH+  + G +  +  L+    ++ +     G + LH+ A+K   +++  LL      N+           T   ++PL+ A   GH  +V LL+  GA+IH +       G+  +H AA   K +V   L + G   D   + G TPL  +   G      FL+   ANVN   K G  P
Sbjct:   41 QNGLNALHLAA--KEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQ------------GHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNAD---VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDF-TARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDG----LTPLHCAARSGHDQVVELLLERGAPL----LARTKNGLSPLHMAAQGDHVECVKHLLQHKAP---VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGAS--IQAIT--ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARA----REEQTPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKK-GFTPLHVAAKYG-SLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIV----------TKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTK----SGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTP 702          

HSP 2 Score: 192.971 bits (489), Expect = 1.207e-48
Identity = 188/772 (24.35%), Postives = 345/772 (44.69%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDG-----------------------------NRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT---GQITDSFSKKTSY 3495
            G D N      + +L  + ++ H  + + L+  G++++         S  K  N A +H+A +    E  + L+ +GAN+          + +   T L++A   + N ++ + +LLE G N  + T  G TP   A++    +A  +LL    + +    +    L ++A K + +    LLQN  +++ +   G T LH           + + +    +D+   +  T + +A    N +   L        L  G +ID                    VV +L +   P L    N   ++P+ +A + + +  + HL++H A ++ ++  +  T LHVA    +  + K L+   +N + R+  G      P+H+A +    +++E+L+ +G+S+ +     +   + P+H+AA     + V  L  Q  AS ++ + R ++  AL        V  V+ +L  GA V      +R+R   T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G +++  +  + G + S A   G T LH AA  GS+D+ ++LL+  A  ++   +G                              +  + P+H+AS++GH   V LLL+ G+ I+       +  LT+L++A  E++ NV   L K GA+ D     LG TPL + C  G  K + +L+    +++N     G + LH  A++GH  +   LL+    PN T   G    + +K+  Y
Sbjct:   33 GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVD---------SATKKGNTA-LHIASLAGQAEVVKVLVKEGANI--------NAQSQNGFTPLYMAA--QENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKL-------LLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNG--LSPLHMAAQGDHVECVKHLLQHKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNG----FTPLHIACKKNRIKVMELLVKYGASIQAI----TESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVTNIRGET--ALHMAARAGQVEVVRCLLRNGALVD-----ARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDA----ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMS----TKSGLTSLHLAAQEDKVNVADILTKHGADQDAH-TKLGYTPLIVACHYGNVKMVNFLLK-QGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 744          

HSP 3 Score: 189.889 bits (481), Expect = 1.247e-47
Identity = 163/602 (27.08%), Postives = 279/602 (46.35%), Query Frame = 1
Query: 2209 AVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLT------------------------HQQSASINI-NSTRSDSFNALLTLVSKRNVIGVQSVLMAG---ADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT--------------------------GQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSL 3852
            A    ++  +   ++ G ++N   + N    LH+A +  ++ + +EL+  GS++   ++ G       +H+A   G  E++++L+  G+++N+    +S     PL++AA  +    VK+L                         H Q+ +I + N T+       L + ++++     ++L+     ADV  K         T LHIAA  G+  +  LLL  GA   A   T  R+GI P+H+A++ G+  +VKL  D G  + A    GLT LH AA +G   ++E+LL+ GA + A   +G    + P+HMA++  H + VK LL++ +P++ V      D LTAL++A       V K L+   ANP+ +  N G TPLHI C++   K +M L+    +S+     +G++ +H+ A  GH  +   LL+   +P++T                          G + D+ +++     +PL+ A   G   +V+LL++  A    A T     G  P+H +A  G+  V   LLEAG +     + G TPLH +   G  D  K L+  +A  +   K G  P   A   N M +
Sbjct:   17 AARAGNLDKVVEYLKGGIDIN-TCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGN----TALHIASLAGQAEVVKVLVKEGANINA----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSK------SGFTPLHIAAHYGNVNVATLLLNRGA---AVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNG----LSPLHMAAQGDHVECVKHLLQHKAPVDDV----TLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACKKNRIK-VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ---TPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQI 582          

HSP 4 Score: 180.259 bits (456), Expect = 9.246e-45
Identity = 169/725 (23.31%), Postives = 320/725 (44.14%), Query Frame = 1
Query: 1639 REVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            ++ ++N + L  A   ++ +L+ +   L+ G++I +    G      A +   +     LL RG   ++      + L ++++    E++K L++   + N +   G T L+ +  ++    + Y + +  N           S + + G+  L  ALQ G+   V  +L+             V +  + +A   +   +   L+++  N + + S +  T LH+A    N+ +A  L+  G+ +   +R G    + P+HVA + G   ++++LL  G  +++    K+ + + PLH AA +     V+ L  + +  +   +   +  + L       +V  V+ +L   A V    +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G                       ++S+ L A   H                        S  T    +PL+ A  +G L V KLL++  A    A    G  G  P+H AA + +  +  TLL  G   +   + G+TPLH +  EG  D    L+   AN+++  K G
Sbjct:    6 QKSDSNASFLRAA---RAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN----------QSTATEDGFTPLAVALQQGHNQAVAILLENDTK-------GKVRLPALHIAARKDDTKSAALLLQNDHNAD-VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNG----ITPLHVASKRGNTNMVKLLLDRGGQIDA----KTRDGLTPLHCAARSGHDQVVELLLERGAPLL---ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL----DYLTALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREG--------------------QVDVASVLLEAGAAH------------------------SLATKKGFTPLHVAAKYGSLDVAKLLLQRRA----AADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSG 633          

HSP 5 Score: 176.022 bits (445), Expect = 1.988e-43
Identity = 184/716 (25.70%), Postives = 324/716 (45.25%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH-HSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            + E++ +L+    NIN  +    + L++A Q N + +V  LL  G++ +       T L  ++Q+ H +   +L+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++GA +  T            +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R    +   LLL RG    A      S L ++A   + E +K LLQ++   +      LTALH  +    +R+         T + + K   N ++ +L     ++     N I V+ +L K  A    +       +TPI +A  M  ++ +  L+++GA+ + +++   ET LH+A R   + + + L+  G+ +  R+R    EE  P+H+A + G  EI+++LL   +  ++     +     PLH++A          L    +A    +S  +      L + +K   + V  +L+   A AD +GK         T LHIAA+    +I   LL YGA+    ++T  + G+ P+HLA++ GH ++V L  D G ++  +   GLT LH AA    V++ +IL K GAD +A    G      P+ +A   G+ K V  LL+ G+ +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+   +
Sbjct:   88 QAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA--------RNGITPLHVAS--KRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRV---------TKLLLDK-RANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAI---TESGLTPIHVAAFMGHLNIVLLLLQNGASPD-VTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAR----EEQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQVDVASVLLEAGAA----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK------NGYTPLHIAAKKNQMQIASTLLNYGAE--TNIVT--KQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLG----YTPLIVACHYGNVKMVNFLLKQGANVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAN-GNTALAIAKRLGYISVV 748          

HSP 6 Score: 56.225 bits (134), Expect = 1.464e-17
Identity = 80/365 (21.92%), Postives = 148/365 (40.55%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQ---LIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRK-------ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS 1881
            +GH  IV +LL+ GA+P +   R + T LH +  +  ++ +   ++   L+ +              + + +I        + ++L+     D    N +   ++    E +VD+ SV    G +++       +  KK   PL         ++  +LL  R   +       + L +A + N + + S LL  G++ NI   Q +T L  + Q+ H  M  LL++ GANI+ +            +   S+H+A           L   GA          +++  T +    L +     ++  +NFLL+ G N+ +KT  G TP   A +       N+LL  G   NA  A   + L ++
Sbjct:  412 MGHLNIVLLLLQNGASPDVTNIRGE-TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEI--------VQLLLQHMAHPDAATTNGY-TPLHISAREGQVDVASVLLEAGAAHS-------LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMST----------KSGLTSLHLAAQEDKVNVADILTKHGA----------DQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA 739          

HSP 7 Score: 55.4546 bits (132), Expect = 1.464e-17
Identity = 48/201 (23.88%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            K+G++ LH A    +V++A  L+N     ++F   +       + P+H+A + G T+++K+LL R           + P  C      + +  ++L + + P+  +  N           +PLH+    DH++C+K L+Q  K  ++  ++    TAL +A          +LL+  ANPN   ++  +PL  A K+   +
Sbjct:  202 KSGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARN------GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGA-PLLARTKN---------GLSPLHMAAQGDHVECVKHLLQH-KAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIK 383          

HSP 8 Score: 87.8113 bits (216), Expect = 1.671e-16
Identity = 121/549 (22.04%), Postives = 223/549 (40.62%), Query Frame = 1
Query: 1369 RGSDPNIGRNQP-ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYL-IYALQYGNEIDVVRVLKQAADPDLVFIHNNVT---MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            RG+ P + R +  ++ L  + Q  H +  + L+ + A +++          V L    ++HVA         + L+DK AN                 T LH+A   K N +  +  L++ G +I++ T  G TP   A     +    LLL  G   +  N   E+ L ++A     E+++ LL+N    + +     T LH +     R+G    +     + +  +   D++ +  +GY  ++      ++DV  VL +A        H+  T    TP+ +A +  S+     L++  A  +  +  N  T LH+A +   + IA  L+  G+  ++ ++ G    V P+H+A Q G  +++ +LL  G++++    + +   +  LHLAA  D  +    LT                                      GAD      +      T L +A   G+ ++V  LL+ GA+  A+     ++G  P+H A + GH  I+ +    G   +A    G T L  A   G + +++ L
Sbjct:  292 RGA-PLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDD----------VTLDYLTALHVAAHCGHYRVTKLLLDKRAN--------PNARALNGFTPLHIAC--KKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIAS----RLGKTEIVQ----LLLQHMAHPDAATT--NGYTPLHISAREGQVDVASVLLEAGAA-----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADS-AGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQG----VTPLHLASQEGHTDMVTLLLDKGANIH----MSTKSGLTSLHLAAQEDKVNVADILTKH------------------------------------GADQDAHTKLGY----TPLIVACHYGNVKMVNFLLKQGANVNAKT----KNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 751          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 206.068 bits (523), Expect = 1.258e-52
Identity = 182/725 (25.10%), Postives = 336/725 (46.34%), Query Frame = 1
Query: 1648 ETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLV--FIHNNVT---MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            +  +  LHLA   K   +  +  LL  G +++S T KG+T    A    + E   +L+  G + NA +    + L ++A + + +++K+LL+N  + +     G T L  +  Q              N  +A + +ND+   ++   L  A +  +      +L+   + D+    + N  T    TP+ +A    +++    L+  GA +++ ++ N  T LHVA +  N  + K L+  G  I  ++R G    + P+H A ++G D+++E+LL  G+ L    + ++   ++PLH+AA  D    VK L  Q  A ++                                DV+   +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G       L+  A ++ ++    G + LH+ A+ G  +++  LL+ +   +  G+            ++PL+ A  + +  V  LL++ GA  H         G  P+H AA + +  +  TLL  G   +   + G+TPLH +  EG  D    L+   AN+++  K G
Sbjct:   41 QNGLNALHLAA--KEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQ------------GHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF-TARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDG----LTPLHCAARSGHDQVVELLLERGAPL----LARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVD--------------------------------DVTLDYL-------TALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREGQVDVASVLLE-AGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK----------NGLTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSG 674          

HSP 2 Score: 205.682 bits (522), Expect = 1.814e-52
Identity = 205/823 (24.91%), Postives = 381/823 (46.29%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDS--------NQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D N      + +L  + ++ H  + + L+  G++++         S  K  N A +H+A +    E  + L+ +GAN+          + +   T L++A   + N ++ + +LLE G N  + T  G TP   A++    +A  +LL    + +    +    L ++A K + +    LLQN  ++        N+    G T LH           + + +    +D+   +  T + +A    N +   L        L  G +ID                    VV +L +   P L    N   ++P+ +A + + +  + HL++H A ++ ++  +  T LHVA    +  + K L+   +N + R+  G      P+H+A +    +++E+L+ +G+S+ +     +   + P+H+AA     + V  L  Q  AS ++ + R ++  AL        V  V+ +L  GA V      +R+R   T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G +++  +  + G + S A   G T LH AA  GS+D+ ++LL+  A  ++   +G    + P+H+A+   ++K   LLLE G+  +A      ++  T L+IA  +N+  +   L+  GA  +I     G TPLH+  Q G T  +  L+    +++++   +G++SLHL A++    ++  L +        G   D+ +K      +PL  AC +G++ +V  L+K GA+++ A+T  G+    P+H AA +G  H+I  LL+ G   +    +G T L
Sbjct:   33 GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVD---------SATKKGNTA-LHIASLAGQAEVVKVLVKEGANI--------NAQSQNGFTPLYMAA--QENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKL-------LLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNG--LSPLHMAAQGDHVECVKHLLQHKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNG----FTPLHIACKKNRIKVMELLVKYGASIQAI----TESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVTNIRGET--ALHMAARAGQVEVVRCLLRNGALVD-----ARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDA----ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNG----LTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQ-GVTPLHLASQEGHTDMVTLLLD-KGANIHMSTKSGLTSLHLAAQEDKVNVADILTK-------HGADQDAHTK---LGYTPLIVACHYGNVKMVNFLLKQGANVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 777          

HSP 3 Score: 193.741 bits (491), Expect = 7.683e-49
Identity = 162/592 (27.36%), Postives = 281/592 (47.47%), Query Frame = 1
Query: 2209 AVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLT------------------------HQQSASINI-NSTRSDSFNALLTLVSKRNVIGVQSVLMAG---ADVSGKCIVSRSRNA--TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT--------------------------GQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            A    ++  +   ++ G ++N   + N    LH+A +  ++ + +EL+  GS++   ++ G       +H+A   G  E++++L+  G+++N+    +S     PL++AA  +    VK+L                         H Q+ +I + N T+       L + ++++     ++L+     ADV  K +V+R+  +  T LHIAA  G+  +  LLL  GA   A   T  R+GI P+H+A++ G+  +VKL  D G  + A    GLT LH AA +G   ++E+LL+ GA + A   +G    + P+HMA++  H + VK LL++ +P++ V      D LTAL++A       V K L+   ANP+ +  N G TPLHI C++   K +M L+    +S+     +G++ +H+ A  GH  +   LL+   +P++T                          G + D+ +++     +PL+ A   G   +V+LL++  A    A T     G  P+H +A  G+  V   LLEAG +     + G TPLH +   G  D  K L+  +A  +   K G  P
Sbjct:   17 AARAGNLDKVVEYLKGGIDIN-TCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGN----TALHIASLAGQAEVVKVLVKEGANINA----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGA---AVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNG----LSPLHMAAQGDHVECVKHLLQHKAPVDDV----TLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACKKNRIK-VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ---TPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 578          

HSP 4 Score: 171.4 bits (433), Expect = 5.884e-42
Identity = 171/735 (23.27%), Postives = 317/735 (43.13%), Query Frame = 1
Query: 1639 REVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIR--HGANLNYISSPNQET-----VLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            ++ ++N + L  A   ++ +L+ +   L+ G++I +    G      A +   +     LL RG   ++      + L ++++    E++K L++   + N +   G T L+ +  ++    + Y + +  N           S + + G+  L  ALQ G+   V  +L+             V +  + +A   +   +   L++  H A++      N+ T      LH+A    N+ +A  L+  G+ +   +R G    + P+HVA + G   ++++LL  G  +++    K+ + + PLH AA +     V+ L  + +  +   +   +  + L       +V  V+ +L   A V    +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G                       ++S+ L A   H                        S  T    +PL+ A  +G L V KLL++  A    A    G  G+ P+H AA      V   LLE G S     ++G TPLH +  +        L+   A  NI+ K G  P
Sbjct:    6 QKSDSNASFLRAA---RAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN----------QSTATEDGFTPLAVALQQGHNQAVAILLENDTK-------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNG----ITPLHVASKRGNTNMVKLLLDRGGQIDA----KTRDGLTPLHCAARSGHDQVVELLLERGAPLL---ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL----DYLTALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREG--------------------QVDVASVLLEAGAAH------------------------SLATKKGFTPLHVAAKYGSLDVAKLLLQRRA----AADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTP 644          

HSP 5 Score: 164.851 bits (416), Expect = 5.690e-40
Identity = 185/753 (24.57%), Postives = 324/753 (43.03%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS--------------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH-HSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITG-----------------------------DRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            + E++ +L+    NIN  +    + L++A Q N + +V  LL  G++ +       T L  ++Q+ H +   +L+             +  A  ++     L+L N    +  S              +H+A  Y +      L+++GA +  T            +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R    +   LLL RG    A      S L ++A   + E +K LLQ++   +      LTALH  +    +R+         T + + K   N ++ +L     ++     N I V+ +L K  A    +       +TPI +A  M  ++ +  L+++GA+ + +++   ET LH+A R   + + + L+  G+ +  R+R    EE  P+H+A + G  EI+++LL   +  ++     +     PLH++A          L    +A    +S  +      L + +K   + V  +L+   A AD +GK         T LH+AA   + ++  LLLE GA P A    G                              + G+ P+HLA++ GH ++V L  D G ++  +   GLT LH AA    V++ +IL K GAD +A    G      P+ +A   G+ K V  LL+ G+ +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+   +
Sbjct:   88 QAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA--------RNGITPLHVAS--KRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRV---------TKLLLDK-RANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAI---TESGLTPIHVAAFMGHLNIVLLLLQNGASPD-VTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAR----EEQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQVDVASVLLEAGAA----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK------NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLG----YTPLIVACHYGNVKMVNFLLKQGANVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAN-GNTALAIAKRLGYISVV 789          

HSP 6 Score: 132.109 bits (331), Expect = 5.518e-30
Identity = 125/485 (25.77%), Postives = 211/485 (43.51%), Query Frame = 1
Query: 2485 STMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIG-VQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLE--YGSPINA--VFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADI------------------HWAET-----------FEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTA 3837
            +TM+ KS    + L  A   +L   V++L       I+IN+   +  NAL  L +K   +G VQ +L  G+ V      +  +  T LHIA+  G  E+V++L++ GA+  A+     ++G  P+++A +  H+++VK   + G + S A + G T L  A   G    + ILL        E     + ++  +H+A+ K   KS  LLL+  + + + +  + +R      T L+IA      NV   L+  GA  D    N G TPLH+  +RG T  +  L+      ++     G++ LH  A  GH+++   LL  +  P L          +T   +SPL+ A    H+  VK L++  A +                  H+  T                G  P+H A  + +  V+  L++ G SI    E GLTP+H +   G  +    L+   A+ ++ +  G+     A  A
Sbjct:    2 TTMLQKSDSNASFLRAARAGNLDKVVEYL----KGGIDINTCNQNGLNAL-HLAAKEGHVGLVQELLGRGSSVDS----ATKKGNTALHIASLAGQAEVVKVLVKEGANINAQ----SQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL--------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-GITPLHVASKRGNTNMVKLLLD-RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLE-RGAPLLA---------RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARA 453          

HSP 7 Score: 98.9821 bits (245), Expect = 6.671e-20
Identity = 122/539 (22.63%), Postives = 230/539 (42.67%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSL--KSGY--LIYALQYGNEIDVVRVLKQ---AADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            +T+L  +    H ++T+LL++  AN N             L     +H+A   +  +  + L+  GA++        +   E+ +T +H+A  +    LN +  LL+ G + +    +G+T    A R  ++E    LL  G   +A     ++ L +++     EI++ LLQ+    +     G T LH S  ++ ++       D  ++ +    +  ++HSL  K G+  L  A +YG+ +DV ++L Q   AAD           +TP+ +A   ++      L+  GA+  + ++ N  T LH+A +   + IA  L+  G+  ++ ++ G    V P+H+A Q G  +++ +LL  G++++    + +   +  LHLAA  D  +    LT                                      GAD      +      T L +A   G+ ++V  LL+ GA+  A+     ++G  P+H A + GH  I+ +    G   +A    G T L  A   G + +++ L
Sbjct:  345 LTALHVAAHCGHYRVTKLLLDKRANPNARA----------LNGFTPLHIACKKNRIKVMELLVKYGASI--------QAITESGLTPIHVAAFM--GHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHIS-AREGQV-------DVASVLL----EAGAAHSLATKKGFTPLHVAAKYGS-LDVAKLLLQRRAAADS-----AGKNGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQG----VTPLHLASQEGHTDMVTLLLDKGANIH----MSTKSGLTSLHLAAQEDKVNVADILTKH------------------------------------GADQDAHTKLGY----TPLIVACHYGNVKMVNFLLKQGANVNAKT----KNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 792          

HSP 8 Score: 63.5438 bits (153), Expect = 2.337e-19
Identity = 86/395 (21.77%), Postives = 166/395 (42.03%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQ---LIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRK-------ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH  IV +LL+ GA+P +   R + T LH +  +  ++ +   ++   L+ +              + + +I        + ++L+     D    N +   ++    E +VD+ SV    G +++       +  KK   PL         ++  +LL  R   +       + L +A   +   +   LL +G+ P+       T L  + +K   ++   L+NYGA  N       +++   +T    +H+A      +    L+DKGAN+ ++         ++ +T LHLA   + + +N  + L + G + ++ T  G TP + A  Y  ++  N LL +G + NA      + L  +A + +  I+  LLQ+    N     G TAL
Sbjct:  420 MGHLNIVLLLLQNGASPDVTNIRGE-TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEI--------VQLLLQHMAHPDAATTNGY-TPLHISAREGQVDVASVLLEAGAAHS-------LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETN-------IVTKQGVT---PLHLASQEGHTDMVTLLLDKGANIHMS--------TKSGLTSLHLAA--QEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 777          

HSP 9 Score: 53.9138 bits (128), Expect = 2.337e-19
Identity = 47/201 (23.38%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            ++G++ LH A    +V++A  L+N     ++F   +       + P+H+A + G T+++K+LL R           + P  C      + +  ++L + + P+  +  N           +PLH+    DH++C+K L+Q  K  ++  ++    TAL +A          +LL+  ANPN   ++  +PL  A K+   +
Sbjct:  210 ESGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARN------GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGA-PLLARTKN---------GLSPLHMAAQGDHVECVKHLLQH-KAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIK 391          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 206.068 bits (523), Expect = 1.260e-52
Identity = 182/725 (25.10%), Postives = 336/725 (46.34%), Query Frame = 1
Query: 1648 ETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLV--FIHNNVT---MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            +  +  LHLA   K   +  +  LL  G +++S T KG+T    A    + E   +L+  G + NA +    + L ++A + + +++K+LL+N  + +     G T L  +  Q              N  +A + +ND+   ++   L  A +  +      +L+   + D+    + N  T    TP+ +A    +++    L+  GA +++ ++ N  T LHVA +  N  + K L+  G  I  ++R G    + P+H A ++G D+++E+LL  G+ L    + ++   ++PLH+AA  D    VK L  Q  A ++                                DV+   +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G       L+  A ++ ++    G + LH+ A+ G  +++  LL+ +   +  G+            ++PL+ A  + +  V  LL++ GA  H         G  P+H AA + +  +  TLL  G   +   + G+TPLH +  EG  D    L+   AN+++  K G
Sbjct:   34 QNGLNALHLAA--KEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQ------------GHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF-TARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDG----LTPLHCAARSGHDQVVELLLERGAPL----LARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVD--------------------------------DVTLDYL-------TALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREGQVDVASVLLE-AGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK----------NGLTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSG 667          

HSP 2 Score: 205.682 bits (522), Expect = 1.817e-52
Identity = 205/823 (24.91%), Postives = 381/823 (46.29%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDS--------NQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D N      + +L  + ++ H  + + L+  G++++         S  K  N A +H+A +    E  + L+ +GAN+          + +   T L++A   + N ++ + +LLE G N  + T  G TP   A++    +A  +LL    + +    +    L ++A K + +    LLQN  ++        N+    G T LH           + + +    +D+   +  T + +A    N +   L        L  G +ID                    VV +L +   P L    N   ++P+ +A + + +  + HL++H A ++ ++  +  T LHVA    +  + K L+   +N + R+  G      P+H+A +    +++E+L+ +G+S+ +     +   + P+H+AA     + V  L  Q  AS ++ + R ++  AL        V  V+ +L  GA V      +R+R   T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G +++  +  + G + S A   G T LH AA  GS+D+ ++LL+  A  ++   +G    + P+H+A+   ++K   LLLE G+  +A      ++  T L+IA  +N+  +   L+  GA  +I     G TPLH+  Q G T  +  L+    +++++   +G++SLHL A++    ++  L +        G   D+ +K      +PL  AC +G++ +V  L+K GA+++ A+T  G+    P+H AA +G  H+I  LL+ G   +    +G T L
Sbjct:   26 GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVD---------SATKKGNTA-LHIASLAGQAEVVKVLVKEGANI--------NAQSQNGFTPLYMAA--QENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKL-------LLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNG--LSPLHMAAQGDHVECVKHLLQHKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNG----FTPLHIACKKNRIKVMELLVKYGASIQAI----TESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVTNIRGET--ALHMAARAGQVEVVRCLLRNGALVD-----ARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDA----ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNG----LTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQ-GVTPLHLASQEGHTDMVTLLLD-KGANIHMSTKSGLTSLHLAAQEDKVNVADILTK-------HGADQDAHTK---LGYTPLIVACHYGNVKMVNFLLKQGANVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 770          

HSP 3 Score: 193.741 bits (491), Expect = 7.698e-49
Identity = 162/592 (27.36%), Postives = 281/592 (47.47%), Query Frame = 1
Query: 2209 AVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLT------------------------HQQSASINI-NSTRSDSFNALLTLVSKRNVIGVQSVLMAG---ADVSGKCIVSRSRNA--TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT--------------------------GQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            A    ++  +   ++ G ++N   + N    LH+A +  ++ + +EL+  GS++   ++ G       +H+A   G  E++++L+  G+++N+    +S     PL++AA  +    VK+L                         H Q+ +I + N T+       L + ++++     ++L+     ADV  K +V+R+  +  T LHIAA  G+  +  LLL  GA   A   T  R+GI P+H+A++ G+  +VKL  D G  + A    GLT LH AA +G   ++E+LL+ GA + A   +G    + P+HMA++  H + VK LL++ +P++ V      D LTAL++A       V K L+   ANP+ +  N G TPLHI C++   K +M L+    +S+     +G++ +H+ A  GH  +   LL+   +P++T                          G + D+ +++     +PL+ A   G   +V+LL++  A    A T     G  P+H +A  G+  V   LLEAG +     + G TPLH +   G  D  K L+  +A  +   K G  P
Sbjct:   10 AARAGNLDKVVEYLKGGIDIN-TCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGN----TALHIASLAGQAEVVKVLVKEGANINA----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGA---AVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNG----LSPLHMAAQGDHVECVKHLLQHKAPVDDV----TLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACKKNRIK-VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ---TPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 571          

HSP 4 Score: 171.014 bits (432), Expect = 6.097e-42
Identity = 171/732 (23.36%), Postives = 315/732 (43.03%), Query Frame = 1
Query: 1648 ETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIR--HGANLNYISSPNQET-----VLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            ++N + L  A   ++ +L+ +   L+ G++I +    G      A +   +     LL RG   ++      + L ++++    E++K L++   + N +   G T L+ +  ++    + Y + +  N           S + + G+  L  ALQ G+   V  +L+             V +  + +A   +   +   L++  H A++      N+ T      LH+A    N+ +A  L+  G+ +   +R G    + P+HVA + G   ++++LL  G  +++    K+ + + PLH AA +     V+ L  + +  +   +   +  + L       +V  V+ +L   A V    +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G                       ++S+ L A   H                        S  T    +PL+ A  +G L V KLL++  A    A    G  G+ P+H AA      V   LLE G S     ++G TPLH +  +        L+   A  NI+ K G  P
Sbjct:    2 DSNASFLRAA---RAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN----------QSTATEDGFTPLAVALQQGHNQAVAILLENDTK-------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNG----ITPLHVASKRGNTNMVKLLLDRGGQIDA----KTRDGLTPLHCAARSGHDQVVELLLERGAPLL---ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL----DYLTALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREG--------------------QVDVASVLLEAGAAH------------------------SLATKKGFTPLHVAAKYGSLDVAKLLLQRRA----AADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTP 637          

HSP 5 Score: 164.851 bits (416), Expect = 5.699e-40
Identity = 185/753 (24.57%), Postives = 324/753 (43.03%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS--------------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH-HSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITG-----------------------------DRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            + E++ +L+    NIN  +    + L++A Q N + +V  LL  G++ +       T L  ++Q+ H +   +L+             +  A  ++     L+L N    +  S              +H+A  Y +      L+++GA +  T            +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R    +   LLL RG    A      S L ++A   + E +K LLQ++   +      LTALH  +    +R+         T + + K   N ++ +L     ++     N I V+ +L K  A    +       +TPI +A  M  ++ +  L+++GA+ + +++   ET LH+A R   + + + L+  G+ +  R+R    EE  P+H+A + G  EI+++LL   +  ++     +     PLH++A          L    +A    +S  +      L + +K   + V  +L+   A AD +GK         T LH+AA   + ++  LLLE GA P A    G                              + G+ P+HLA++ GH ++V L  D G ++  +   GLT LH AA    V++ +IL K GAD +A    G      P+ +A   G+ K V  LL+ G+ +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+   +
Sbjct:   81 QAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA--------RNGITPLHVAS--KRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRV---------TKLLLDK-RANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAI---TESGLTPIHVAAFMGHLNIVLLLLQNGASPD-VTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAR----EEQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQVDVASVLLEAGAA----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK------NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLG----YTPLIVACHYGNVKMVNFLLKQGANVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAN-GNTALAIAKRLGYISVV 782          

HSP 6 Score: 130.568 bits (327), Expect = 1.307e-29
Identity = 111/399 (27.82%), Postives = 185/399 (46.37%), Query Frame = 1
Query: 2614 SDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNL-------GATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVN 3789
            SDS  + L      N+  V   L  G D++             LH+AA+ G   +VQ LL  G+     + +  + G   +H+A+ +G  E+VK+    G +++A    G T L+ AA    +D+++ LL+ GA+ +    DG      P+ +A ++GH ++V +LLE  +          +  L AL+IA  ++       L+++  N D+Q   +       G TPLHI    G       L+    ++++     GI+ LH+ +++G+  +   LL      +  GQI      KT   ++PL+ A   GH  VV+LL++ GA +  A T     G+ P+H AA       +  LL+    +D+   D LT LH +   G Y  TK L+  +AN N
Sbjct:    1 SDSNASFLRAARAGNLDKVVEYLKGGIDIN----TCNQNGLNALHLAAKEGHVGLVQELLGRGSS----VDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDG----FTPLAVALQQGHNQAVAILLENDTK--------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLN-RGAAVDFTARNGITPLHVASKRGNTNMVKLLL------DRGGQI----DAKTRDGLTPLHCAARSGHDQVVELLLERGAPL-LART---KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPN 364          

HSP 7 Score: 126.716 bits (317), Expect = 1.978e-28
Identity = 121/472 (25.64%), Postives = 204/472 (43.22%), Query Frame = 1
Query: 2524 LHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIG-VQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLE--YGSPINA--VFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADI------------------HWAET-----------FEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTA 3837
            L  A   +L   V++L       I+IN+   +  NAL  L +K   +G VQ +L  G+ V      +  +  T LHIA+  G  E+V++L++ GA+  A+     ++G  P+++A +  H+++VK   + G + S A + G T L  A   G    + ILL        E     + ++  +H+A+ K   KS  LLL+  + + + +  + +R      T L+IA      NV   L+  GA  D    N G TPLH+  +RG T  +  L+      ++     G++ LH  A  GH+++   LL  +  P L          +T   +SPL+ A    H+  VK L++  A +                  H+  T                G  P+H A  + +  V+  L++ G SI    E GLTP+H +   G  +    L+   A+ ++ +  G+     A  A
Sbjct:    8 LRAARAGNLDKVVEYL----KGGIDINTCNQNGLNAL-HLAAKEGHVGLVQELLGRGSSVDS----ATKKGNTALHIASLAGQAEVVKVLVKEGANINAQ----SQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL--------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-GITPLHVASKRGNTNMVKLLLD-RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLE-RGAPLLA---------RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARA 446          

HSP 8 Score: 98.9821 bits (245), Expect = 6.676e-20
Identity = 122/539 (22.63%), Postives = 230/539 (42.67%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSL--KSGY--LIYALQYGNEIDVVRVLKQ---AADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            +T+L  +    H ++T+LL++  AN N             L     +H+A   +  +  + L+  GA++        +   E+ +T +H+A  +    LN +  LL+ G + +    +G+T    A R  ++E    LL  G   +A     ++ L +++     EI++ LLQ+    +     G T LH S  ++ ++       D  ++ +    +  ++HSL  K G+  L  A +YG+ +DV ++L Q   AAD           +TP+ +A   ++      L+  GA+  + ++ N  T LH+A +   + IA  L+  G+  ++ ++ G    V P+H+A Q G  +++ +LL  G++++    + +   +  LHLAA  D  +    LT                                      GAD      +      T L +A   G+ ++V  LL+ GA+  A+     ++G  P+H A + GH  I+ +    G   +A    G T L  A   G + +++ L
Sbjct:  338 LTALHVAAHCGHYRVTKLLLDKRANPNARA----------LNGFTPLHIACKKNRIKVMELLVKYGASI--------QAITESGLTPIHVAAFM--GHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHIS-AREGQV-------DVASVLL----EAGAAHSLATKKGFTPLHVAAKYGS-LDVAKLLLQRRAAADS-----AGKNGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQG----VTPLHLASQEGHTDMVTLLLDKGANIH----MSTKSGLTSLHLAAQEDKVNVADILTKH------------------------------------GADQDAHTKLGY----TPLIVACHYGNVKMVNFLLKQGANVNAKT----KNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 785          

HSP 9 Score: 63.5438 bits (153), Expect = 2.356e-19
Identity = 86/395 (21.77%), Postives = 166/395 (42.03%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQ---LIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRK-------ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH  IV +LL+ GA+P +   R + T LH +  +  ++ +   ++   L+ +              + + +I        + ++L+     D    N +   ++    E +VD+ SV    G +++       +  KK   PL         ++  +LL  R   +       + L +A   +   +   LL +G+ P+       T L  + +K   ++   L+NYGA  N       +++   +T    +H+A      +    L+DKGAN+ ++         ++ +T LHLA   + + +N  + L + G + ++ T  G TP + A  Y  ++  N LL +G + NA      + L  +A + +  I+  LLQ+    N     G TAL
Sbjct:  413 MGHLNIVLLLLQNGASPDVTNIRGE-TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEI--------VQLLLQHMAHPDAATTNGY-TPLHISAREGQVDVASVLLEAGAAHS-------LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETN-------IVTKQGVT---PLHLASQEGHTDMVTLLLDKGANIHMS--------TKSGLTSLHLAA--QEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 770          

HSP 10 Score: 53.9138 bits (128), Expect = 2.356e-19
Identity = 47/201 (23.38%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            ++G++ LH A    +V++A  L+N     ++F   +       + P+H+A + G T+++K+LL R           + P  C      + +  ++L + + P+  +  N           +PLH+    DH++C+K L+Q  K  ++  ++    TAL +A          +LL+  ANPN   ++  +PL  A K+   +
Sbjct:  203 ESGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARN------GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGA-PLLARTKN---------GLSPLHMAAQGDHVECVKHLLQH-KAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIK 384          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 206.068 bits (523), Expect = 1.261e-52
Identity = 182/725 (25.10%), Postives = 336/725 (46.34%), Query Frame = 1
Query: 1648 ETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLV--FIHNNVT---MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            +  +  LHLA   K   +  +  LL  G +++S T KG+T    A    + E   +L+  G + NA +    + L ++A + + +++K+LL+N  + +     G T L  +  Q              N  +A + +ND+   ++   L  A +  +      +L+   + D+    + N  T    TP+ +A    +++    L+  GA +++ ++ N  T LHVA +  N  + K L+  G  I  ++R G    + P+H A ++G D+++E+LL  G+ L    + ++   ++PLH+AA  D    VK L  Q  A ++                                DV+   +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G       L+  A ++ ++    G + LH+ A+ G  +++  LL+ +   +  G+            ++PL+ A  + +  V  LL++ GA  H         G  P+H AA + +  +  TLL  G   +   + G+TPLH +  EG  D    L+   AN+++  K G
Sbjct:   41 QNGLNALHLAA--KEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQ------------GHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF-TARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDG----LTPLHCAARSGHDQVVELLLERGAPL----LARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVD--------------------------------DVTLDYL-------TALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREGQVDVASVLLE-AGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK----------NGLTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSG 674          

HSP 2 Score: 205.682 bits (522), Expect = 1.818e-52
Identity = 205/823 (24.91%), Postives = 381/823 (46.29%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDS--------NQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D N      + +L  + ++ H  + + L+  G++++         S  K  N A +H+A +    E  + L+ +GAN+          + +   T L++A   + N ++ + +LLE G N  + T  G TP   A++    +A  +LL    + +    +    L ++A K + +    LLQN  ++        N+    G T LH           + + +    +D+   +  T + +A    N +   L        L  G +ID                    VV +L +   P L    N   ++P+ +A + + +  + HL++H A ++ ++  +  T LHVA    +  + K L+   +N + R+  G      P+H+A +    +++E+L+ +G+S+ +     +   + P+H+AA     + V  L  Q  AS ++ + R ++  AL        V  V+ +L  GA V      +R+R   T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G +++  +  + G + S A   G T LH AA  GS+D+ ++LL+  A  ++   +G    + P+H+A+   ++K   LLLE G+  +A      ++  T L+IA  +N+  +   L+  GA  +I     G TPLH+  Q G T  +  L+    +++++   +G++SLHL A++    ++  L +        G   D+ +K      +PL  AC +G++ +V  L+K GA+++ A+T  G+    P+H AA +G  H+I  LL+ G   +    +G T L
Sbjct:   33 GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVD---------SATKKGNTA-LHIASLAGQAEVVKVLVKEGANI--------NAQSQNGFTPLYMAA--QENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKL-------LLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNG--LSPLHMAAQGDHVECVKHLLQHKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNG----FTPLHIACKKNRIKVMELLVKYGASIQAI----TESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVTNIRGET--ALHMAARAGQVEVVRCLLRNGALVD-----ARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDA----ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNG----LTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQ-GVTPLHLASQEGHTDMVTLLLD-KGANIHMSTKSGLTSLHLAAQEDKVNVADILTK-------HGADQDAHTK---LGYTPLIVACHYGNVKMVNFLLKQGANVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 777          

HSP 3 Score: 193.741 bits (491), Expect = 7.701e-49
Identity = 162/592 (27.36%), Postives = 281/592 (47.47%), Query Frame = 1
Query: 2209 AVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLT------------------------HQQSASINI-NSTRSDSFNALLTLVSKRNVIGVQSVLMAG---ADVSGKCIVSRSRNA--TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT--------------------------GQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            A    ++  +   ++ G ++N   + N    LH+A +  ++ + +EL+  GS++   ++ G       +H+A   G  E++++L+  G+++N+    +S     PL++AA  +    VK+L                         H Q+ +I + N T+       L + ++++     ++L+     ADV  K +V+R+  +  T LHIAA  G+  +  LLL  GA   A   T  R+GI P+H+A++ G+  +VKL  D G  + A    GLT LH AA +G   ++E+LL+ GA + A   +G    + P+HMA++  H + VK LL++ +P++ V      D LTAL++A       V K L+   ANP+ +  N G TPLHI C++   K +M L+    +S+     +G++ +H+ A  GH  +   LL+   +P++T                          G + D+ +++     +PL+ A   G   +V+LL++  A    A T     G  P+H +A  G+  V   LLEAG +     + G TPLH +   G  D  K L+  +A  +   K G  P
Sbjct:   17 AARAGNLDKVVEYLKGGIDIN-TCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGN----TALHIASLAGQAEVVKVLVKEGANINA----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGA---AVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNG----LSPLHMAAQGDHVECVKHLLQHKAPVDDV----TLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACKKNRIK-VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ---TPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 578          

HSP 4 Score: 171.4 bits (433), Expect = 5.896e-42
Identity = 171/735 (23.27%), Postives = 317/735 (43.13%), Query Frame = 1
Query: 1639 REVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIR--HGANLNYISSPNQET-----VLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            ++ ++N + L  A   ++ +L+ +   L+ G++I +    G      A +   +     LL RG   ++      + L ++++    E++K L++   + N +   G T L+ +  ++    + Y + +  N           S + + G+  L  ALQ G+   V  +L+             V +  + +A   +   +   L++  H A++      N+ T      LH+A    N+ +A  L+  G+ +   +R G    + P+HVA + G   ++++LL  G  +++    K+ + + PLH AA +     V+ L  + +  +   +   +  + L       +V  V+ +L   A V    +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G                       ++S+ L A   H                        S  T    +PL+ A  +G L V KLL++  A    A    G  G+ P+H AA      V   LLE G S     ++G TPLH +  +        L+   A  NI+ K G  P
Sbjct:    6 QKSDSNASFLRAA---RAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN----------QSTATEDGFTPLAVALQQGHNQAVAILLENDTK-------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNG----ITPLHVASKRGNTNMVKLLLDRGGQIDA----KTRDGLTPLHCAARSGHDQVVELLLERGAPLL---ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL----DYLTALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREG--------------------QVDVASVLLEAGAAH------------------------SLATKKGFTPLHVAAKYGSLDVAKLLLQRRA----AADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTP 644          

HSP 5 Score: 164.851 bits (416), Expect = 5.701e-40
Identity = 185/753 (24.57%), Postives = 324/753 (43.03%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS--------------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH-HSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITG-----------------------------DRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            + E++ +L+    NIN  +    + L++A Q N + +V  LL  G++ +       T L  ++Q+ H +   +L+             +  A  ++     L+L N    +  S              +H+A  Y +      L+++GA +  T            +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R    +   LLL RG    A      S L ++A   + E +K LLQ++   +      LTALH  +    +R+         T + + K   N ++ +L     ++     N I V+ +L K  A    +       +TPI +A  M  ++ +  L+++GA+ + +++   ET LH+A R   + + + L+  G+ +  R+R    EE  P+H+A + G  EI+++LL   +  ++     +     PLH++A          L    +A    +S  +      L + +K   + V  +L+   A AD +GK         T LH+AA   + ++  LLLE GA P A    G                              + G+ P+HLA++ GH ++V L  D G ++  +   GLT LH AA    V++ +IL K GAD +A    G      P+ +A   G+ K V  LL+ G+ +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+   +
Sbjct:   88 QAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA--------RNGITPLHVAS--KRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRV---------TKLLLDK-RANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAI---TESGLTPIHVAAFMGHLNIVLLLLQNGASPD-VTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAR----EEQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQVDVASVLLEAGAA----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK------NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLG----YTPLIVACHYGNVKMVNFLLKQGANVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAN-GNTALAIAKRLGYISVV 789          

HSP 6 Score: 132.109 bits (331), Expect = 5.526e-30
Identity = 125/485 (25.77%), Postives = 211/485 (43.51%), Query Frame = 1
Query: 2485 STMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIG-VQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLE--YGSPINA--VFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADI------------------HWAET-----------FEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTA 3837
            +TM+ KS    + L  A   +L   V++L       I+IN+   +  NAL  L +K   +G VQ +L  G+ V      +  +  T LHIA+  G  E+V++L++ GA+  A+     ++G  P+++A +  H+++VK   + G + S A + G T L  A   G    + ILL        E     + ++  +H+A+ K   KS  LLL+  + + + +  + +R      T L+IA      NV   L+  GA  D    N G TPLH+  +RG T  +  L+      ++     G++ LH  A  GH+++   LL  +  P L          +T   +SPL+ A    H+  VK L++  A +                  H+  T                G  P+H A  + +  V+  L++ G SI    E GLTP+H +   G  +    L+   A+ ++ +  G+     A  A
Sbjct:    2 TTMLQKSDSNASFLRAARAGNLDKVVEYL----KGGIDINTCNQNGLNAL-HLAAKEGHVGLVQELLGRGSSVDS----ATKKGNTALHIASLAGQAEVVKVLVKEGANINAQ----SQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL--------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-GITPLHVASKRGNTNMVKLLLD-RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLE-RGAPLLA---------RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARA 453          

HSP 7 Score: 98.9821 bits (245), Expect = 6.677e-20
Identity = 122/539 (22.63%), Postives = 230/539 (42.67%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSL--KSGY--LIYALQYGNEIDVVRVLKQ---AADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            +T+L  +    H ++T+LL++  AN N             L     +H+A   +  +  + L+  GA++        +   E+ +T +H+A  +    LN +  LL+ G + +    +G+T    A R  ++E    LL  G   +A     ++ L +++     EI++ LLQ+    +     G T LH S  ++ ++       D  ++ +    +  ++HSL  K G+  L  A +YG+ +DV ++L Q   AAD           +TP+ +A   ++      L+  GA+  + ++ N  T LH+A +   + IA  L+  G+  ++ ++ G    V P+H+A Q G  +++ +LL  G++++    + +   +  LHLAA  D  +    LT                                      GAD      +      T L +A   G+ ++V  LL+ GA+  A+     ++G  P+H A + GH  I+ +    G   +A    G T L  A   G + +++ L
Sbjct:  345 LTALHVAAHCGHYRVTKLLLDKRANPNARA----------LNGFTPLHIACKKNRIKVMELLVKYGASI--------QAITESGLTPIHVAAFM--GHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHIS-AREGQV-------DVASVLL----EAGAAHSLATKKGFTPLHVAAKYGS-LDVAKLLLQRRAAADS-----AGKNGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQG----VTPLHLASQEGHTDMVTLLLDKGANIH----MSTKSGLTSLHLAAQEDKVNVADILTKH------------------------------------GADQDAHTKLGY----TPLIVACHYGNVKMVNFLLKQGANVNAKT----KNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 792          

HSP 8 Score: 63.5438 bits (153), Expect = 2.356e-19
Identity = 86/395 (21.77%), Postives = 166/395 (42.03%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQ---LIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRK-------ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH  IV +LL+ GA+P +   R + T LH +  +  ++ +   ++   L+ +              + + +I        + ++L+     D    N +   ++    E +VD+ SV    G +++       +  KK   PL         ++  +LL  R   +       + L +A   +   +   LL +G+ P+       T L  + +K   ++   L+NYGA  N       +++   +T    +H+A      +    L+DKGAN+ ++         ++ +T LHLA   + + +N  + L + G + ++ T  G TP + A  Y  ++  N LL +G + NA      + L  +A + +  I+  LLQ+    N     G TAL
Sbjct:  420 MGHLNIVLLLLQNGASPDVTNIRGE-TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEI--------VQLLLQHMAHPDAATTNGY-TPLHISAREGQVDVASVLLEAGAAHS-------LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETN-------IVTKQGVT---PLHLASQEGHTDMVTLLLDKGANIHMS--------TKSGLTSLHLAA--QEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 777          

HSP 9 Score: 53.9138 bits (128), Expect = 2.356e-19
Identity = 47/201 (23.38%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            ++G++ LH A    +V++A  L+N     ++F   +       + P+H+A + G T+++K+LL R           + P  C      + +  ++L + + P+  +  N           +PLH+    DH++C+K L+Q  K  ++  ++    TAL +A          +LL+  ANPN   ++  +PL  A K+   +
Sbjct:  210 ESGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARN------GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGA-PLLARTKN---------GLSPLHMAAQGDHVECVKHLLQH-KAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIK 391          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 191.815 bits (486), Expect = 1.200e-48
Identity = 190/775 (24.52%), Postives = 347/775 (44.77%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTS---------------TVKFLT---------HQQSASININSTRSDSFNAL-----LTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDG----------------------NRSKML-------PIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K      +  L++    +++ T KG+T    A    +     +L+  G + N  +    + L ++A + + E++K+LL++  +       G T L  +  Q          HD     +A + +NDS   ++   L  A +  +      +L+   +PD   + +    TP+ +A      +    L+  GAN+NY +  N  + LHVA +     +A  L+  G+ I  R++    + + P+H A ++G D+++++L++ G+ +++    K+   + PLH+AA  D                  TV +LT         H + A + ++ +   +  AL     L +  K+N I V  +L+           +     T LH+AA +G+  IV  LL+ GA+P    + G+     P+HLA  +   ++V++    G  V A      T LH A+  G+ DI+ +LL+AGA+ NA   D                       N  K L       P+H+AS+ G+ + V+LLLE G+P++       ++ +T L++A   N + V   L+++GA+      N G TPLHI  ++   +    L+    +  N     G + LHL+A++GH E+S  L+    N +  G        K +  ++ ++      H+ V ++L   GA+I+     + + G  P+H A   G+ +++  L+E G  + E      TPLH +  +G  +C ++L+   A+ N     G+ P
Sbjct:   70 LHLAS--KEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQG---------HDRV---VAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPD---VTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNI-SPLHVATKWGRTNMANLLLSRGAIIDSRTK----DLLTPLHCAARSGHDQVVDLLVVQGAPISA----KTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL---KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET----PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE----GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKN-GYTPLHIAAKKNQMEIASTLLQF-KADPNAKSRAGFTPLHLSAQEGHKEISGLLIE---NGSDVG-------AKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN----SKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTP 791          

HSP 2 Score: 188.348 bits (477), Expect = 1.465e-47
Identity = 218/865 (25.20%), Postives = 382/865 (44.16%), Query Frame = 1
Query: 1147 DINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQET-FQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQ--VDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHK---GIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            DIN+       SN NGL+ L +  K+    + +ELI      +  ++    K  + L +A       +V+ L+  G++ N+      T L  + Q+ H+++ + L+ +GAN                        AL   D  T     + +G +  + V L ++ + +  +  LH+A   K +       LL+   N +  +  G TP   A  Y       LLL +G + N     N S L ++       +   LL     +DS  KD   LT LH +     R G     HD                                  VV +L     P      N   + P+ +A + + +     L+ H A ++ ++  +  T LHVA    ++ +AK L+   ++ + R+  G      P+H+A +    +++E+LL + +++ +T    +   + PLH+AA     + V +L  QQ A+ ++ + R ++    L L ++ N   V  VL+     +G  + +++R   T LHIA+++G+ +IV LLL+ GA+  A      RD   P+H+A + G  E+  +  D     +     G T LH A+  G+++++ +LL+ G  V+ E     ++++ P+H+A+   + K   LLLE G+   A      ++  T L+IA  +N+  +   L++  A+P+  ++  G TPLH++ Q G  K I  L+    S +    N G++++HL A++ H  ++  L       N           KT+   +PL+ AC FG L +VK LV+ GAD+       G K      P+H AA +G  + +  LLE G S +E    G TPL
Sbjct:   58 DINT-------SNANGLNSLHLASKEGHSEVVRELIK----RQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGAN-----------------------QALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAA--KKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL--LTPLHCA----ARSG-----HDQ---------------------------------VVDLLVVQGAPISAKTKNG--LAPLHMAAQGDHVDAARTLLYHRAPVDDVTV-DYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNG----FTPLHIACKKNRIKVVELLLKYRAAIEAT----TESGLTPLHVAAFMGAINIVIYLL-QQGANPDVETVRGET---PLHLAARANQTDVVRVLIR----NGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT----RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEG----KNQVTPLHVAAHYNNDKVAMLLLENGASAKAA----AKNGYTPLHIAAKKNQMEIASTLLQFKADPN-AKSRAGFTPLHLSAQEGH-KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN----------SKTNAGYTPLHVACHFGQLNMVKFLVENGADV-------GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPL 792          

HSP 3 Score: 177.563 bits (449), Expect = 3.213e-44
Identity = 171/652 (26.23%), Postives = 296/652 (45.40%), Query Frame = 1
Query: 1378 DPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYL-IYALQYGNEIDVV-RVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYL 3324
            +P++      T L  +    H+ + +LL+  GAN+N               N + +HVA  +        L+ +GA       ++D R  +  +T LH A   +S     ++ L+  G  I +KT  G  P   A +   ++A   LL+     + V     + L ++A   +  + K LL    D N +   G T LH +  ++ RI +   +      + A I+      + +SG   ++   +   I++V  +L+Q A+PD+  +      TP+ LA   N    +  LIR+GA ++   +   +T LH+A R  N  I   L+ AG+N +  +R    +   P+H+A + G +E+  ILL      N+   L + +   PLHLA+       V+ L  ++   ++I      +    L + +  N   V  +L+     +G    + ++N  T LHIAA+    EI   LL++ ADP A+     R G  P+HL+ + GH EI  L  + G  V A  + GLT +H  A    V + +IL   GA++N++   G      P+H+A   G    VK L+E G+ +        R + T L+ A  +   N ++YL+++GA+P+ ++   G TPL I  + G+   +  L
Sbjct:  219 NPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA----------RHNISPLHVATKWGRTNMANLLLSRGA-------IIDSRTKDL-LTPLHCAA--RSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKN-RIKVVELLLK----YRAAIE-----ATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE---TPLHLAARANQTDVVRVLIRNGAKVD-AQARELQTPLHIASRLGNTDIVILLLQAGANSNATTR----DNYSPLHIAAKEGQEEVAGILL----DHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL-ERGTPVDIEGKNQVT---PLHVAAHYNNDKVAMLLLE----NGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAK----SRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAG----YTPLHVACHFGQLNMVKFLVENGADV----GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPN-EQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 131.724 bits (330), Expect = 2.642e-30
Identity = 120/468 (25.64%), Postives = 222/468 (47.44%), Query Frame = 1
Query: 2437 LDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            L++++E LL  G+ +N++    +   +N LHLA+    +  V+ L  +Q A ++  + + ++   + +L  +  ++ +  ++  GA+V+    V      T L++AAQ    E+V+ LL++GA+          DG  P+ +A + GH  +V +  +      +     L  LH AA         +LL+   + N + T  ++S   P+H+A+  GH+   +LLLE G+ +N       R N++ L++AT   R N+   L+  GA  D +  +L  TPLH   + G  + +  L+ +  + ++     G++ LH+ A+  H + +  LL  +   +    +T  +       ++PL+ A   GH+ V KLL+   AD           G  P+H A  + +  V+  LL+   +I+   E GLTPLH +   G  +   +L+   AN ++    G+ P   A  AN
Sbjct:   46 LEKVLE-LLRAGTDINTS----NANGLNSLHLASKEGHSEVVRELIKRQ-AQVDAATRKGNTALHIASLAGQSLIVTI--LVENGANVN----VQSVNGFTPLYMAAQENHEEVVKYLLKHGAN----QALSTEDGFTPLAVALQQGHDRVVAVLLE----NDSKGKVRLPALHIAAKKDDTTAATLLLQN--EHNPDVT--SKSGFTPLHIAAHYGHENVGQLLLEKGANVN----YQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL-LTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD---DVTVDY-------LTPLHVAAHCGHVRVAKLLLDRSAD----PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARAN 469          

HSP 5 Score: 129.028 bits (323), Expect = 1.916e-29
Identity = 102/356 (28.65%), Postives = 169/356 (47.47%), Query Frame = 1
Query: 2722 RSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVN 3789
            R+  +     AA+ G  E V  LL  G D    + T + +G+  +HLA++ GH E+V+        V AA   G T LH A+ AG   I+ IL++ GA+VN ++ +G      P++MA+++ H++ VK LL++G+  N   S    D  T L +A  +  + V+  L+++ +   ++        LHI  ++  T A   L+   ++  +V   +G + LH+ A  GH  +   LL    N N   +          +NISPL+ A  +G   +  LL+  GA I           + P+HCAA  G   V+  L+  G  I    ++GL PLH +      D  + L+  +A V+
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLRAGTD----INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNG----FTPLYMAAQENHEEVVKYLLKHGA--NQALS--TEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR-----LPALHIAAKKDDTTAATLLLQNEHNP-DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQAR----------HNISPLHVATKWGRTNMANLLLSRGAII----DSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD 353          

HSP 6 Score: 112.464 bits (280), Expect = 2.207e-24
Identity = 137/547 (25.05%), Postives = 221/547 (40.40%), Query Frame = 1
Query: 1261 LLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVET--NVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVK 2895
            LL HR  +++      + L +A     + +   LL R +DPN       T L  + +K   K+ ELL+ Y A I               +    +HVA          +L+ +GAN           +VET    T LHLA   ++N  + +  L+  G  ++++  +  TP   A R    +   LLL  G + NA    N S L ++A +   E+   LL +  D       G T LH                                          A +YGN ++VVR+L +   P  V I     +TP+ +A   N+      L+ +GA+    ++ N  T LH+A +   + IA  L+   ++ + +SR G      P+H++ Q G  EI  +L+  GS + +    K+   +  +HL A  D     + L +  +    INS  +  +  L        +  V+ ++  GADV  K   S     T LH AAQ G    V+ LLE GA P  +  TG      P+ +A   G++ +V+
Sbjct:  345 LLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT----------ESGLTPLHVAAFMGAINIVIYLLQQGAN----------PDVETVRGETPLHLAA--RANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLH-----------------------------------------LASKYGN-LEVVRLLLERGTP--VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAK-AAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAG----FTPLHLSAQEGHKEISGLLIENGSDVGA----KANNGLTAMHLCAQEDHVPVAQILYNNGA---EINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASY----TPLHQAAQQGHNNCVRYLLENGASPNEQTATGQT----PLSIAQRLGYVSVVE 805          

HSP 7 Score: 51.6026 bits (122), Expect = 2.689e-12
Identity = 48/205 (23.41%), Postives = 86/205 (41.95%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPV-------------ILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLI-QEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            K+G++ LH A    H ++ Q L+     N+N+         HN+ P+H+A ++GRT++  +LL R       ++    +L+ P+             +L     PI  +  N            PLH+    DH+D  + L+   A V       +   T L +A     +    +LL+  A+PN   ++  +PL  A K+   +
Sbjct:  225 KSGFTPLHIAAHYGHENVGQLLLEKG-ANVNYQAR------HNISPLHVATKWGRTNMANLLLSRGA----IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKN---------GLAPLHMAAQGDHVDAARTLLYHRAPV---DDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIK 406          

HSP 8 Score: 40.817 bits (94), Expect = 2.689e-12
Identity = 95/414 (22.95%), Postives = 167/414 (40.34%), Query Frame = 1
Query:  832 IVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLD----DVQFNCHIKK------INYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNI-GRNQPITSLMFSIQKRHKKMTELLINYGANI-----------------NENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +VE+LLKY A     T    +TPLH +     I+ +   +Q   + P+V   +    L +   + N T V   + V++++   +D    ++Q   HI        I  LL +   + N+        N + LHI     K+ Q    +E+  ILL H  +      K  + L LA +   L +V  LL RG+  +I G+NQ +T L  +    + K+  LL+  GA+                  N+      +L      N  S      +H++     +E    LI+ G+++          +    +T +HL    + + +     L   G  I SKT+ G TP   A  + ++     L+  G D       + + L  +A + +   +++LL+N    N++   G T L
Sbjct:  407 VVELLLKYRAAIE-ATTESGLTPLHVAAFMGAINIVIYLLQQ-GANPDVETVRGETPLHL-AARANQTDV---VRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTR----DNYSPLHI---AAKEGQ----EEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQ-VTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV--------GAKANNGLTAMHLCA--QEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPL 792          

HSP 9 Score: 63.929 bits (154), Expect = 9.613e-10
Identity = 52/184 (28.26%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  233 LHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            LH A    HV +A+ L++ S        +  S  L+   P+HIAC+  R  ++++LL+     E   E   + L     +   +  I+  +   +     +    PLHL    +  D +++LI+  AKV  ++R +   +T L +A  L   + V +LL++GAN N     N SPL  AAK G+
Sbjct:  363 LHVAAHCGHVRVAKLLLDRS-------ADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL---QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 191.815 bits (486), Expect = 1.200e-48
Identity = 190/775 (24.52%), Postives = 347/775 (44.77%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTS---------------TVKFLT---------HQQSASININSTRSDSFNAL-----LTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDG----------------------NRSKML-------PIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K      +  L++    +++ T KG+T    A    +     +L+  G + N  +    + L ++A + + E++K+LL++  +       G T L  +  Q          HD     +A + +NDS   ++   L  A +  +      +L+   +PD   + +    TP+ +A      +    L+  GAN+NY +  N  + LHVA +     +A  L+  G+ I  R++    + + P+H A ++G D+++++L++ G+ +++    K+   + PLH+AA  D                  TV +LT         H + A + ++ +   +  AL     L +  K+N I V  +L+           +     T LH+AA +G+  IV  LL+ GA+P    + G+     P+HLA  +   ++V++    G  V A      T LH A+  G+ DI+ +LL+AGA+ NA   D                       N  K L       P+H+AS+ G+ + V+LLLE G+P++       ++ +T L++A   N + V   L+++GA+      N G TPLHI  ++   +    L+    +  N     G + LHL+A++GH E+S  L+    N +  G        K +  ++ ++      H+ V ++L   GA+I+     + + G  P+H A   G+ +++  L+E G  + E      TPLH +  +G  +C ++L+   A+ N     G+ P
Sbjct:   70 LHLAS--KEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQG---------HDRV---VAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPD---VTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNI-SPLHVATKWGRTNMANLLLSRGAIIDSRTK----DLLTPLHCAARSGHDQVVDLLVVQGAPISA----KTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL---KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET----PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE----GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKN-GYTPLHIAAKKNQMEIASTLLQF-KADPNAKSRAGFTPLHLSAQEGHKEISGLLIE---NGSDVG-------AKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN----SKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTP 791          

HSP 2 Score: 188.348 bits (477), Expect = 1.465e-47
Identity = 218/865 (25.20%), Postives = 382/865 (44.16%), Query Frame = 1
Query: 1147 DINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQET-FQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQ--VDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHK---GIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            DIN+       SN NGL+ L +  K+    + +ELI      +  ++    K  + L +A       +V+ L+  G++ N+      T L  + Q+ H+++ + L+ +GAN                        AL   D  T     + +G +  + V L ++ + +  +  LH+A   K +       LL+   N +  +  G TP   A  Y       LLL +G + N     N S L ++       +   LL     +DS  KD   LT LH +     R G     HD                                  VV +L     P      N   + P+ +A + + +     L+ H A ++ ++  +  T LHVA    ++ +AK L+   ++ + R+  G      P+H+A +    +++E+LL + +++ +T    +   + PLH+AA     + V +L  QQ A+ ++ + R ++    L L ++ N   V  VL+     +G  + +++R   T LHIA+++G+ +IV LLL+ GA+  A      RD   P+H+A + G  E+  +  D     +     G T LH A+  G+++++ +LL+ G  V+ E     ++++ P+H+A+   + K   LLLE G+   A      ++  T L+IA  +N+  +   L++  A+P+  ++  G TPLH++ Q G  K I  L+    S +    N G++++HL A++ H  ++  L       N           KT+   +PL+ AC FG L +VK LV+ GAD+       G K      P+H AA +G  + +  LLE G S +E    G TPL
Sbjct:   58 DINT-------SNANGLNSLHLASKEGHSEVVRELIK----RQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGAN-----------------------QALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAA--KKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL--LTPLHCA----ARSG-----HDQ---------------------------------VVDLLVVQGAPISAKTKNG--LAPLHMAAQGDHVDAARTLLYHRAPVDDVTV-DYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNG----FTPLHIACKKNRIKVVELLLKYRAAIEAT----TESGLTPLHVAAFMGAINIVIYLL-QQGANPDVETVRGET---PLHLAARANQTDVVRVLIR----NGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT----RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEG----KNQVTPLHVAAHYNNDKVAMLLLENGASAKAA----AKNGYTPLHIAAKKNQMEIASTLLQFKADPN-AKSRAGFTPLHLSAQEGH-KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN----------SKTNAGYTPLHVACHFGQLNMVKFLVENGADV-------GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPL 792          

HSP 3 Score: 177.563 bits (449), Expect = 3.213e-44
Identity = 171/652 (26.23%), Postives = 296/652 (45.40%), Query Frame = 1
Query: 1378 DPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYL-IYALQYGNEIDVV-RVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYL 3324
            +P++      T L  +    H+ + +LL+  GAN+N               N + +HVA  +        L+ +GA       ++D R  +  +T LH A   +S     ++ L+  G  I +KT  G  P   A +   ++A   LL+     + V     + L ++A   +  + K LL    D N +   G T LH +  ++ RI +   +      + A I+      + +SG   ++   +   I++V  +L+Q A+PD+  +      TP+ LA   N    +  LIR+GA ++   +   +T LH+A R  N  I   L+ AG+N +  +R    +   P+H+A + G +E+  ILL      N+   L + +   PLHLA+       V+ L  ++   ++I      +    L + +  N   V  +L+     +G    + ++N  T LHIAA+    EI   LL++ ADP A+     R G  P+HL+ + GH EI  L  + G  V A  + GLT +H  A    V + +IL   GA++N++   G      P+H+A   G    VK L+E G+ +        R + T L+ A  +   N ++YL+++GA+P+ ++   G TPL I  + G+   +  L
Sbjct:  219 NPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA----------RHNISPLHVATKWGRTNMANLLLSRGA-------IIDSRTKDL-LTPLHCAA--RSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKN-RIKVVELLLK----YRAAIE-----ATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE---TPLHLAARANQTDVVRVLIRNGAKVD-AQARELQTPLHIASRLGNTDIVILLLQAGANSNATTR----DNYSPLHIAAKEGQEEVAGILL----DHNADKTLLTKKGFTPLHLASKYGNLEVVRLLL-ERGTPVDIEGKNQVT---PLHVAAHYNNDKVAMLLLE----NGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAK----SRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAG----YTPLHVACHFGQLNMVKFLVENGADV----GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPN-EQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 131.724 bits (330), Expect = 2.642e-30
Identity = 120/468 (25.64%), Postives = 222/468 (47.44%), Query Frame = 1
Query: 2437 LDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            L++++E LL  G+ +N++    +   +N LHLA+    +  V+ L  +Q A ++  + + ++   + +L  +  ++ +  ++  GA+V+    V      T L++AAQ    E+V+ LL++GA+          DG  P+ +A + GH  +V +  +      +     L  LH AA         +LL+   + N + T  ++S   P+H+A+  GH+   +LLLE G+ +N       R N++ L++AT   R N+   L+  GA  D +  +L  TPLH   + G  + +  L+ +  + ++     G++ LH+ A+  H + +  LL  +   +    +T  +       ++PL+ A   GH+ V KLL+   AD           G  P+H A  + +  V+  LL+   +I+   E GLTPLH +   G  +   +L+   AN ++    G+ P   A  AN
Sbjct:   46 LEKVLE-LLRAGTDINTS----NANGLNSLHLASKEGHSEVVRELIKRQ-AQVDAATRKGNTALHIASLAGQSLIVTI--LVENGANVN----VQSVNGFTPLYMAAQENHEEVVKYLLKHGAN----QALSTEDGFTPLAVALQQGHDRVVAVLLE----NDSKGKVRLPALHIAAKKDDTTAATLLLQN--EHNPDVT--SKSGFTPLHIAAHYGHENVGQLLLEKGANVN----YQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL-LTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD---DVTVDY-------LTPLHVAAHCGHVRVAKLLLDRSAD----PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARAN 469          

HSP 5 Score: 129.028 bits (323), Expect = 1.916e-29
Identity = 102/356 (28.65%), Postives = 169/356 (47.47%), Query Frame = 1
Query: 2722 RSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVN 3789
            R+  +     AA+ G  E V  LL  G D    + T + +G+  +HLA++ GH E+V+        V AA   G T LH A+ AG   I+ IL++ GA+VN ++ +G      P++MA+++ H++ VK LL++G+  N   S    D  T L +A  +  + V+  L+++ +   ++        LHI  ++  T A   L+   ++  +V   +G + LH+ A  GH  +   LL    N N   +          +NISPL+ A  +G   +  LL+  GA I           + P+HCAA  G   V+  L+  G  I    ++GL PLH +      D  + L+  +A V+
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLRAGTD----INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNG----FTPLYMAAQENHEEVVKYLLKHGA--NQALS--TEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR-----LPALHIAAKKDDTTAATLLLQNEHNP-DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQAR----------HNISPLHVATKWGRTNMANLLLSRGAII----DSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD 353          

HSP 6 Score: 112.464 bits (280), Expect = 2.207e-24
Identity = 137/547 (25.05%), Postives = 221/547 (40.40%), Query Frame = 1
Query: 1261 LLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVET--NVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVK 2895
            LL HR  +++      + L +A     + +   LL R +DPN       T L  + +K   K+ ELL+ Y A I               +    +HVA          +L+ +GAN           +VET    T LHLA   ++N  + +  L+  G  ++++  +  TP   A R    +   LLL  G + NA    N S L ++A +   E+   LL +  D       G T LH                                          A +YGN ++VVR+L +   P  V I     +TP+ +A   N+      L+ +GA+    ++ N  T LH+A +   + IA  L+   ++ + +SR G      P+H++ Q G  EI  +L+  GS + +    K+   +  +HL A  D     + L +  +    INS  +  +  L        +  V+ ++  GADV  K   S     T LH AAQ G    V+ LLE GA P  +  TG      P+ +A   G++ +V+
Sbjct:  345 LLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT----------ESGLTPLHVAAFMGAINIVIYLLQQGAN----------PDVETVRGETPLHLAA--RANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLH-----------------------------------------LASKYGN-LEVVRLLLERGTP--VDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAK-AAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAG----FTPLHLSAQEGHKEISGLLIENGSDVGA----KANNGLTAMHLCAQEDHVPVAQILYNNGA---EINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASY----TPLHQAAQQGHNNCVRYLLENGASPNEQTATGQT----PLSIAQRLGYVSVVE 805          

HSP 7 Score: 51.6026 bits (122), Expect = 2.689e-12
Identity = 48/205 (23.41%), Postives = 86/205 (41.95%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPV-------------ILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLI-QEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            K+G++ LH A    H ++ Q L+     N+N+         HN+ P+H+A ++GRT++  +LL R       ++    +L+ P+             +L     PI  +  N            PLH+    DH+D  + L+   A V       +   T L +A     +    +LL+  A+PN   ++  +PL  A K+   +
Sbjct:  225 KSGFTPLHIAAHYGHENVGQLLLEKG-ANVNYQAR------HNISPLHVATKWGRTNMANLLLSRGA----IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKN---------GLAPLHMAAQGDHVDAARTLLYHRAPV---DDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIK 406          

HSP 8 Score: 40.817 bits (94), Expect = 2.689e-12
Identity = 95/414 (22.95%), Postives = 167/414 (40.34%), Query Frame = 1
Query:  832 IVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLD----DVQFNCHIKK------INYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNI-GRNQPITSLMFSIQKRHKKMTELLINYGANI-----------------NENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +VE+LLKY A     T    +TPLH +     I+ +   +Q   + P+V   +    L +   + N T V   + V++++   +D    ++Q   HI        I  LL +   + N+        N + LHI     K+ Q    +E+  ILL H  +      K  + L LA +   L +V  LL RG+  +I G+NQ +T L  +    + K+  LL+  GA+                  N+      +L      N  S      +H++     +E    LI+ G+++          +    +T +HL    + + +     L   G  I SKT+ G TP   A  + ++     L+  G D       + + L  +A + +   +++LL+N    N++   G T L
Sbjct:  407 VVELLLKYRAAIE-ATTESGLTPLHVAAFMGAINIVIYLLQQ-GANPDVETVRGETPLHL-AARANQTDV---VRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTR----DNYSPLHI---AAKEGQ----EEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQ-VTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDV--------GAKANNGLTAMHLCA--QEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPL 792          

HSP 9 Score: 63.929 bits (154), Expect = 9.613e-10
Identity = 52/184 (28.26%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  233 LHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            LH A    HV +A+ L++ S        +  S  L+   P+HIAC+  R  ++++LL+     E   E   + L     +   +  I+  +   +     +    PLHL    +  D +++LI+  AKV  ++R +   +T L +A  L   + V +LL++GAN N     N SPL  AAK G+
Sbjct:  363 LHVAAHCGHVRVAKLLLDRS-------ADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL---QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 178.718 bits (452), Expect = 7.182e-45
Identity = 188/775 (24.26%), Postives = 345/775 (44.52%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTS---------------TVKFLT---------HQQSASININSTRSDSFNAL-----LTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDG----------------------NRSKML-------PIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K      +  L++    +++ T KG+T    A    +     +L+  G + N  +    + L ++A + + E++K+LL++  +       G T L  +  Q          HD     +A + +NDS   ++   L  A +  +      +L+   +PD+    +    TP+ +A      +    L+  GAN+NY +  N  + LHVA +     +A  L+  G+ I  R++    + + P+H A ++G D+++++L++ G+ +++    K+   + PLH+AA  D                  TV +LT         H + A + ++ +   +  AL     L +  K+N I V  +L+           +     T LH+AA +G+  IV  LL+ GA+P    + G+     P+HLA  +   ++V++    G  V A      T LH A+  G+ DI+ +LL+AGA+ NA   D                       N  K L       P+H+AS+ G+ + V+LLLE G+P++       ++ +T L++A   N + V   L+++GA+      N G TPLHI  ++   +    L+    +  N     G + LHL+A++GH E+S  L+    +             K +  ++ ++      H+ V ++L   GA+I+     + + G  P+H A   G+ +++  L+E G  + E      TPLH +  +G  +C ++L+   A+ N     G+ P
Sbjct:   70 LHLAS--KEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQG---------HDR---VVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVT---SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNI-SPLHVATKWGRTNMANLLLSRGAIIDSRTK----DLLTPLHCAARSGHDQVVDLLVVQGAPISA----KTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL---KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE----TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE----GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKN-GYTPLHIAAKKNQMEIASTLLQF-KADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD----------VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN----SKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTP 791          

HSP 2 Score: 175.252 bits (443), Expect = 8.990e-44
Identity = 212/870 (24.37%), Postives = 381/870 (43.79%), Query Frame = 1
Query: 1177 VSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQET-FQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQ--VDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHK---GIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFL 3765
             SN NGL+ L +  K+       E++  L+  +  ++    K  + L +A       +V+ L+  G++ N+      T L  + Q+ H+++ + L+ +GAN                        AL   D  T     + +G +  + V L ++ + +  +  LH+A   K +       LL+   N +  +  G TP   A  Y       LLL +G + N     N S L ++       +   LL     +DS  KD   LT LH +        +D  +     I          S   K+G                                  + P+ +A + + +     L+ H A ++ ++  +  T LHVA    ++ +AK L+   ++ + R+  G      P+H+A +    +++E+LL + +++ +T    +   + PLH+AA     + V +L  QQ A+ ++ + R ++    L L ++ N   V  VL+     +G  + +++R   T LHIA+++G+ +IV LLL+ GA+  A      RD   P+H+A + G  E+  +  D     +     G T LH A+  G+++++ +LL+ G  V+ E     ++++ P+H+A+   + K   LLLE G+   A      ++  T L+IA  +N+  +   L++  A+P+ + +  G TPLH++ Q G  K I  L+    S +    N G++++HL A++ H  ++  L       N           KT+   +PL+ AC FG L +VK LV+ GAD+       G K      P+H AA +G  + +  LLE G S +E    G TPL  +   G+    + L
Sbjct:   61 TSNANGLNSLHLASKEGH----SEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGAN-----------------------QALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAA--KKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL--LTPLHCAARSGHDQVVDLLVVQGAPI----------SAKTKNG----------------------------------LAPLHMAAQGDHVDAARTLLYHRAPVDDVTV-DYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNG----FTPLHIACKKNRIKVVELLLKYRAAIEAT----TESGLTPLHVAAFMGAINIVIYLL-QQGANPDVETVRGET---PLHLAARANQTDVVRVLIR----NGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT----RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEG----KNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA----KNGYTPLHIAAKKNQMEIASTLLQFKADPNAK-SRAGFTPLHLSAQEGH-KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN----------SKTNAGYTPLHVACHFGQLNMVKFLVENGADV-------GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 3 Score: 125.176 bits (313), Expect = 1.893e-28
Identity = 104/358 (29.05%), Postives = 172/358 (48.04%), Query Frame = 1
Query: 2722 RSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNII 3795
            R+  +     AA+ G  E V  LL  G D    + T + +G+  +HLA++ GH E+V+        V AA   G T LH A+ AG   I+ IL++ GA+VN ++ +G      P++MA+++ H++ VK LL++G+  N   S    D  T L +A  +  + V+  L+++ +   ++   L A  LHI  ++  T A   L+   ++  +V   +G + LH+ A  GH  +   LL    N N           +  +NISPL+ A  +G   +  LL+  GA I           + P+HCAA  G   V+  L+  G  I    ++GL PLH +      D  + L+  +A V+ +
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLRAGTD----INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNG----FTPLYMAAQENHEEVVKYLLKHGA--NQALS--TEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR---LPA--LHIAAKKDDTTAATLLLQNEHNP-DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNY----------QARHNISPLHVATKWGRTNMANLLLSRGAII----DSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDV 355          

HSP 4 Score: 122.479 bits (306), Expect = 1.178e-27
Identity = 120/476 (25.21%), Postives = 222/476 (46.64%), Query Frame = 1
Query: 2413 IHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            +  A    L++++E LL  G+ +N++    +   +N LHLA+    +  V+ L  +Q A ++  + + ++   + +L  +  ++ +  ++  GA+V+ + +       T L++AAQ    E+V+ LL++GA+          DG  P+ +A + GH  +V +  +      +     L  LH AA         +LL+   + N + T  ++S   P+H+A+  GH+   +LLLE G+ +N       R N++ L++AT   R N+   L+  GA  D +  +L  TPLH   + G  + +  L+ +  + ++     G++ LH+ A+  H + +  LL  +                T   ++PL+ A   GH+ V KLL+   AD           G  P+H A  + +  V+  LL+   +I+   E GLTPLH +   G  +   +L+   AN ++    G+ P   A  AN
Sbjct:   38 LRAARAGDLEKVLE-LLRAGTDINTS----NANGLNSLHLASKEGHSEVVRELIKRQ-AQVDAATRKGNTALHIASLAGQSLIVTI--LVENGANVNVQSV----NGFTPLYMAAQENHEEVVKYLLKHGAN----QALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQN--EHNPDVT--SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA----RHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL-LTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA----------PVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSAD----PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARAN 469          

HSP 5 Score: 52.7582 bits (125), Expect = 3.357e-12
Identity = 48/205 (23.41%), Postives = 86/205 (41.95%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPV-------------ILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLI-QEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            K+G++ LH A    H ++ Q L+     N+N+         HN+ P+H+A ++GRT++  +LL R       ++    +L+ P+             +L     PI  +  N            PLH+    DH+D  + L+   A V       +   T L +A     +    +LL+  A+PN   ++  +PL  A K+   +
Sbjct:  225 KSGFTPLHIAAHYGHENVGQLLLEKG-ANVNYQAR------HNISPLHVATKWGRTNMANLLLSRGA----IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKN---------GLAPLHMAAQGDHVDAARTLLYHRAPV---DDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIK 406          

HSP 6 Score: 39.2762 bits (90), Expect = 3.357e-12
Identity = 95/414 (22.95%), Postives = 166/414 (40.10%), Query Frame = 1
Query:  832 IVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLD----DVQFNCHIKK------INYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNI-GRNQPITSLMFSIQKRHKKMTELLINYGANI-----------------NENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +VE+LLKY A     T    +TPLH +     I N+   +    + P+V   +    L +   + N T V   + V++++   +D    ++Q   HI        I  LL +   + N+        N + LHI     K+ Q    +E+  ILL H  +      K  + L LA +   L +V  LL RG+  +I G+NQ +T L  +    + K+  LL+  GA+                  N+      +L      N  S      +H++     +E    LI+ G+++    +          +T +HL    + + +     L   G  I SKT+ G TP   A  + ++     L+  G D       + + L  +A + +   +++LL+N    N++   G T L
Sbjct:  407 VVELLLKYRAAIE-ATTESGLTPLHVAAFMGAI-NIVIYLLQQGANPDVETVRGETPLHLA-ARANQTDV---VRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTR----DNYSPLHI---AAKEGQ----EEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQ-VTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN--------NGLTAMHLCA--QEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPL 792          

HSP 7 Score: 65.0846 bits (157), Expect = 4.464e-10
Identity = 52/184 (28.26%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  233 LHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            LH A    HV +A+ L++ S        +  S  L+   P+HIAC+  R  ++++LL+     E   E   + L     +   +  I+  +   +     +    PLHL    +  D +++LI+  AKV  ++R +   +T L +A  L   + V +LL++GAN N     N SPL  AAK G+
Sbjct:  363 LHVAAHCGHVRVAKLLLDRS-------ADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL---QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 178.718 bits (452), Expect = 7.182e-45
Identity = 188/775 (24.26%), Postives = 345/775 (44.52%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTS---------------TVKFLT---------HQQSASININSTRSDSFNAL-----LTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDG----------------------NRSKML-------PIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K      +  L++    +++ T KG+T    A    +     +L+  G + N  +    + L ++A + + E++K+LL++  +       G T L  +  Q          HD     +A + +NDS   ++   L  A +  +      +L+   +PD+    +    TP+ +A      +    L+  GAN+NY +  N  + LHVA +     +A  L+  G+ I  R++    + + P+H A ++G D+++++L++ G+ +++    K+   + PLH+AA  D                  TV +LT         H + A + ++ +   +  AL     L +  K+N I V  +L+           +     T LH+AA +G+  IV  LL+ GA+P    + G+     P+HLA  +   ++V++    G  V A      T LH A+  G+ DI+ +LL+AGA+ NA   D                       N  K L       P+H+AS+ G+ + V+LLLE G+P++       ++ +T L++A   N + V   L+++GA+      N G TPLHI  ++   +    L+    +  N     G + LHL+A++GH E+S  L+    +             K +  ++ ++      H+ V ++L   GA+I+     + + G  P+H A   G+ +++  L+E G  + E      TPLH +  +G  +C ++L+   A+ N     G+ P
Sbjct:   70 LHLAS--KEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQG---------HDR---VVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVT---SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNI-SPLHVATKWGRTNMANLLLSRGAIIDSRTK----DLLTPLHCAARSGHDQVVDLLVVQGAPISA----KTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL---KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE----TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE----GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKN-GYTPLHIAAKKNQMEIASTLLQF-KADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD----------VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN----SKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTP 791          

HSP 2 Score: 175.252 bits (443), Expect = 8.990e-44
Identity = 212/870 (24.37%), Postives = 381/870 (43.79%), Query Frame = 1
Query: 1177 VSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQET-FQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQ--VDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHK---GIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFL 3765
             SN NGL+ L +  K+       E++  L+  +  ++    K  + L +A       +V+ L+  G++ N+      T L  + Q+ H+++ + L+ +GAN                        AL   D  T     + +G +  + V L ++ + +  +  LH+A   K +       LL+   N +  +  G TP   A  Y       LLL +G + N     N S L ++       +   LL     +DS  KD   LT LH +        +D  +     I          S   K+G                                  + P+ +A + + +     L+ H A ++ ++  +  T LHVA    ++ +AK L+   ++ + R+  G      P+H+A +    +++E+LL + +++ +T    +   + PLH+AA     + V +L  QQ A+ ++ + R ++    L L ++ N   V  VL+     +G  + +++R   T LHIA+++G+ +IV LLL+ GA+  A      RD   P+H+A + G  E+  +  D     +     G T LH A+  G+++++ +LL+ G  V+ E     ++++ P+H+A+   + K   LLLE G+   A      ++  T L+IA  +N+  +   L++  A+P+ + +  G TPLH++ Q G  K I  L+    S +    N G++++HL A++ H  ++  L       N           KT+   +PL+ AC FG L +VK LV+ GAD+       G K      P+H AA +G  + +  LLE G S +E    G TPL  +   G+    + L
Sbjct:   61 TSNANGLNSLHLASKEGH----SEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGAN-----------------------QALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAA--KKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL--LTPLHCAARSGHDQVVDLLVVQGAPI----------SAKTKNG----------------------------------LAPLHMAAQGDHVDAARTLLYHRAPVDDVTV-DYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNG----FTPLHIACKKNRIKVVELLLKYRAAIEAT----TESGLTPLHVAAFMGAINIVIYLL-QQGANPDVETVRGET---PLHLAARANQTDVVRVLIR----NGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT----RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEG----KNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA----KNGYTPLHIAAKKNQMEIASTLLQFKADPNAK-SRAGFTPLHLSAQEGH-KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN----------SKTNAGYTPLHVACHFGQLNMVKFLVENGADV-------GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 3 Score: 125.176 bits (313), Expect = 1.893e-28
Identity = 104/358 (29.05%), Postives = 172/358 (48.04%), Query Frame = 1
Query: 2722 RSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNII 3795
            R+  +     AA+ G  E V  LL  G D    + T + +G+  +HLA++ GH E+V+        V AA   G T LH A+ AG   I+ IL++ GA+VN ++ +G      P++MA+++ H++ VK LL++G+  N   S    D  T L +A  +  + V+  L+++ +   ++   L A  LHI  ++  T A   L+   ++  +V   +G + LH+ A  GH  +   LL    N N           +  +NISPL+ A  +G   +  LL+  GA I           + P+HCAA  G   V+  L+  G  I    ++GL PLH +      D  + L+  +A V+ +
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLRAGTD----INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNG----FTPLYMAAQENHEEVVKYLLKHGA--NQALS--TEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR---LPA--LHIAAKKDDTTAATLLLQNEHNP-DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNY----------QARHNISPLHVATKWGRTNMANLLLSRGAII----DSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDV 355          

HSP 4 Score: 122.479 bits (306), Expect = 1.178e-27
Identity = 120/476 (25.21%), Postives = 222/476 (46.64%), Query Frame = 1
Query: 2413 IHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            +  A    L++++E LL  G+ +N++    +   +N LHLA+    +  V+ L  +Q A ++  + + ++   + +L  +  ++ +  ++  GA+V+ + +       T L++AAQ    E+V+ LL++GA+          DG  P+ +A + GH  +V +  +      +     L  LH AA         +LL+   + N + T  ++S   P+H+A+  GH+   +LLLE G+ +N       R N++ L++AT   R N+   L+  GA  D +  +L  TPLH   + G  + +  L+ +  + ++     G++ LH+ A+  H + +  LL  +                T   ++PL+ A   GH+ V KLL+   AD           G  P+H A  + +  V+  LL+   +I+   E GLTPLH +   G  +   +L+   AN ++    G+ P   A  AN
Sbjct:   38 LRAARAGDLEKVLE-LLRAGTDINTS----NANGLNSLHLASKEGHSEVVRELIKRQ-AQVDAATRKGNTALHIASLAGQSLIVTI--LVENGANVNVQSV----NGFTPLYMAAQENHEEVVKYLLKHGAN----QALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQN--EHNPDVT--SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA----RHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL-LTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA----------PVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSAD----PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARAN 469          

HSP 5 Score: 52.7582 bits (125), Expect = 3.357e-12
Identity = 48/205 (23.41%), Postives = 86/205 (41.95%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPV-------------ILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLI-QEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            K+G++ LH A    H ++ Q L+     N+N+         HN+ P+H+A ++GRT++  +LL R       ++    +L+ P+             +L     PI  +  N            PLH+    DH+D  + L+   A V       +   T L +A     +    +LL+  A+PN   ++  +PL  A K+   +
Sbjct:  225 KSGFTPLHIAAHYGHENVGQLLLEKG-ANVNYQAR------HNISPLHVATKWGRTNMANLLLSRGA----IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKN---------GLAPLHMAAQGDHVDAARTLLYHRAPV---DDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIK 406          

HSP 6 Score: 39.2762 bits (90), Expect = 3.357e-12
Identity = 95/414 (22.95%), Postives = 166/414 (40.10%), Query Frame = 1
Query:  832 IVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLD----DVQFNCHIKK------INYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNI-GRNQPITSLMFSIQKRHKKMTELLINYGANI-----------------NENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +VE+LLKY A     T    +TPLH +     I N+   +    + P+V   +    L +   + N T V   + V++++   +D    ++Q   HI        I  LL +   + N+        N + LHI     K+ Q    +E+  ILL H  +      K  + L LA +   L +V  LL RG+  +I G+NQ +T L  +    + K+  LL+  GA+                  N+      +L      N  S      +H++     +E    LI+ G+++    +          +T +HL    + + +     L   G  I SKT+ G TP   A  + ++     L+  G D       + + L  +A + +   +++LL+N    N++   G T L
Sbjct:  407 VVELLLKYRAAIE-ATTESGLTPLHVAAFMGAI-NIVIYLLQQGANPDVETVRGETPLHLA-ARANQTDV---VRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTR----DNYSPLHI---AAKEGQ----EEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQ-VTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN--------NGLTAMHLCA--QEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPL 792          

HSP 7 Score: 65.0846 bits (157), Expect = 4.464e-10
Identity = 52/184 (28.26%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  233 LHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            LH A    HV +A+ L++ S        +  S  L+   P+HIAC+  R  ++++LL+     E   E   + L     +   +  I+  +   +     +    PLHL    +  D +++LI+  AKV  ++R +   +T L +A  L   + V +LL++GAN N     N SPL  AAK G+
Sbjct:  363 LHVAAHCGHVRVAKLLLDRS-------ADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL---QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 178.333 bits (451), Expect = 9.884e-45
Identity = 188/775 (24.26%), Postives = 345/775 (44.52%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTS---------------TVKFLT---------HQQSASININSTRSDSFNAL-----LTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDG----------------------NRSKML-------PIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K      +  L++    +++ T KG+T    A    +     +L+  G + N  +    + L ++A + + E++K+LL++  +       G T L  +  Q          HD     +A + +NDS   ++   L  A +  +      +L+   +PD+    +    TP+ +A      +    L+  GAN+NY +  N  + LHVA +     +A  L+  G+ I  R++    + + P+H A ++G D+++++L++ G+ +++    K+   + PLH+AA  D                  TV +LT         H + A + ++ +   +  AL     L +  K+N I V  +L+           +     T LH+AA +G+  IV  LL+ GA+P    + G+     P+HLA  +   ++V++    G  V A      T LH A+  G+ DI+ +LL+AGA+ NA   D                       N  K L       P+H+AS+ G+ + V+LLLE G+P++       ++ +T L++A   N + V   L+++GA+      N G TPLHI  ++   +    L+    +  N     G + LHL+A++GH E+S  L+    +             K +  ++ ++      H+ V ++L   GA+I+     + + G  P+H A   G+ +++  L+E G  + E      TPLH +  +G  +C ++L+   A+ N     G+ P
Sbjct:   70 LHLAS--KEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQG---------HDR---VVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVT---SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNI-SPLHVATKWGRTNMANLLLSRGAIIDSRTK----DLLTPLHCAARSGHDQVVDLLVVQGAPISA----KTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLL---KYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE----TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE----GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKN-GYTPLHIAAKKNQMEIASTLLQF-KADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSD----------VGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN----SKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTP 791          

HSP 2 Score: 174.866 bits (442), Expect = 1.107e-43
Identity = 212/870 (24.37%), Postives = 381/870 (43.79%), Query Frame = 1
Query: 1177 VSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQET-FQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQ--VDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHK---GIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFL 3765
             SN NGL+ L +  K+       E++  L+  +  ++    K  + L +A       +V+ L+  G++ N+      T L  + Q+ H+++ + L+ +GAN                        AL   D  T     + +G +  + V L ++ + +  +  LH+A   K +       LL+   N +  +  G TP   A  Y       LLL +G + N     N S L ++       +   LL     +DS  KD   LT LH +        +D  +     I          S   K+G                                  + P+ +A + + +     L+ H A ++ ++  +  T LHVA    ++ +AK L+   ++ + R+  G      P+H+A +    +++E+LL + +++ +T    +   + PLH+AA     + V +L  QQ A+ ++ + R ++    L L ++ N   V  VL+     +G  + +++R   T LHIA+++G+ +IV LLL+ GA+  A      RD   P+H+A + G  E+  +  D     +     G T LH A+  G+++++ +LL+ G  V+ E     ++++ P+H+A+   + K   LLLE G+   A      ++  T L+IA  +N+  +   L++  A+P+ + +  G TPLH++ Q G  K I  L+    S +    N G++++HL A++ H  ++  L       N           KT+   +PL+ AC FG L +VK LV+ GAD+       G K      P+H AA +G  + +  LLE G S +E    G TPL  +   G+    + L
Sbjct:   61 TSNANGLNSLHLASKEGH----SEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGAN-----------------------QALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAA--KKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL--LTPLHCAARSGHDQVVDLLVVQGAPI----------SAKTKNG----------------------------------LAPLHMAAQGDHVDAARTLLYHRAPVDDVTV-DYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNG----FTPLHIACKKNRIKVVELLLKYRAAIEAT----TESGLTPLHVAAFMGAINIVIYLL-QQGANPDVETVRGET---PLHLAARANQTDVVRVLIR----NGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT----RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEG----KNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA----KNGYTPLHIAAKKNQMEIASTLLQFKADPNAK-SRAGFTPLHLSAQEGH-KEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN----------SKTNAGYTPLHVACHFGQLNMVKFLVENGADV-------GEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 3 Score: 124.79 bits (312), Expect = 2.534e-28
Identity = 104/358 (29.05%), Postives = 172/358 (48.04%), Query Frame = 1
Query: 2722 RSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNII 3795
            R+  +     AA+ G  E V  LL  G D    + T + +G+  +HLA++ GH E+V+        V AA   G T LH A+ AG   I+ IL++ GA+VN ++ +G      P++MA+++ H++ VK LL++G+  N   S    D  T L +A  +  + V+  L+++ +   ++   L A  LHI  ++  T A   L+   ++  +V   +G + LH+ A  GH  +   LL    N N           +  +NISPL+ A  +G   +  LL+  GA I           + P+HCAA  G   V+  L+  G  I    ++GL PLH +      D  + L+  +A V+ +
Sbjct:   30 RAEGSASFLRAARAGDLEKVLELLRAGTD----INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNG----FTPLYMAAQENHEEVVKYLLKHGA--NQALS--TEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR---LPA--LHIAAKKDDTTAATLLLQNEHNP-DVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNY----------QARHNISPLHVATKWGRTNMANLLLSRGAII----DSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDV 355          

HSP 4 Score: 122.479 bits (306), Expect = 1.498e-27
Identity = 120/476 (25.21%), Postives = 222/476 (46.64%), Query Frame = 1
Query: 2413 IHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            +  A    L++++E LL  G+ +N++    +   +N LHLA+    +  V+ L  +Q A ++  + + ++   + +L  +  ++ +  ++  GA+V+ + +       T L++AAQ    E+V+ LL++GA+          DG  P+ +A + GH  +V +  +      +     L  LH AA         +LL+   + N + T  ++S   P+H+A+  GH+   +LLLE G+ +N       R N++ L++AT   R N+   L+  GA  D +  +L  TPLH   + G  + +  L+ +  + ++     G++ LH+ A+  H + +  LL  +                T   ++PL+ A   GH+ V KLL+   AD           G  P+H A  + +  V+  LL+   +I+   E GLTPLH +   G  +   +L+   AN ++    G+ P   A  AN
Sbjct:   38 LRAARAGDLEKVLE-LLRAGTDINTS----NANGLNSLHLASKEGHSEVVRELIKRQ-AQVDAATRKGNTALHIASLAGQSLIVTI--LVENGANVNVQSV----NGFTPLYMAAQENHEEVVKYLLKHGAN----QALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQN--EHNPDVT--SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQA----RHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL-LTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA----------PVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSAD----PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARAN 469          

HSP 5 Score: 52.7582 bits (125), Expect = 2.827e-12
Identity = 48/205 (23.41%), Postives = 86/205 (41.95%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPV-------------ILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLI-QEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            K+G++ LH A    H ++ Q L+     N+N+         HN+ P+H+A ++GRT++  +LL R       ++    +L+ P+             +L     PI  +  N            PLH+    DH+D  + L+   A V       +   T L +A     +    +LL+  A+PN   ++  +PL  A K+   +
Sbjct:  225 KSGFTPLHIAAHYGHENVGQLLLEKG-ANVNYQAR------HNISPLHVATKWGRTNMANLLLSRGA----IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKN---------GLAPLHMAAQGDHVDAARTLLYHRAPV---DDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIK 406          

HSP 6 Score: 39.6614 bits (91), Expect = 2.827e-12
Identity = 95/414 (22.95%), Postives = 166/414 (40.10%), Query Frame = 1
Query:  832 IVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLD----DVQFNCHIKK------INYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNI-GRNQPITSLMFSIQKRHKKMTELLINYGANI-----------------NENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +VE+LLKY A     T    +TPLH +     I N+   +    + P+V   +    L +   + N T V   + V++++   +D    ++Q   HI        I  LL +   + N+        N + LHI     K+ Q    +E+  ILL H  +      K  + L LA +   L +V  LL RG+  +I G+NQ +T L  +    + K+  LL+  GA+                  N+      +L      N  S      +H++     +E    LI+ G+++    +          +T +HL    + + +     L   G  I SKT+ G TP   A  + ++     L+  G D       + + L  +A + +   +++LL+N    N++   G T L
Sbjct:  407 VVELLLKYRAAIE-ATTESGLTPLHVAAFMGAI-NIVIYLLQQGANPDVETVRGETPLHLA-ARANQTDV---VRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTR----DNYSPLHI---AAKEGQ----EEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQ-VTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKAN--------NGLTAMHLCA--QEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPL 792          

HSP 7 Score: 65.0846 bits (157), Expect = 4.486e-10
Identity = 52/184 (28.26%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  233 LHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            LH A    HV +A+ L++ S        +  S  L+   P+HIAC+  R  ++++LL+     E   E   + L     +   +  I+  +   +     +    PLHL    +  D +++LI+  AKV  ++R +   +T L +A  L   + V +LL++GAN N     N SPL  AAK G+
Sbjct:  363 LHVAAHCGHVRVAKLLLDRS-------ADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL---QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQ 536          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344224)

HSP 1 Score: 199.519 bits (506), Expect = 6.686e-51
Identity = 192/719 (26.70%), Postives = 325/719 (45.20%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEM--NSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   ++ ++ LL  G  ++S T KG+T    A    + E   LLL      N  +    + L ++A + +  +++ LL N  + +     G T L  +  Q          HD     +A + ++D+   ++   L  A +  +      +L    +PD   + +    TP+ +A      +I+N+  LI+ GA++NY S+ +  + LHVA +     +   L+  G NI  ++R G    + P+H A ++G ++++++LL  G+ +++    K+   + PLH+AA  +     + L + ++    ++    D   AL       +V   + +L   AD + + +       T LHIA +    ++V+LLL +GA   A        G+ P+H+A   G + IV        S       G T LH AA A   DI+ ILL+ GA V+A A    R +  P+H+AS  G+   V LLL++G+ ++A      +D  TAL+IA  E ++ V   LI++GA                                   +L+     G + LHLTA+ GH +++  LL+ + + +  G+            ++PL+ AC + +  V  LL++ GA  H A    GH    P+H AA + +  +  TLLE G   +   + G TPLH S  EG  + +  LI  KA VN   K G  P
Sbjct:   48 LHLAS--KDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQG---------HDKV---VAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPD---VTSKSGFTPLHIASHYGNQNIANL--LIQKGADVNY-SAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDG----LTPLHCAARSGHEQVVDMLLERGAPISA----KTKNGLAPLHMAAQGEHVDAARILLYHRAP---VDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARAL----NGFTPLHIACKKNRLKVVELLLRHGASISATT----ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARA----REQQTPLHIASRLGNVDIVMLLLQHGAQVDAT----TKDMYTALHIAAKEGQDEVAAVLIENGA-----------------------------------ALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGK----------NGVTPLHVACHYNNQQVALLLLEKGASPH-ATAKNGHT---PLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTP 670          

HSP 2 Score: 194.512 bits (493), Expect = 2.304e-49
Identity = 210/840 (25.00%), Postives = 381/840 (45.36%), Query Frame = 1
Query: 1264 LAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLT-------------------VDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSR-NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLH 3723
            L + I+IN +N+   + L LA +   + +VS LL RG+  +    +  T+L  +     +++ +LL+ + A++N       V S    T    +++A   +     + L+  GAN  L                    V +L E +    V L  L I  K + +     LL+   N +  +  G TP   A  Y      NLL+ +G D N     N S L ++A      ++  LL+   +   K   GLT LH                                          A + G+E  VV +L +   P      N   + P+ +A +   +     L+ H A ++ ++  +  T LHVA    ++ +AK L+   ++ + R+  G      P+H+A +    +++E+LL  G+S+++T    +   + PLH+AA     + V +L  Q  AS ++ + R ++   L    ++ ++I +  +L  GA V      +R+R   T LHIA+++G+ +IV LLL++GA   A      +D    +H+A + G  E+  +  + G ++ AA   G T LH  A  G + + ++LL+  ADV+A+  +G    + P+H+A    +++   LLLE G+  +A      ++  T L+IA  +N+ ++   L++ GA  +  E+  G TPLH++ Q G  +    LI    +++N P   G++ +HL A++ +  ++  L +   N ++        + K  Y  +PL+ A  FG   +V+ L++ GA++  A +     G  P+H  A +G  H++  LLE   + +    +G TPLH
Sbjct:   31 LKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVN-------VQSQNGFT---PLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH-----------------------------------------CAARSGHE-QVVDMLLERGAPISAKTKNG--LAPLHMAAQGEHVDAARILLYHRAPVDEVTV-DYLTALHVAAHCGHVRVAKLLLDRNADANARALNG----FTPLHIACKKNRLKVVELLLRHGASISAT----TESGLTPLHVAAFMGCMNIVIYLL-QHDASPDVPTVRGETPLHLAARANQTDIIRI--LLRNGAQVD-----ARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATT----KDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNG----VTPLHVACHYNNQQVALLLLEKGASPHAT----AKNGHTPLHIAARKNQMDIATTLLEYGALAN-AESKAGFTPLHLSSQEGHAEISNLLIE-HKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDM--------ATKAGY--TPLHVASHFGQANMVRFLLQNGANVDAATSI----GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLH 771          

HSP 3 Score: 179.104 bits (453), Expect = 1.235e-44
Identity = 157/532 (29.51%), Postives = 249/532 (46.80%), Query Frame = 1
Query: 2245 LIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            L+ H A++N + S N  T L++A +  + A+ + L+  G+N  L +  G      P+ VA+Q G D+++ +LL   +        +   R+  LH+AA  D       L        N + T    F  L       N      ++  GADV+     S   N + LH+AA+ G   +V LLLE G +  A+     RDG+ P+H A  SGH ++V +  + G  +SA    GL  LH AA    VD   ILL   A V+    D     +  +H+A+  GH +  KLLL+  +  NA    LN    T L+IA  +NR  V++ L++ GA+      + G TPLH+    G    ++YL+   ++S +VP   G + LHL A     ++   LLR        G   D+ +++     +PL+ A   G++ +V LL++ GA +  A T + +     +H AA  G+  V   L+E G ++D   + G TPLH +   G     + L+  +A+V+   K G  P   A   N
Sbjct:   96 LLEHNASVN-VQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDG----FTPLAVAMQQGHDKVVAVLLESDT--------RGKVRLPALHIAAKKDDVKAATLLLDNDH---NPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVN----YSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT----RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVD----YLTALHVAAHCGHVRVAKLLLDRNADANA--RALN--GFTPLHIACKKNRLKVVELLLRHGASISATTES-GLTPLHVAAFMGCMNIVIYLLQ-HDASPDVPTVRGETPLHLAARANQTDIIRILLR-------NGAQVDARAREQQ---TPLHIASRLGNVDIVMLLLQHGAQVD-ATTKDMYTA---LHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYN 579          

HSP 4 Score: 171.014 bits (432), Expect = 4.128e-42
Identity = 183/746 (24.53%), Postives = 325/746 (43.57%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNA-----------------VNA----------INE------SGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            ++E++ +LL H  ++N  +    + L++A Q N   +V  LL  G++ ++      T L  ++Q+ H K+  +L+             +  A  ++     L+L N    +  S      +H+A  Y +Q     LI KGA++            + N++ LH+A   K    N ++ LLE G NIE+KT  G TP   A R    +  ++LL RG   +A                 V+A          ++E      + L ++A   +  + K LL    D+N +   G T LH +  ++    ++  +    +I          S + +SG   L  A   G    V+ +L+  A PD+  +      TP+ LA   N    +  L+R+GA ++   +  Q+T LH+A R  N+ I   L+  G+ +   ++    +    +H+A + G DE+  +L+  G++L++     + +   PLHL A        + L  +++   ++++   +    L       N    Q V +   +       +     T LHIAA+    +I   LLEYGA   A      + G  P+HL+++ GH EI  L  +   +V+     GLT +H  A   +V++ EIL K GA+++     G      P+H+AS  G    V+ LL+ G+ ++A  S       T L+    +   +++  L++  AN + Q  N G TPLHI  + G+   +
Sbjct:   89 QEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADV--------NYSAKHNISPLHVAA--KWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASI----------SATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE---TPLHLAARANQTDIIRILLRNGAQVD-ARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK----DMYTALHIAAKEGQDEVAAVLIENGAALDAA----TKKGFTPLHLTAKYGHIKVAQLLLQKEA---DVDAQGKNGVTPLHVACHYNN----QQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAE----SKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAG----YTPLHVASHFGQANMVRFLLQNGANVDAATSI----GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVN-GQTPLHIARKLGYISVL 782          

HSP 5 Score: 129.028 bits (323), Expect = 2.091e-29
Identity = 98/346 (28.32%), Postives = 171/346 (49.42%), Query Frame = 1
Query: 2752 AAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVN 3789
            AA+ G+ E V   L+   D    + T + +G+  +HLA++ GH+ +V      G  V +A   G T LH A+ AG  +++++LL+  A VN ++ +G      P++MA+++ H   V+LLL  G    A  S    D  T L +A  +  + V+  L++S     ++        LHI  ++   KA   L+   + + +V   +G + LH+ +  G+  ++  L++   + N + +          +NISPL+ A  +G   +V LL++ G +I  A+T     G+ P+HCAA  G   V+  LLE G  I    ++GL PLH +      D  + L+  +A V+
Sbjct:   18 AARAGNLERVLEHLKNNID----INTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNG----FTPLYMAAQENHDAVVRLLLSNG----ANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR-----LPALHIAAKKDDVKAATLLLD-NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAK----------HNISPLHVAAKWGKTNMVSLLLEKGGNIE-AKT---RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVD 331          

HSP 6 Score: 99.3673 bits (246), Expect = 2.432e-20
Identity = 123/538 (22.86%), Postives = 226/538 (42.01%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQN--QVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSS--HSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            +T+L  +    H ++ +LL++  A+ N             L     +H+A   +  +  + L+  GA++  T         E+ +T LH+A  +    +N + +LL+   + +  T +G+TP   A R ++ +   +LL  G   +A     ++ L +++   N +I+  LLQ+  QVD+  KD Y  TALH +              +  +   A + +N ++   + K G+  L    +YG+      +L++ AD D         +TP+ +A   N+      L+  GA+  + ++ N  T LH+A R   + IA  L+  G+  +  S+ G      P+H++ Q G  EI  +L+   +++N      +   + P+HL A  D                N+N             + ++N   +     AG               T LH+A+  G   +V+ LL+ GA+  A        G  P+H   + GH  IV L  +   + +A    G T LH A   G + +++ L
Sbjct:  338 LTALHVAAHCGHVRVAKLLLDRNADANARA----------LNGFTPLHIACKKNRLKVVELLLRHGASISATT--------ESGLTPLHVAAFM--GCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMY--TALHIA------------AKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVD---AQGKNGVTPLHVACHYNNQQVALLLLEKGAS-PHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAG----FTPLHLSSQEGHAEISNLLIEHKAAVNH----PAKNGLTPMHLCAQED----------------NVNVAE----------ILEKNGANIDMATKAGY--------------TPLHVASHFGQANMVRFLLQNGANVDA----ATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 785          

HSP 7 Score: 47.7506 bits (112), Expect = 1.072e-6
Identity = 43/186 (23.12%), Postives = 86/186 (46.24%), Query Frame = 2
Query:  227 SILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            + LH A    HV +A+ L++ +        ++ +  L+   P+HIAC+  R  ++++LL+   +     E   + L     +   +  I+  + + S     +    PLHL    +  D +++L++  A+V   +R    ++T L +A  L  ++ V +LL+ GA  +       + L  AAK G+
Sbjct:  339 TALHVAAHCGHVRVAKLLLDRN-------ADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAR---EQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQ 514          

HSP 8 Score: 25.7942 bits (55), Expect = 1.072e-6
Identity = 12/36 (33.33%), Postives = 21/36 (58.33%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNN 927
            GH  + ++LL+  A+      ++ +TPLH +C  NN
Sbjct:  546 GHIKVAQLLLQKEADVD-AQGKNGVTPLHVACHYNN 580          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303125)

HSP 1 Score: 199.519 bits (506), Expect = 6.764e-51
Identity = 192/719 (26.70%), Postives = 325/719 (45.20%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEM--NSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   ++ ++ LL  G  ++S T KG+T    A    + E   LLL      N  +    + L ++A + +  +++ LL N  + +     G T L  +  Q          HD     +A + ++D+   ++   L  A +  +      +L    +PD   + +    TP+ +A      +I+N+  LI+ GA++NY S+ +  + LHVA +     +   L+  G NI  ++R G    + P+H A ++G ++++++LL  G+ +++    K+   + PLH+AA  +     + L + ++    ++    D   AL       +V   + +L   AD + + +       T LHIA +    ++V+LLL +GA   A        G+ P+H+A   G + IV        S       G T LH AA A   DI+ ILL+ GA V+A A    R +  P+H+AS  G+   V LLL++G+ ++A      +D  TAL+IA  E ++ V   LI++GA                                   +L+     G + LHLTA+ GH +++  LL+ + + +  G+            ++PL+ AC + +  V  LL++ GA  H A    GH    P+H AA + +  +  TLLE G   +   + G TPLH S  EG  + +  LI  KA VN   K G  P
Sbjct:   48 LHLAS--KDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQG---------HDKV---VAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPD---VTSKSGFTPLHIASHYGNQNIANL--LIQKGADVNY-SAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDG----LTPLHCAARSGHEQVVDMLLERGAPISA----KTKNGLAPLHMAAQGEHVDAARILLYHRAP---VDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARAL----NGFTPLHIACKKNRLKVVELLLRHGASISATT----ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARA----REQQTPLHIASRLGNVDIVMLLLQHGAQVDAT----TKDMYTALHIAAKEGQDEVAAVLIENGA-----------------------------------ALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGK----------NGVTPLHVACHYNNQQVALLLLEKGASPH-ATAKNGHT---PLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTP 670          

HSP 2 Score: 194.512 bits (493), Expect = 2.330e-49
Identity = 210/840 (25.00%), Postives = 381/840 (45.36%), Query Frame = 1
Query: 1264 LAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLT-------------------VDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSR-NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLH 3723
            L + I+IN +N+   + L LA +   + +VS LL RG+  +    +  T+L  +     +++ +LL+ + A++N       V S    T    +++A   +     + L+  GAN  L                    V +L E +    V L  L I  K + +     LL+   N +  +  G TP   A  Y      NLL+ +G D N     N S L ++A      ++  LL+   +   K   GLT LH                                          A + G+E  VV +L +   P      N   + P+ +A +   +     L+ H A ++ ++  +  T LHVA    ++ +AK L+   ++ + R+  G      P+H+A +    +++E+LL  G+S+++T    +   + PLH+AA     + V +L  Q  AS ++ + R ++   L    ++ ++I +  +L  GA V      +R+R   T LHIA+++G+ +IV LLL++GA   A      +D    +H+A + G  E+  +  + G ++ AA   G T LH  A  G + + ++LL+  ADV+A+  +G    + P+H+A    +++   LLLE G+  +A      ++  T L+IA  +N+ ++   L++ GA  +  E+  G TPLH++ Q G  +    LI    +++N P   G++ +HL A++ +  ++  L +   N ++        + K  Y  +PL+ A  FG   +V+ L++ GA++  A +     G  P+H  A +G  H++  LLE   + +    +G TPLH
Sbjct:   31 LKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVN-------VQSQNGFT---PLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH-----------------------------------------CAARSGHE-QVVDMLLERGAPISAKTKNG--LAPLHMAAQGEHVDAARILLYHRAPVDEVTV-DYLTALHVAAHCGHVRVAKLLLDRNADANARALNG----FTPLHIACKKNRLKVVELLLRHGASISAT----TESGLTPLHVAAFMGCMNIVIYLL-QHDASPDVPTVRGETPLHLAARANQTDIIRI--LLRNGAQVD-----ARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATT----KDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNG----VTPLHVACHYNNQQVALLLLEKGASPHAT----AKNGHTPLHIAARKNQMDIATTLLEYGALAN-AESKAGFTPLHLSSQEGHAEISNLLIE-HKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDM--------ATKAGY--TPLHVASHFGQANMVRFLLQNGANVDAATSI----GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLH 771          

HSP 3 Score: 179.104 bits (453), Expect = 1.248e-44
Identity = 157/532 (29.51%), Postives = 249/532 (46.80%), Query Frame = 1
Query: 2245 LIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            L+ H A++N + S N  T L++A +  + A+ + L+  G+N  L +  G      P+ VA+Q G D+++ +LL   +        +   R+  LH+AA  D       L        N + T    F  L       N      ++  GADV+     S   N + LH+AA+ G   +V LLLE G +  A+     RDG+ P+H A  SGH ++V +  + G  +SA    GL  LH AA    VD   ILL   A V+    D     +  +H+A+  GH +  KLLL+  +  NA    LN    T L+IA  +NR  V++ L++ GA+      + G TPLH+    G    ++YL+   ++S +VP   G + LHL A     ++   LLR        G   D+ +++     +PL+ A   G++ +V LL++ GA +  A T + +     +H AA  G+  V   L+E G ++D   + G TPLH +   G     + L+  +A+V+   K G  P   A   N
Sbjct:   96 LLEHNASVN-VQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDG----FTPLAVAMQQGHDKVVAVLLESDT--------RGKVRLPALHIAAKKDDVKAATLLLDNDH---NPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVN----YSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT----RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVD----YLTALHVAAHCGHVRVAKLLLDRNADANA--RALN--GFTPLHIACKKNRLKVVELLLRHGASISATTES-GLTPLHVAAFMGCMNIVIYLLQ-HDASPDVPTVRGETPLHLAARANQTDIIRILLR-------NGAQVDARAREQQ---TPLHIASRLGNVDIVMLLLQHGAQVD-ATTKDMYTA---LHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYN 579          

HSP 4 Score: 171.014 bits (432), Expect = 4.169e-42
Identity = 183/746 (24.53%), Postives = 325/746 (43.57%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNA-----------------VNA----------INE------SGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            ++E++ +LL H  ++N  +    + L++A Q N   +V  LL  G++ ++      T L  ++Q+ H K+  +L+             +  A  ++     L+L N    +  S      +H+A  Y +Q     LI KGA++            + N++ LH+A   K    N ++ LLE G NIE+KT  G TP   A R    +  ++LL RG   +A                 V+A          ++E      + L ++A   +  + K LL    D+N +   G T LH +  ++    ++  +    +I          S + +SG   L  A   G    V+ +L+  A PD+  +      TP+ LA   N    +  L+R+GA ++   +  Q+T LH+A R  N+ I   L+  G+ +   ++    +    +H+A + G DE+  +L+  G++L++     + +   PLHL A        + L  +++   ++++   +    L       N    Q V +   +       +     T LHIAA+    +I   LLEYGA   A      + G  P+HL+++ GH EI  L  +   +V+     GLT +H  A   +V++ EIL K GA+++     G      P+H+AS  G    V+ LL+ G+ ++A  S       T L+    +   +++  L++  AN + Q  N G TPLHI  + G+   +
Sbjct:   89 QEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADV--------NYSAKHNISPLHVAA--KWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASI----------SATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE---TPLHLAARANQTDIIRILLRNGAQVD-ARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK----DMYTALHIAAKEGQDEVAAVLIENGAALDAA----TKKGFTPLHLTAKYGHIKVAQLLLQKEA---DVDAQGKNGVTPLHVACHYNN----QQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAE----SKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAG----YTPLHVASHFGQANMVRFLLQNGANVDAATSI----GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVN-GQTPLHIARKLGYISVL 782          

HSP 5 Score: 129.028 bits (323), Expect = 2.107e-29
Identity = 98/346 (28.32%), Postives = 171/346 (49.42%), Query Frame = 1
Query: 2752 AAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVN 3789
            AA+ G+ E V   L+   D    + T + +G+  +HLA++ GH+ +V      G  V +A   G T LH A+ AG  +++++LL+  A VN ++ +G      P++MA+++ H   V+LLL  G    A  S    D  T L +A  +  + V+  L++S     ++        LHI  ++   KA   L+   + + +V   +G + LH+ +  G+  ++  L++   + N + +          +NISPL+ A  +G   +V LL++ G +I  A+T     G+ P+HCAA  G   V+  LLE G  I    ++GL PLH +      D  + L+  +A V+
Sbjct:   18 AARAGNLERVLEHLKNNID----INTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNG----FTPLYMAAQENHDAVVRLLLSNG----ANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR-----LPALHIAAKKDDVKAATLLLD-NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAK----------HNISPLHVAAKWGKTNMVSLLLEKGGNIE-AKT---RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVD 331          

HSP 6 Score: 99.3673 bits (246), Expect = 2.445e-20
Identity = 123/538 (22.86%), Postives = 226/538 (42.01%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQN--QVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSS--HSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            +T+L  +    H ++ +LL++  A+ N             L     +H+A   +  +  + L+  GA++  T         E+ +T LH+A  +    +N + +LL+   + +  T +G+TP   A R ++ +   +LL  G   +A     ++ L +++   N +I+  LLQ+  QVD+  KD Y  TALH +              +  +   A + +N ++   + K G+  L    +YG+      +L++ AD D         +TP+ +A   N+      L+  GA+  + ++ N  T LH+A R   + IA  L+  G+  +  S+ G      P+H++ Q G  EI  +L+   +++N      +   + P+HL A  D                N+N             + ++N   +     AG               T LH+A+  G   +V+ LL+ GA+  A        G  P+H   + GH  IV L  +   + +A    G T LH A   G + +++ L
Sbjct:  338 LTALHVAAHCGHVRVAKLLLDRNADANARA----------LNGFTPLHIACKKNRLKVVELLLRHGASISATT--------ESGLTPLHVAAFM--GCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMY--TALHIA------------AKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVD---AQGKNGVTPLHVACHYNNQQVALLLLEKGAS-PHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAG----FTPLHLSSQEGHAEISNLLIEHKAAVNH----PAKNGLTPMHLCAQED----------------NVNVAE----------ILEKNGANIDMATKAGY--------------TPLHVASHFGQANMVRFLLQNGANVDA----ATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 785          

HSP 7 Score: 48.1358 bits (113), Expect = 9.598e-7
Identity = 43/186 (23.12%), Postives = 86/186 (46.24%), Query Frame = 2
Query:  227 SILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            + LH A    HV +A+ L++ +        ++ +  L+   P+HIAC+  R  ++++LL+   +     E   + L     +   +  I+  + + S     +    PLHL    +  D +++L++  A+V   +R    ++T L +A  L  ++ V +LL+ GA  +       + L  AAK G+
Sbjct:  339 TALHVAAHCGHVRVAKLLLDRN-------ADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAR---EQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQ 514          

HSP 8 Score: 25.7942 bits (55), Expect = 9.598e-7
Identity = 12/36 (33.33%), Postives = 21/36 (58.33%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNN 927
            GH  + ++LL+  A+      ++ +TPLH +C  NN
Sbjct:  546 GHIKVAQLLLQKEADVD-AQGKNGVTPLHVACHYNN 580          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303121)

HSP 1 Score: 197.978 bits (502), Expect = 1.900e-50
Identity = 192/719 (26.70%), Postives = 325/719 (45.20%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEM--NSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   ++ ++ LL  G  ++S T KG+T    A    + E   LLL      N  +    + L ++A + +  +++ LL N  + +     G T L  +  Q          HD     +A + ++D+   ++   L  A +  +      +L    +PD   + +    TP+ +A      +I+N+  LI+ GA++NY S+ +  + LHVA +     +   L+  G NI  ++R G    + P+H A ++G ++++++LL  G+ +++    K+   + PLH+AA  +     + L + ++    ++    D   AL       +V   + +L   AD + + +       T LHIA +    ++V+LLL +GA   A        G+ P+H+A   G + IV        S       G T LH AA A   DI+ ILL+ GA V+A A    R +  P+H+AS  G+   V LLL++G+ ++A      +D  TAL+IA  E ++ V   LI++GA                                   +L+     G + LHLTA+ GH +++  LL+ + + +  G+            ++PL+ AC + +  V  LL++ GA  H A    GH    P+H AA + +  +  TLLE G   +   + G TPLH S  EG  + +  LI  KA VN   K G  P
Sbjct:   48 LHLAS--KDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQG---------HDKV---VAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPD---VTSKSGFTPLHIASHYGNQNIANL--LIQKGADVNY-SAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDG----LTPLHCAARSGHEQVVDMLLERGAPISA----KTKNGLAPLHMAAQGEHVDAARILLYHRAP---VDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARAL----NGFTPLHIACKKNRLKVVELLLRHGASISATT----ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARA----REQQTPLHIASRLGNVDIVMLLLQHGAQVDAT----TKDMYTALHIAAKEGQDEVAAVLIENGA-----------------------------------ALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGK----------NGVTPLHVACHYNNQQVALLLLEKGASPH-ATAKNGHT---PLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTP 670          

HSP 2 Score: 193.356 bits (490), Expect = 5.589e-49
Identity = 210/840 (25.00%), Postives = 382/840 (45.48%), Query Frame = 1
Query: 1264 LAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLT-------------------VDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSR-NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLH 3723
            L + I+IN +N+   + L LA +   + +VS LL RG+  +    +  T+L  +     +++ +LL+ + A++N       V S    T    +++A   +     + L+  GAN  L                    V +L E +    V L  L I  K + +     LL+   N +  +  G TP   A  Y      NLL+ +G D N     N S L ++A      ++  LL+   +   K   GLT LH                                          A + G+E  VV +L +   P      N   + P+ +A +   +     L+ H A ++ ++  +  T LHVA    ++ +AK L+   ++ + R+  G      P+H+A +    +++E+LL  G+S+++T    +   + PLH+AA     + V +L  Q  AS ++ + R ++   L    ++ ++I +  +L  GA V      +R+R   T LHIA+++G+ +IV LLL++GA   A      +D    +H+A + G  E+  +  + G ++ AA   G T LH  A  G + + ++LL+  ADV+A+  +G    + P+H+A    +++   LLLE G+  +A      ++  T L+IA  +N+ ++   L++ GA  +  E+  G TPLH++ Q G  + I  L+    +++N P   G++ +HL A++ +  ++  L +   N ++        + K  Y  +PL+ A  FG   +V+ L++ GA++  A +     G  P+H  A +G  H++  LLE   + +    +G TPLH
Sbjct:   31 LKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVN-------VQSQNGFT---PLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH-----------------------------------------CAARSGHE-QVVDMLLERGAPISAKTKNG--LAPLHMAAQGEHVDAARILLYHRAPVDEVTV-DYLTALHVAAHCGHVRVAKLLLDRNADANARALNG----FTPLHIACKKNRLKVVELLLRHGASISAT----TESGLTPLHVAAFMGCMNIVIYLL-QHDASPDVPTVRGETPLHLAARANQTDIIRI--LLRNGAQVD-----ARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATT----KDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNG----VTPLHVACHYNNQQVALLLLEKGASPHAT----AKNGHTPLHIAARKNQMDIATTLLEYGALAN-AESKAGFTPLHLSSQEGHAE-ISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDM--------ATKAGY--TPLHVASHFGQANMVRFLLQNGANVDAATSI----GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLH 771          

HSP 3 Score: 177.948 bits (450), Expect = 2.646e-44
Identity = 157/532 (29.51%), Postives = 249/532 (46.80%), Query Frame = 1
Query: 2245 LIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            L+ H A++N + S N  T L++A +  + A+ + L+  G+N  L +  G      P+ VA+Q G D+++ +LL   +        +   R+  LH+AA  D       L        N + T    F  L       N      ++  GADV+     S   N + LH+AA+ G   +V LLLE G +  A+     RDG+ P+H A  SGH ++V +  + G  +SA    GL  LH AA    VD   ILL   A V+    D     +  +H+A+  GH +  KLLL+  +  NA    LN    T L+IA  +NR  V++ L++ GA+      + G TPLH+    G    ++YL+   ++S +VP   G + LHL A     ++   LLR        G   D+ +++     +PL+ A   G++ +V LL++ GA +  A T + +     +H AA  G+  V   L+E G ++D   + G TPLH +   G     + L+  +A+V+   K G  P   A   N
Sbjct:   96 LLEHNASVN-VQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDG----FTPLAVAMQQGHDKVVAVLLESDT--------RGKVRLPALHIAAKKDDVKAATLLLDNDH---NPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVN----YSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT----RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVD----YLTALHVAAHCGHVRVAKLLLDRNADANA--RALN--GFTPLHIACKKNRLKVVELLLRHGASISATTES-GLTPLHVAAFMGCMNIVIYLLQ-HDASPDVPTVRGETPLHLAARANQTDIIRILLR-------NGAQVDARAREQQ---TPLHIASRLGNVDIVMLLLQHGAQVD-ATTKDMYTA---LHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYN 579          

HSP 4 Score: 169.474 bits (428), Expect = 1.037e-41
Identity = 183/746 (24.53%), Postives = 325/746 (43.57%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNA-----------------VNA----------INE------SGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            ++E++ +LL H  ++N  +    + L++A Q N   +V  LL  G++ ++      T L  ++Q+ H K+  +L+             +  A  ++     L+L N    +  S      +H+A  Y +Q     LI KGA++            + N++ LH+A   K    N ++ LLE G NIE+KT  G TP   A R    +  ++LL RG   +A                 V+A          ++E      + L ++A   +  + K LL    D+N +   G T LH +  ++    ++  +    +I          S + +SG   L  A   G    V+ +L+  A PD+  +      TP+ LA   N    +  L+R+GA ++   +  Q+T LH+A R  N+ I   L+  G+ +   ++    +    +H+A + G DE+  +L+  G++L++     + +   PLHL A        + L  +++   ++++   +    L       N    Q V +   +       +     T LHIAA+    +I   LLEYGA   A      + G  P+HL+++ GH EI  L  +   +V+     GLT +H  A   +V++ EIL K GA+++     G      P+H+AS  G    V+ LL+ G+ ++A  S       T L+    +   +++  L++  AN + Q  N G TPLHI  + G+   +
Sbjct:   89 QEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADV--------NYSAKHNISPLHVAA--KWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASI----------SATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE---TPLHLAARANQTDIIRILLRNGAQVD-ARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK----DMYTALHIAAKEGQDEVAAVLIENGAALDAA----TKKGFTPLHLTAKYGHIKVAQLLLQKEA---DVDAQGKNGVTPLHVACHYNN----QQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAE----SKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAG----YTPLHVASHFGQANMVRFLLQNGANVDAATSI----GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVN-GQTPLHIARKLGYISVL 782          

HSP 5 Score: 128.642 bits (322), Expect = 3.090e-29
Identity = 98/346 (28.32%), Postives = 171/346 (49.42%), Query Frame = 1
Query: 2752 AAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVN 3789
            AA+ G+ E V   L+   D    + T + +G+  +HLA++ GH+ +V      G  V +A   G T LH A+ AG  +++++LL+  A VN ++ +G      P++MA+++ H   V+LLL  G    A  S    D  T L +A  +  + V+  L++S     ++        LHI  ++   KA   L+   + + +V   +G + LH+ +  G+  ++  L++   + N + +          +NISPL+ A  +G   +V LL++ G +I  A+T     G+ P+HCAA  G   V+  LLE G  I    ++GL PLH +      D  + L+  +A V+
Sbjct:   18 AARAGNLERVLEHLKNNID----INTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNG----FTPLYMAAQENHDAVVRLLLSNG----ANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR-----LPALHIAAKKDDVKAATLLLD-NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAK----------HNISPLHVAAKWGKTNMVSLLLEKGGNIE-AKT---RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVD 331          

HSP 6 Score: 48.9062 bits (115), Expect = 5.957e-7
Identity = 43/186 (23.12%), Postives = 86/186 (46.24%), Query Frame = 2
Query:  227 SILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            + LH A    HV +A+ L++ +        ++ +  L+   P+HIAC+  R  ++++LL+   +     E   + L     +   +  I+  + + S     +    PLHL    +  D +++L++  A+V   +R    ++T L +A  L  ++ V +LL+ GA  +       + L  AAK G+
Sbjct:  339 TALHVAAHCGHVRVAKLLLDRN-------ADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAR---EQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQ 514          

HSP 7 Score: 25.409 bits (54), Expect = 5.957e-7
Identity = 12/36 (33.33%), Postives = 21/36 (58.33%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNN 927
            GH  + ++LL+  A+      ++ +TPLH +C  NN
Sbjct:  546 GHIKVAQLLLQKEADVD-AQGKNGVTPLHVACHYNN 580          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303117)

HSP 1 Score: 197.593 bits (501), Expect = 2.154e-50
Identity = 192/719 (26.70%), Postives = 325/719 (45.20%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEM--NSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   ++ ++ LL  G  ++S T KG+T    A    + E   LLL      N  +    + L ++A + +  +++ LL N  + +     G T L  +  Q          HD     +A + ++D+   ++   L  A +  +      +L    +PD   + +    TP+ +A      +I+N+  LI+ GA++NY S+ +  + LHVA +     +   L+  G NI  ++R G    + P+H A ++G ++++++LL  G+ +++    K+   + PLH+AA  +     + L + ++    ++    D   AL       +V   + +L   AD + + +       T LHIA +    ++V+LLL +GA   A        G+ P+H+A   G + IV        S       G T LH AA A   DI+ ILL+ GA V+A A    R +  P+H+AS  G+   V LLL++G+ ++A      +D  TAL+IA  E ++ V   LI++GA                                   +L+     G + LHLTA+ GH +++  LL+ + + +  G+            ++PL+ AC + +  V  LL++ GA  H A    GH    P+H AA + +  +  TLLE G   +   + G TPLH S  EG  + +  LI  KA VN   K G  P
Sbjct:   48 LHLAS--KDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQG---------HDKV---VAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPD---VTSKSGFTPLHIASHYGNQNIANL--LIQKGADVNY-SAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDG----LTPLHCAARSGHEQVVDMLLERGAPISA----KTKNGLAPLHMAAQGEHVDAARILLYHRAP---VDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARAL----NGFTPLHIACKKNRLKVVELLLRHGASISATT----ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARA----REQQTPLHIASRLGNVDIVMLLLQHGAQVDAT----TKDMYTALHIAAKEGQDEVAAVLIENGA-----------------------------------ALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGK----------NGVTPLHVACHYNNQQVALLLLEKGASPH-ATAKNGHT---PLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTP 670          

HSP 2 Score: 192.971 bits (489), Expect = 6.444e-49
Identity = 210/840 (25.00%), Postives = 382/840 (45.48%), Query Frame = 1
Query: 1264 LAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLT-------------------VDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSR-NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLH 3723
            L + I+IN +N+   + L LA +   + +VS LL RG+  +    +  T+L  +     +++ +LL+ + A++N       V S    T    +++A   +     + L+  GAN  L                    V +L E +    V L  L I  K + +     LL+   N +  +  G TP   A  Y      NLL+ +G D N     N S L ++A      ++  LL+   +   K   GLT LH                                          A + G+E  VV +L +   P      N   + P+ +A +   +     L+ H A ++ ++  +  T LHVA    ++ +AK L+   ++ + R+  G      P+H+A +    +++E+LL  G+S+++T    +   + PLH+AA     + V +L  Q  AS ++ + R ++   L    ++ ++I +  +L  GA V      +R+R   T LHIA+++G+ +IV LLL++GA   A      +D    +H+A + G  E+  +  + G ++ AA   G T LH  A  G + + ++LL+  ADV+A+  +G    + P+H+A    +++   LLLE G+  +A      ++  T L+IA  +N+ ++   L++ GA  +  E+  G TPLH++ Q G  + I  L+    +++N P   G++ +HL A++ +  ++  L +   N ++        + K  Y  +PL+ A  FG   +V+ L++ GA++  A +     G  P+H  A +G  H++  LLE   + +    +G TPLH
Sbjct:   31 LKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVN-------VQSQNGFT---PLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH-----------------------------------------CAARSGHE-QVVDMLLERGAPISAKTKNG--LAPLHMAAQGEHVDAARILLYHRAPVDEVTV-DYLTALHVAAHCGHVRVAKLLLDRNADANARALNG----FTPLHIACKKNRLKVVELLLRHGASISAT----TESGLTPLHVAAFMGCMNIVIYLL-QHDASPDVPTVRGETPLHLAARANQTDIIRI--LLRNGAQVD-----ARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATT----KDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNG----VTPLHVACHYNNQQVALLLLEKGASPHAT----AKNGHTPLHIAARKNQMDIATTLLEYGALAN-AESKAGFTPLHLSSQEGHAE-ISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDM--------ATKAGY--TPLHVASHFGQANMVRFLLQNGANVDAATSI----GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLH 771          

HSP 3 Score: 177.563 bits (449), Expect = 2.949e-44
Identity = 157/532 (29.51%), Postives = 249/532 (46.80%), Query Frame = 1
Query: 2245 LIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            L+ H A++N + S N  T L++A +  + A+ + L+  G+N  L +  G      P+ VA+Q G D+++ +LL   +        +   R+  LH+AA  D       L        N + T    F  L       N      ++  GADV+     S   N + LH+AA+ G   +V LLLE G +  A+     RDG+ P+H A  SGH ++V +  + G  +SA    GL  LH AA    VD   ILL   A V+    D     +  +H+A+  GH +  KLLL+  +  NA    LN    T L+IA  +NR  V++ L++ GA+      + G TPLH+    G    ++YL+   ++S +VP   G + LHL A     ++   LLR        G   D+ +++     +PL+ A   G++ +V LL++ GA +  A T + +     +H AA  G+  V   L+E G ++D   + G TPLH +   G     + L+  +A+V+   K G  P   A   N
Sbjct:   96 LLEHNASVN-VQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDG----FTPLAVAMQQGHDKVVAVLLESDT--------RGKVRLPALHIAAKKDDVKAATLLLDNDH---NPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVN----YSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT----RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVD----YLTALHVAAHCGHVRVAKLLLDRNADANA--RALN--GFTPLHIACKKNRLKVVELLLRHGASISATTES-GLTPLHVAAFMGCMNIVIYLLQ-HDASPDVPTVRGETPLHLAARANQTDIIRILLR-------NGAQVDARAREQQ---TPLHIASRLGNVDIVMLLLQHGAQVD-ATTKDMYTA---LHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYN 579          

HSP 4 Score: 169.474 bits (428), Expect = 1.127e-41
Identity = 183/746 (24.53%), Postives = 325/746 (43.57%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNA-----------------VNA----------INE------SGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            ++E++ +LL H  ++N  +    + L++A Q N   +V  LL  G++ ++      T L  ++Q+ H K+  +L+             +  A  ++     L+L N    +  S      +H+A  Y +Q     LI KGA++            + N++ LH+A   K    N ++ LLE G NIE+KT  G TP   A R    +  ++LL RG   +A                 V+A          ++E      + L ++A   +  + K LL    D+N +   G T LH +  ++    ++  +    +I          S + +SG   L  A   G    V+ +L+  A PD+  +      TP+ LA   N    +  L+R+GA ++   +  Q+T LH+A R  N+ I   L+  G+ +   ++    +    +H+A + G DE+  +L+  G++L++     + +   PLHL A        + L  +++   ++++   +    L       N    Q V +   +       +     T LHIAA+    +I   LLEYGA   A      + G  P+HL+++ GH EI  L  +   +V+     GLT +H  A   +V++ EIL K GA+++     G      P+H+AS  G    V+ LL+ G+ ++A  S       T L+    +   +++  L++  AN + Q  N G TPLHI  + G+   +
Sbjct:   89 QEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADV--------NYSAKHNISPLHVAA--KWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASI----------SATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE---TPLHLAARANQTDIIRILLRNGAQVD-ARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK----DMYTALHIAAKEGQDEVAAVLIENGAALDAA----TKKGFTPLHLTAKYGHIKVAQLLLQKEA---DVDAQGKNGVTPLHVACHYNN----QQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAE----SKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAG----YTPLHVASHFGQANMVRFLLQNGANVDAATSI----GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVN-GQTPLHIARKLGYISVL 782          

HSP 5 Score: 128.257 bits (321), Expect = 3.386e-29
Identity = 98/346 (28.32%), Postives = 171/346 (49.42%), Query Frame = 1
Query: 2752 AAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVN 3789
            AA+ G+ E V   L+   D    + T + +G+  +HLA++ GH+ +V      G  V +A   G T LH A+ AG  +++++LL+  A VN ++ +G      P++MA+++ H   V+LLL  G    A  S    D  T L +A  +  + V+  L++S     ++        LHI  ++   KA   L+   + + +V   +G + LH+ +  G+  ++  L++   + N + +          +NISPL+ A  +G   +V LL++ G +I  A+T     G+ P+HCAA  G   V+  LLE G  I    ++GL PLH +      D  + L+  +A V+
Sbjct:   18 AARAGNLERVLEHLKNNID----INTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNG----FTPLYMAAQENHDAVVRLLLSNG----ANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR-----LPALHIAAKKDDVKAATLLLD-NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAK----------HNISPLHVAAKWGKTNMVSLLLEKGGNIE-AKT---RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVD 331          

HSP 6 Score: 98.2117 bits (243), Expect = 5.203e-20
Identity = 123/538 (22.86%), Postives = 226/538 (42.01%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQN--QVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSS--HSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            +T+L  +    H ++ +LL++  A+ N             L     +H+A   +  +  + L+  GA++  T         E+ +T LH+A  +    +N + +LL+   + +  T +G+TP   A R ++ +   +LL  G   +A     ++ L +++   N +I+  LLQ+  QVD+  KD Y  TALH +              +  +   A + +N ++   + K G+  L    +YG+      +L++ AD D         +TP+ +A   N+      L+  GA+  + ++ N  T LH+A R   + IA  L+  G+  +  S+ G      P+H++ Q G  EI  +L+   +++N      +   + P+HL A  D                N+N             + ++N   +     AG               T LH+A+  G   +V+ LL+ GA+  A        G  P+H   + GH  IV L  +   + +A    G T LH A   G + +++ L
Sbjct:  338 LTALHVAAHCGHVRVAKLLLDRNADANARA----------LNGFTPLHIACKKNRLKVVELLLRHGASISATT--------ESGLTPLHVAAFM--GCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMY--TALHIA------------AKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVD---AQGKNGVTPLHVACHYNNQQVALLLLEKGAS-PHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAG----FTPLHLSSQEGHAEISNLLIEHKAAVNH----PAKNGLTPMHLCAQED----------------NVNVAE----------ILEKNGANIDMATKAGY--------------TPLHVASHFGQANMVRFLLQNGANVDA----ATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 785          

HSP 7 Score: 48.9062 bits (115), Expect = 5.911e-7
Identity = 43/186 (23.12%), Postives = 86/186 (46.24%), Query Frame = 2
Query:  227 SILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            + LH A    HV +A+ L++ +        ++ +  L+   P+HIAC+  R  ++++LL+   +     E   + L     +   +  I+  + + S     +    PLHL    +  D +++L++  A+V   +R    ++T L +A  L  ++ V +LL+ GA  +       + L  AAK G+
Sbjct:  339 TALHVAAHCGHVRVAKLLLDRN-------ADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAR---EQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQ 514          

HSP 8 Score: 25.409 bits (54), Expect = 5.911e-7
Identity = 12/36 (33.33%), Postives = 21/36 (58.33%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNN 927
            GH  + ++LL+  A+      ++ +TPLH +C  NN
Sbjct:  546 GHIKVAQLLLQKEADVD-AQGKNGVTPLHVACHYNN 580          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303124)

HSP 1 Score: 197.593 bits (501), Expect = 2.179e-50
Identity = 192/719 (26.70%), Postives = 325/719 (45.20%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEM--NSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   ++ ++ LL  G  ++S T KG+T    A    + E   LLL      N  +    + L ++A + +  +++ LL N  + +     G T L  +  Q          HD     +A + ++D+   ++   L  A +  +      +L    +PD   + +    TP+ +A      +I+N+  LI+ GA++NY S+ +  + LHVA +     +   L+  G NI  ++R G    + P+H A ++G ++++++LL  G+ +++    K+   + PLH+AA  +     + L + ++    ++    D   AL       +V   + +L   AD + + +       T LHIA +    ++V+LLL +GA   A        G+ P+H+A   G + IV        S       G T LH AA A   DI+ ILL+ GA V+A A    R +  P+H+AS  G+   V LLL++G+ ++A      +D  TAL+IA  E ++ V   LI++GA                                   +L+     G + LHLTA+ GH +++  LL+ + + +  G+            ++PL+ AC + +  V  LL++ GA  H A    GH    P+H AA + +  +  TLLE G   +   + G TPLH S  EG  + +  LI  KA VN   K G  P
Sbjct:  198 LHLAS--KDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQG---------HDKV---VAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPD---VTSKSGFTPLHIASHYGNQNIANL--LIQKGADVNY-SAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDG----LTPLHCAARSGHEQVVDMLLERGAPISA----KTKNGLAPLHMAAQGEHVDAARILLYHRAP---VDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARAL----NGFTPLHIACKKNRLKVVELLLRHGASISATT----ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARA----REQQTPLHIASRLGNVDIVMLLLQHGAQVDAT----TKDMYTALHIAAKEGQDEVAAVLIENGA-----------------------------------ALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGK----------NGVTPLHVACHYNNQQVALLLLEKGASPH-ATAKNGHT---PLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTP 820          

HSP 2 Score: 192.971 bits (489), Expect = 6.517e-49
Identity = 210/840 (25.00%), Postives = 382/840 (45.48%), Query Frame = 1
Query: 1264 LAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLT-------------------VDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSR-NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLH 3723
            L + I+IN +N+   + L LA +   + +VS LL RG+  +    +  T+L  +     +++ +LL+ + A++N       V S    T    +++A   +     + L+  GAN  L                    V +L E +    V L  L I  K + +     LL+   N +  +  G TP   A  Y      NLL+ +G D N     N S L ++A      ++  LL+   +   K   GLT LH                                          A + G+E  VV +L +   P      N   + P+ +A +   +     L+ H A ++ ++  +  T LHVA    ++ +AK L+   ++ + R+  G      P+H+A +    +++E+LL  G+S+++T    +   + PLH+AA     + V +L  Q  AS ++ + R ++   L    ++ ++I +  +L  GA V      +R+R   T LHIA+++G+ +IV LLL++GA   A      +D    +H+A + G  E+  +  + G ++ AA   G T LH  A  G + + ++LL+  ADV+A+  +G    + P+H+A    +++   LLLE G+  +A      ++  T L+IA  +N+ ++   L++ GA  +  E+  G TPLH++ Q G  + I  L+    +++N P   G++ +HL A++ +  ++  L +   N ++        + K  Y  +PL+ A  FG   +V+ L++ GA++  A +     G  P+H  A +G  H++  LLE   + +    +G TPLH
Sbjct:  181 LKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVN-------VQSQNGFT---PLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLH-----------------------------------------CAARSGHE-QVVDMLLERGAPISAKTKNG--LAPLHMAAQGEHVDAARILLYHRAPVDEVTV-DYLTALHVAAHCGHVRVAKLLLDRNADANARALNG----FTPLHIACKKNRLKVVELLLRHGASISAT----TESGLTPLHVAAFMGCMNIVIYLL-QHDASPDVPTVRGETPLHLAARANQTDIIRI--LLRNGAQVD-----ARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATT----KDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNG----VTPLHVACHYNNQQVALLLLEKGASPHAT----AKNGHTPLHIAARKNQMDIATTLLEYGALAN-AESKAGFTPLHLSSQEGHAE-ISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDM--------ATKAGY--TPLHVASHFGQANMVRFLLQNGANVDAATSI----GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLH 921          

HSP 3 Score: 177.563 bits (449), Expect = 2.979e-44
Identity = 157/532 (29.51%), Postives = 249/532 (46.80%), Query Frame = 1
Query: 2245 LIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            L+ H A++N + S N  T L++A +  + A+ + L+  G+N  L +  G      P+ VA+Q G D+++ +LL   +        +   R+  LH+AA  D       L        N + T    F  L       N      ++  GADV+     S   N + LH+AA+ G   +V LLLE G +  A+     RDG+ P+H A  SGH ++V +  + G  +SA    GL  LH AA    VD   ILL   A V+    D     +  +H+A+  GH +  KLLL+  +  NA    LN    T L+IA  +NR  V++ L++ GA+      + G TPLH+    G    ++YL+   ++S +VP   G + LHL A     ++   LLR        G   D+ +++     +PL+ A   G++ +V LL++ GA +  A T + +     +H AA  G+  V   L+E G ++D   + G TPLH +   G     + L+  +A+V+   K G  P   A   N
Sbjct:  246 LLEHNASVN-VQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDG----FTPLAVAMQQGHDKVVAVLLESDT--------RGKVRLPALHIAAKKDDVKAATLLLDNDH---NPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVN----YSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKT----RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVD----YLTALHVAAHCGHVRVAKLLLDRNADANA--RALN--GFTPLHIACKKNRLKVVELLLRHGASISATTES-GLTPLHVAAFMGCMNIVIYLLQ-HDASPDVPTVRGETPLHLAARANQTDIIRILLR-------NGAQVDARAREQQ---TPLHIASRLGNVDIVMLLLQHGAQVD-ATTKDMYTA---LHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYN 729          

HSP 4 Score: 169.474 bits (428), Expect = 1.138e-41
Identity = 183/746 (24.53%), Postives = 325/746 (43.57%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNA-----------------VNA----------INE------SGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            ++E++ +LL H  ++N  +    + L++A Q N   +V  LL  G++ ++      T L  ++Q+ H K+  +L+             +  A  ++     L+L N    +  S      +H+A  Y +Q     LI KGA++            + N++ LH+A   K    N ++ LLE G NIE+KT  G TP   A R    +  ++LL RG   +A                 V+A          ++E      + L ++A   +  + K LL    D+N +   G T LH +  ++    ++  +    +I          S + +SG   L  A   G    V+ +L+  A PD+  +      TP+ LA   N    +  L+R+GA ++   +  Q+T LH+A R  N+ I   L+  G+ +   ++    +    +H+A + G DE+  +L+  G++L++     + +   PLHL A        + L  +++   ++++   +    L       N    Q V +   +       +     T LHIAA+    +I   LLEYGA   A      + G  P+HL+++ GH EI  L  +   +V+     GLT +H  A   +V++ EIL K GA+++     G      P+H+AS  G    V+ LL+ G+ ++A  S       T L+    +   +++  L++  AN + Q  N G TPLHI  + G+   +
Sbjct:  239 QEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADV--------NYSAKHNISPLHVAA--KWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASI----------SATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE---TPLHLAARANQTDIIRILLRNGAQVD-ARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK----DMYTALHIAAKEGQDEVAAVLIENGAALDAA----TKKGFTPLHLTAKYGHIKVAQLLLQKEA---DVDAQGKNGVTPLHVACHYNN----QQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAE----SKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAG----YTPLHVASHFGQANMVRFLLQNGANVDAATSI----GYTPLHQTAQQGHCHIVNLLLEHKANANAQTVN-GQTPLHIARKLGYISVL 932          

HSP 5 Score: 128.257 bits (321), Expect = 3.410e-29
Identity = 98/346 (28.32%), Postives = 171/346 (49.42%), Query Frame = 1
Query: 2752 AAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVN 3789
            AA+ G+ E V   L+   D    + T + +G+  +HLA++ GH+ +V      G  V +A   G T LH A+ AG  +++++LL+  A VN ++ +G      P++MA+++ H   V+LLL  G    A  S    D  T L +A  +  + V+  L++S     ++        LHI  ++   KA   L+   + + +V   +G + LH+ +  G+  ++  L++   + N + +          +NISPL+ A  +G   +V LL++ G +I  A+T     G+ P+HCAA  G   V+  LLE G  I    ++GL PLH +      D  + L+  +A V+
Sbjct:  168 AARAGNLERVLEHLKNNID----INTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNG----FTPLYMAAQENHDAVVRLLLSNG----ANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVR-----LPALHIAAKKDDVKAATLLLD-NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAK----------HNISPLHVAAKWGKTNMVSLLLEKGGNIE-AKT---RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVD 481          

HSP 6 Score: 48.9062 bits (115), Expect = 6.244e-7
Identity = 43/186 (23.12%), Postives = 86/186 (46.24%), Query Frame = 2
Query:  227 SILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            + LH A    HV +A+ L++ +        ++ +  L+   P+HIAC+  R  ++++LL+   +     E   + L     +   +  I+  + + S     +    PLHL    +  D +++L++  A+V   +R    ++T L +A  L  ++ V +LL+ GA  +       + L  AAK G+
Sbjct:  489 TALHVAAHCGHVRVAKLLLDRN-------ADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAR---EQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQ 664          

HSP 7 Score: 25.409 bits (54), Expect = 6.244e-7
Identity = 12/36 (33.33%), Postives = 21/36 (58.33%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNN 927
            GH  + ++LL+  A+      ++ +TPLH +C  NN
Sbjct:  696 GHIKVAQLLLQKEADVD-AQGKNGVTPLHVACHYNN 730          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Zebrafish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 216.853 bits (551), Expect = 2.930e-56
Identity = 191/721 (26.49%), Postives = 327/721 (45.35%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVR----VLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   +  +  LL  G+ +E+ T KG+T    A    + +    L+  G + NA +    + L ++A + + E++KFLL N  +       G T L  +  Q     +   I                +H  K    + AL      D  R    +L+   +PD++   +    TP+ +A    +++    L+  GA++N+    N  T LH+A R  N+ + + L+  G+ I  +++    +E+ P+H A +NG   IIEILL  G+ + +    K+   ++P+H+AA  D    ++ L                 +NA +  ++  ++                         T LH+AA  G   + ++LL+ GA P  R +    +G  P+H+A +  H+ ++ L      S+ A  + GLT LH ++  G ++I++IL++ GA  NA     N     P+HMAS  GH +  + LL+  +P++A      +D+ T L+ A+      ++K L++  AN +      G TPLHI  + G T+    L+ + N+ L      G + LH+ A+ G  +++  LL    NPN  G++           ++PL+ A    +L VV LL+  G   H A       G  P+H A+ + +  V  +LL+ G S +     G+TPLH +  EG  D    LI  +ANVN+ +K G  P
Sbjct:   49 LHLAS--KEGHVKMVLELLHHGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDNGANQTIPTEDGFTPLAVALQQGHENVVALLI----------------NHGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL---SKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPK-NGITPLHIASRRGNVIMVRLLLDRGAKIDAKTK----DELTPLHCAARNGHVRIIEILLDQGAPIQA----KTKNGLSPIHMAAQGDHLDCIRQLLQ---------------YNAEIDDITLDHL-------------------------TPLHVAAHCGHHRVAKVLLDKGAKPNTRAL----NGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNAS----NVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKA----KDDQTPLHCASRMGHNEMVKLLLEHKANSN-STTTAGHTPLHIAAREGHTQTASILLDM-NAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKV----------GLTPLHVAVHHNNLDVVNLLLSKGGSPHSA----ARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTP 671          

HSP 2 Score: 180.259 bits (456), Expect = 4.788e-45
Identity = 201/777 (25.87%), Postives = 346/777 (44.53%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAG-----SNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLL 3555
            +++++  L+ +  N+N  + K  + L++A Q N L +V  LL  G++  I      T L  ++Q+ H+ +  LLIN+G               V+L    ++H+A    D  T   L+    N     D+L     +T  T LH+A   +  +LN    LL  G ++      G TP   A R   +    LLL RG   +A      + L  +A   +  I++ LL        K   GL+ +H +   D    I   +      + A+IDD    H      L  A   G+      +L + A P+   ++     TP+ +A + N +  M  L++H A+L  ++     T LHV+    ++ I K L+  G     SN+ + +         P+H+A + G  E+ E LL   + +++    K+ +   PLH A+       VK L   ++   N NST + + +  L + ++       S+L+   D++ +      +  T LH+AA+ G  ++  LLLE GA+P A      + G+ P+H+A    +L++V L    G S  +A   G T LH A+     ++   LL+ GA  NAE+  G    + P+H+AS++G    V LL+   + +N      N+  LT L++   E    +   L+K GA+       +G TPLH+ C  G  K + +L+    +++N       + LH  A++GH ++   LL+    PN          + TS   S L  A   G+++V+ +L
Sbjct:   90 QEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDNGANQTIPTEDGFTPLAVALQQGHENVVALLINHGTK-----------GKVRL---PALHIAARNDDTRTAAVLLQNDPN----PDVLS----KTGFTPLHIAAHYE--NLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQ-----YNAEIDDITLDHLTP---LHVAAHCGHHRVAKVLLDKGAKPNTRALNG---FTPLHIACKKNHMRVMDLLLKHSASLEAVTESGL-TPLHVSSFMGHLNIVKILMQKGASPNASNVKVET---------PLHMASRAGHCEVAEFLLQNAAPVDA----KAKDDQTPLHCASRMGHNEMVKLLLEHKA---NSNST-TTAGHTPLHIAAREGHTQTASILL---DMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNA----AGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQG----VTPLHLASQEGQPDMVLLLISKQANVNLG----NKSGLTPLHLVAQEGHVGIADILVKHGAS-VYAATRMGYTPLHVACHYGNIKMVKFLLQ-QQANVNCKTRMSYTPLHQAAQQGHTDIVTLLLKHGAQPN----------EVTSNGTSALAIAKRLGYISVIDVL 786          

HSP 3 Score: 171.014 bits (432), Expect = 3.507e-42
Identity = 194/815 (23.80%), Postives = 355/815 (43.56%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKN---------AVNAINESGLILSAIKKNPEIM--------------------KFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSH-SLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMA-GADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLL-EYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D N      +  L  + ++ H KM   L+++G          +VL         ++H+A +   ++    L++ GAN+          + +   T L++A   + N L  + FLL+ G N    T  G TP   A++        LL+  G             A N    +  +L     NP+++                    + LL    D N     G+T LH +  +   I +   +     I     D+    H + ++G+          + ++ +L     P      N   ++PI +A + + +  +  L+++ A ++ I+  +  T LHVA    +  +AK L+  G+  + R+  G      P+H+A +     ++++LL   +SL +     +   + PLH+++     + VK L  Q+ AS N ++ + ++    L + S+     V   L+   A V  K       + T LH A+++G  E+V+LLLE+ A+  +    G      P+H+A   GH +   +  D    ++     G T LH AA  G VD+  +LL+ GA+ NA    G    + P+H+A    +   V LLL + GSP +A      R+  T L+IA+ +N+  V   L++ GA+ +  E+  G TPLH+  Q G    ++ LI    +++N+   +G++ LHL A++GH  ++  L++             S    T    +PL+ AC +G++ +VK L++  A+++            P+H AA +G   ++  LL+ G   +E   +G + L
Sbjct:   35 GIDINTANQNGLNGLHLASKEGHVKMVLELLHHG----------IVLETTTKKGNTALHIAALAGQEQVVTELVNYGANV--------NAQSQKGFTPLYMAA--QENHLEVVKFLLDNGANQTIPTEDGFTPLAVALQQGHENVVALLINHGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGH----------VRIIEILLDQGAPIQAKTKNG--LSPIHMAAQGDHLDCIRQLLQYNAEIDDITL-DHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNG----FTPLHIACKKNHMRVMDLLLKHSASLEAV----TESGLTPLHVSSFMGHLNIVKILM-QKGASPNASNVKVET---PLHMASRAGHCEVAEFLLQNAAPVDAKA----KDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGH----TPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVG----LTPLHVAVHHNNLDVVNLLLSKGGSPHSAA-----RNGYTPLHIASKQNQAEVASSLLQHGASANA-ESLQGVTPLHLASQEGQPDMVLLLIS-KQANVNLGNKSGLTPLHLVAQEGHVGIADILVKHGA----------SVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCKTRM----SYTPLHQAAQQGHTDIVTLLLKHGAQPNEVTSNGTSAL 771          

HSP 4 Score: 169.474 bits (428), Expect = 9.638e-42
Identity = 157/558 (28.14%), Postives = 250/558 (44.80%), Query Frame = 1
Query: 2236 MCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTG-----------------------QITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            +  L+ +GAN+N   S    T L++A +  ++ + K L+  G+N  + +  G      P+ VA+Q G + ++ +L+  G+        K   R+  LH+AA ND T T   L          N    D                               ++S++   T LHIAA   +  + QLLL  GAD    +    ++GI P+H+A+  G++ +V+L  D G  + A     LT LH AA  G V I+EILL  GA + A+  +G    + PIHMA++  H   ++ LL+Y    NA    +  D+LT L++A       V K L+  GA P+ +  N G TPLHI C++   + +M L+   ++SL     +G++ LH+++  GH  +   L++   +PN +                        Q       K   + +PL+ A   GH  +VKLL++  A+ + + T  GH    P+H AA  G       LL+    + +  + G TPLH +   G  D    L+   AN N   K+G  P   AV  N
Sbjct:   94 VTELVNYGANVN-AQSQKGFTPLYMAAQENHLEVVKFLLDNGANQTIPTEDG----FTPLAVALQQGHENVVALLINHGT--------KGKVRLPALHIAARNDDTRTAAVLLQ--------NDPNPD-------------------------------VLSKT-GFTPLHIAAHYENLNVAQLLLNRGAD----VNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNG----LSPIHMAAQGDHLDCIRQLLQY----NAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALN-GFTPLHIACKKNHMR-VMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSN-STTTAGHT---PLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHN 580          

HSP 5 Score: 114.005 bits (284), Expect = 9.835e-25
Identity = 101/354 (28.53%), Postives = 170/354 (48.02%), Query Frame = 1
Query: 2734 ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNII 3795
            AT    AA+ G+ E     ++ G D    + T +++G+  +HLA++ GH+++V      G+ +      G T LH AA AG   ++  L+  GA+VNA++  G      P++MA+++ H + VK LL+ G+  N        D  T L +A  +  ENV+  LI  G    ++   L A  LHI  +   T+    L+   + + +V   TG + LH+ A   +  ++  LL    + N T +            I+PL+ A   G++ +V+LL+  GA I      E    + P+HCAA  G   +I  LL+ G  I    ++GL+P+H +      DC + L+   A ++ I
Sbjct:   13 ATSFLRAARSGNLEKALDHIKNGID----INTANQNGLNGLHLASKEGHVKMVLELLHHGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKG----FTPLYMAAQENHLEVVKFLLDNGA--NQTIP--TEDGFTPLAVALQQGHENVVALLINHGTKGKVR---LPA--LHIAARNDDTRTAAVLLQ-NDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPK----------NGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDE----LTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDI 334          

HSP 6 Score: 106.686 bits (265), Expect = 1.705e-22
Identity = 102/371 (27.49%), Postives = 169/371 (45.55%), Query Frame = 1
Query: 2743 LHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF 3855
            LH+A++ G  ++V  LL +G      + T  + G   +H+A  +G  ++V    ++G +V+A    G T L+ AA    +++++ LL  GA+      DG      P+ +A ++GH+  V LL+ +G+          +  L AL+IA   +       L+++  NPD+  +  G TPLHI            L+    + +N     GI+ LH+ + +G+  +   LL         G   D+   KT   ++PL+ A   GH+ ++++L+  GA I  A+T     G+ PIH AA       I  LL+    ID+   D LTPLH +   G +   K L+   A  N     G  P   A   N M + 
Sbjct:   49 LHLASKEGHVKMVLELLHHGI----VLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDNGANQTIPTEDG----FTPLAVALQQGHENVVALLINHGTK--------GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL-SKTGFTPLHIAAHYENLNVAQLLLN-RGADVNFTPKNGITPLHIASRRGNVIMVRLLLD-------RGAKIDA---KTKDELTPLHCAARNGHVRIIEILLDQGAPIQ-AKT---KNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVM 387          

HSP 7 Score: 49.2914 bits (116), Expect = 2.694e-7
Identity = 51/218 (23.39%), Postives = 97/218 (44.50%), Query Frame = 2
Query:  239 DAIILNHVD---IAQHLINHSLMNI--NFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSEL----------IEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETRESNSVVILFK*VTIQSLKFF 847
            D I L+H+    +A H  +H +  +  +      +  L+   P+HIAC+     ++ +LL+ + + E   E   + L          I  +++ K + P      N S+  V      PLH+     H +  + L+Q A   +++++    +T L  A  +   E V +LLE  AN N    +  +PL  AA+ G T+ ++ ++ +   +T  + K F
Sbjct:  332 DDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASP------NASNVKV----ETPLHMASRAGHCEVAEFLLQNA-APVDAKAK-DDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGF 537          

HSP 8 Score: 26.5646 bits (57), Expect = 2.694e-7
Identity = 14/31 (45.16%), Postives = 19/31 (61.29%), Query Frame = 1
Query:  841 VLLKYGANPRIGTKRHQITPLHASCISNNID 933
            +LL+ GANP    K   +TPLH +   NN+D
Sbjct:  554 LLLERGANPNAAGKV-GLTPLHVAVHHNNLD 583          

HSP 9 Score: 46.595 bits (109), Expect = 5.372e-6
Identity = 43/191 (22.51%), Postives = 78/191 (40.84%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 784
            + G++ LH A   N  ++A  L+ H         ++ +  L  + P+H+A + G+  ++ +L+ +  N                              N+ +   L     PLHLV    H+    +L++  A V+  +R      T L +AC    ++ V  LL+  AN N     + +PL  AA++G T
Sbjct:  600 RNGYTPLHIASKQNQAEVASSLLQHG-------ASANAESLQGVTPLHLASQEGQPDMVLLLISKQAN-----------------------------VNLGNKSGL----TPLHLVAQEGHVGIADILVKHGASVYAATRMGY---TPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTPLHQAAQQGHT 747          

HSP 10 Score: 25.0238 bits (53), Expect = 5.372e-6
Identity = 10/16 (62.50%), Postives = 12/16 (75.00%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANP 867
            GH  IV +LLK+GA P
Sbjct:  745 GHTDIVTLLLKHGAQP 760          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 198.364 bits (503), Expect = 7.196e-51
Identity = 205/799 (25.66%), Postives = 354/799 (44.31%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVR----VLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYG-----------SPI------------------NAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHK-GIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF*LSMCFFERLFYKFSCDYFM*KYFYNFQIEFILFH 3960
            LHLA   K   +  +  LL  G+++E+ T KG+T    A    + +    L+  G + NA +    S L ++A + + E++K+LL++  + +     G T L  +  Q     +   I+  T                K    + AL      D  R    +L+   +PD++   +    TP+ +A    ++S    L+  GAN+N+    N  T LH+A R  N+ + + L+  G+ I  +++    +E+ P+H A +NG   ++EILL  G+ L +    K+   ++P+H+AA  D    V+ L    +    I+    D    L       +   V+ +L  GA  + + +       T LHIA +      + LLL++ A   A  +T    G+ P+H+A   GHL IVK     G S +A+     T LH AA AG  ++ + LL+  A V+A+A D       P+H A+  GHK+ VKLL+E+            +P+                  NA  +++ +   T L++A    + +V++ L++ GANP+    N G TPLH+         +  L+    S  +   N G ++LH+ A++   E++  LL+   N N           ++   I+PL+ A   G   +V LL+   A+++      G+K G+ P+H  A  G   +   L++ G S+      G TPLH +   G     KFL+  +A+VN   ++        + A+   LF +S+C      + FS  +        FQ+ +   H
Sbjct:   82 LHLAS--KEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGT----------------KGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL---SKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK-NGITPLHIASRRGNVIMVRLLLDRGAQIDAKTK----DELTPLHCAARNGHVRVVEILLDQGAPLQA----KTKNGLSPIHMAAQGDHMDCVRQLLQYNA---EIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARAL----NGFTPLHIACKKNHMRSMDLLLKHSASLEA--VT--ESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKD----DQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKN-GLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARN-GYTALHIAAKQNQLEVASSLLQYGANAN----------SESLQGITPLHLASQEGQPDMVALLISKQANVNL-----GNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSV----LLLDASYTGLFSVSVCTLRTFAFSFSLIFL-------FQLGYTPLH 807          

HSP 2 Score: 179.874 bits (455), Expect = 4.632e-45
Identity = 205/785 (26.11%), Postives = 353/785 (44.97%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAG-----SNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAE-KGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNI--SPLNQACGFGHLTVVKLLVKFGA 3570
            +++++  L+ +  N+N  + K  S L++A Q N L +V  LL  G++ ++      T L  ++Q+ H+ +  LLINYG               V+L    ++H+A    D  T   L+    N     D+L     +T  T LH+A   +  +L+    LL  G N+      G TP   A R   +    LLL RG   +A      + L  +A   +  +++ LL        K   GL+ +H +   D    +   +      + A+IDD    H      L  A   G+   V  +L + A  +   ++     TP+ +A + N + +M  L++H A+L  ++  +  T LHVA    ++ I K L+  G     SN+ + +         P+H+A + G  E+ + LL   + +++    K+ +   PLH AA       VK L   ++   N +S  + + +  L + ++        +L+   D + +      +  T LH+A + G  ++V+LLLE GA+P A      ++G+ P+H+A    +L++VKL    G S  +    G T LH AA    +++   LL+ GA+ N+E+  G    + P+H+AS++G    V LL+   + +N      N++ LT L++   E    +   L+K GA+     + +G TPLH+ C  G  K + +L+       +V   T +S L L A   G   +S   LR             SFS    + +  +PL+QA   GH  +V LL+K GA
Sbjct:  123 QEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----------GKVRL---PALHIAARNDDTRTAAVLLQNDPN----PDVLS----KTGFTPLHIAAHYE--NLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQ-----YNAEIDDITLDHLTP---LHVAAHCGHHRMVKVLLDKGAKANARALNG---FTPLHIACKKNHMRSMDLLLKHSASLEAVTE-SGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVET---------PLHMAARAGHCEVAQFLLQNNAQVDA----KAKDDQTPLHCAARMGHKELVKLLMEHKA---NPDSA-TTAGHTPLHIAAREGHAQTTRILL---DENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNA----AGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQG----ITPLHLASQEGQPDMVALLISKQANVNLG----NKNGLTPLHLVAQEGHVGIADMLVKQGAS-VYAASRMGYTPLHVACHYGNIKMVKFLL---QQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRT---------FAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLKHGA 826          

HSP 3 Score: 119.783 bits (299), Expect = 1.104e-26
Identity = 100/348 (28.74%), Postives = 155/348 (44.54%), Query Frame = 1
Query: 2863 ATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF*LSMCFFERLFYKFSCD 3906
            A  SG+LE        G+ ++ A   GL  LH A+  G V ++  LL  G D+      GN +    +H+A+  G +K V  L+ YG+ +NA     ++   + LY+A  EN   V+KYL++ GAN  +   + G TPL +  Q+G    +  LI              + +LH+ A       +  LL+   NP       D  SK      +PL+ A  + +L+V +LL+  GA+++    F    GI P+H A+ RG   ++  LL+ G  ID   +D LTPLH +   G     + L+   A +    K G  P   A   + M       C  + L Y    D
Sbjct:   52 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTA----LHIAALAGQEKVVAELINYGANVNAQ----SQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTED-GFTPLAVALQQGHENVVALLINYGTKG-----KVRLPALHIAARNDDTRTAAVLLQNDPNP-------DVLSKT---GFTPLHIAAHYENLSVAQLLLNRGANVN----FTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMD------CVRQLLQYNAEID 365          

HSP 4 Score: 116.701 bits (291), Expect = 1.230e-25
Identity = 94/322 (29.19%), Postives = 157/322 (48.76%), Query Frame = 1
Query: 2830 GDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNII 3795
             +++G+  +HLA++ GH+++V      G+ +      G T LH AA AG   ++  L+  GA+VNA++  G      P++MA+++ H + VK LLE+G    A  S    D  T L +A  +  ENV+  LI  G    ++   L A  LHI  +   T+    L+   + + +V   TG + LH+ A   +  ++  LL    N N T +            I+PL+ A   G++ +V+LL+  GA I      E    + P+HCAA  G   V+  LL+ G  +    ++GL+P+H +      DC + L+   A ++ I
Sbjct:   74 ANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKG----FSPLYMAAQENHLEVVKYLLEHG----ANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVR---LPA--LHIAARNDDTRTAAVLLQ-NDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK----------NGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDE----LTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDI 367          

HSP 5 Score: 56.9954 bits (136), Expect = 4.898e-15
Identity = 58/218 (26.61%), Postives = 92/218 (42.20%), Query Frame = 2
Query:  179 LLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINF-PCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFN--ISDTYVLLD-----------AWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            LL       +L K G++ LH A    ++ +AQ L+N    N+NF P N        + P+HIA   G   ++++LL R    +      K EL           P+ C   N  +    +LLD             +P+H+    DH+DC++ L+Q  A++       +   T L +A        V VLL+ GA  N   ++  +PL  A K+   R
Sbjct:  225 LLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRG-ANVNFTPKNG-------ITPLHIASRRGNVIMVRLLLDRGAQID---AKTKDELT----------PLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMR 418          

HSP 6 Score: 45.4394 bits (106), Expect = 4.898e-15
Identity = 98/481 (20.37%), Postives = 181/481 (37.63%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHI----KKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGI---DYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSIS 2232
            +GH  IV+ LL+ GA+P     + + TPLH +  + + +     +Q                   N  Q++    +             D    +C      K++  LL E+K + +S  T          H  L I  +       +   ILL       +   K  + L +A +   + +V  LL RG++PN      +T L  ++   +  + +LL++ G + +          +       ++H+A   +  E    L+  GAN           E    +T LHLA   +    + +  L+    N+      G TP     +   +   ++L+ +G    A + +  + L ++    N +++KFLLQ Q   N K    +  L  S+   F + +     F    + IF+ ++           GY  L  A Q G+   V  +LK  A P+ +  +     +P+ +A  +  IS
Sbjct:  447 MGHLNIVKSLLQRGASPNASNVKVE-TPLHMAARAGHCEVAQFLLQ-------------------NNAQVDAKAKD-------------DQTPLHCAARMGHKELVKLLMEHKANPDSATTAG--------HTPLHIAAREGH---AQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPH----------STARNGYTALHIAAKQNQLEVASSLLQYGANA--------NSESLQGITPLHLAS--QEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQL-----------GYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGT---SPLGIAKRLGYIS 849          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 194.512 bits (493), Expect = 1.867e-49
Identity = 197/751 (26.23%), Postives = 338/751 (45.01%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVR----VLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYG-----------SPI------------------NAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHK-GIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   +  +  LL  G+++E+ T KG+T    A    + +    L+  G + NA +    S L ++A + + E++K+LL++  + +     G T L  +  Q     +   I+  T                K    + AL      D  R    +L+   +PD++   +    TP+ +A    ++S    L+  GAN+N+    N  T LH+A R  N+ + + L+  G+ I  +++    +E+ P+H A +NG   ++EILL  G+ L +    K+   ++P+H+AA  D    V+ L    +    I+    D    L       +   V+ +L  GA  + + +       T LHIA +      + LLL++ A   A  +T    G+ P+H+A   GHL IVK     G S +A+     T LH AA AG  ++ + LL+  A V+A+A D       P+H A+  GHK+ VKLL+E+            +P+                  NA  +++ +   T L++A    + +V++ L++ GANP+    N G TPLH+         +  L+    S  +   N G ++LH+ A++   E++  LL+   N N           ++   I+PL+ A   G   +V LL+   A+++      G+K G+ P+H  A  G   +   L++ G S+      G TPLH +   G     KFL+  +A+VN   ++G  P
Sbjct:   52 LHLAS--KEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGT----------------KGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL---SKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK-NGITPLHIASRRGNVIMVRLLLDRGAQIDAKTK----DELTPLHCAARNGHVRVVEILLDQGAPLQA----KTKNGLSPIHMAAQGDHMDCVRQLLQYNA---EIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARAL----NGFTPLHIACKKNHMRSMDLLLKHSASLEA--VT--ESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKD----DQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKN-GLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARN-GYTALHIAAKQNQLEVASSLLQYGANAN----------SESLQGITPLHLASQEGQPDMVALLISKQANVNL-----GNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTP 740          

HSP 2 Score: 189.119 bits (479), Expect = 8.769e-48
Identity = 199/777 (25.61%), Postives = 353/777 (45.43%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAG-----SNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLL 3555
            +++++  L+ +  N+N  + K  S L++A Q N L +V  LL  G++ ++      T L  ++Q+ H+ +  LLINYG               V+L    ++H+A    D  T   L+    N     D+L     +T  T LH+A   +  +L+    LL  G N+      G TP   A R   +    LLL RG   +A      + L  +A   +  +++ LL        K   GL+ +H +   D    +   +      + A+IDD    H      L  A   G+   V  +L + A  +   ++     TP+ +A + N + +M  L++H A+L  ++  +  T LHVA    ++ I K L+  G     SN+ + +         P+H+A + G  E+ + LL   + +++    K+ +   PLH AA       VK L   ++   N +S  + + +  L + ++        +L+   D + +      +  T LH+A + G  ++V+LLLE GA+P A      ++G+ P+H+A    +L++VKL    G S  +    G T LH AA    +++   LL+ GA+ N+E+  G    + P+H+AS++G    V LL+   + +N      N++ LT L++   E    +   L+K GA+     + +G TPLH+ C  G  K + +L+    + +N     G + LH  A++GH ++   LL+    PN          + T+   SPL  A   G+++V+ +L
Sbjct:   93 QEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----------GKVRL---PALHIAARNDDTRTAAVLLQNDPN----PDVLS----KTGFTPLHIAAHYE--NLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQ-----YNAEIDDITLDHLTP---LHVAAHCGHHRMVKVLLDKGAKANARALNG---FTPLHIACKKNHMRSMDLLLKHSASLEAVTE-SGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVET---------PLHMAARAGHCEVAQFLLQNNAQVDA----KAKDDQTPLHCAARMGHKELVKLLMEHKA---NPDSA-TTAGHTPLHIAAREGHAQTTRILL---DENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNA----AGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQG----ITPLHLASQEGQPDMVALLISKQANVNLG----NKNGLTPLHLVAQEGHVGIADMLVKQGAS-VYAASRMGYTPLHVACHYGNIKMVKFLLQ-QQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPN----------EITTNGTSPLGIAKRLGYISVIDVL 789          

HSP 3 Score: 169.474 bits (428), Expect = 1.014e-41
Identity = 158/537 (29.42%), Postives = 248/537 (46.18%), Query Frame = 1
Query: 2236 MCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI--GIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            +  LI +GAN+N   S    + L++A +  ++ + K L+  G+N  L +  G      P+ VA+Q G + ++ +L+ +G+        K   R+  LH+AA ND T T   L        N +      F  L       N+   Q +L  GA+V+     +     T LHIA++ G+  +V+LLL+ GA   A+     +D + P+H A  +GH+ +V++  D G  + A    GL+ +H AA    +D +  LL+     NAE  D     + P+H+A+  GH + VK+LL+ G+  NA    LN    T L+IA  +N    M  L+K  A+ +    + G TPLH+    G    +  L+  G + ++ NV + T    LH+ A  GH E++ +LL          Q       K   + +PL+ A   GH  +VKLL++  A+   A T     G  P+H AA  G       LL+      +  + G TPLH +   G  D  + L+   AN N   K G  P   AV  N
Sbjct:   97 VAELINYGANVN-AQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDG----FTPLAVALQQGHENVVALLINYGT--------KGKVRLPALHIAARNDDTRTAAVLLQNDP---NPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVN----FTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKT----KDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQ----YNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANA--RALN--GFTPLHIACKKNHMRSMDLLLKHSASLEAVTES-GLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVET---PLHMAARAGHCEVAQFLL----------QNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATT----AGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHN 583          

HSP 4 Score: 119.013 bits (297), Expect = 2.468e-26
Identity = 101/365 (27.67%), Postives = 162/365 (44.38%), Query Frame = 1
Query: 2812 FARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF*LSMCFFERLFYKFSCD 3906
            F+ + +   D       A  SG+LE        G+ ++ A   GL  LH A+  G V ++  LL  G D+      GN +    +H+A+  G +K V  L+ YG+ +NA     ++   + LY+A  EN   V+KYL++ GAN  +   + G TPL +  Q+G    +  LI              + +LH+ A       +  LL+   NP++          KT +  +PL+ A  + +L+V +LL+  GA+++    F    GI P+H A+ RG   ++  LL+ G  ID   +D LTPLH +   G     + L+   A +    K G  P   A   + M       C  + L Y    D
Sbjct:    5 FSSLSSPQADATTSFLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTA----LHIAALAGQEKVVAELINYGANVNAQ----SQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTED-GFTPLAVALQQGHENVVALLINYGTKG-----KVRLPALHIAARNDDTRTAAVLLQNDPNPDVL--------SKTGF--TPLHIAAHYENLSVAQLLLNRGANVN----FTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMD------CVRQLLQYNAEID 335          

HSP 5 Score: 115.931 bits (289), Expect = 1.980e-25
Identity = 94/322 (29.19%), Postives = 157/322 (48.76%), Query Frame = 1
Query: 2830 GDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNII 3795
             +++G+  +HLA++ GH+++V      G+ +      G T LH AA AG   ++  L+  GA+VNA++  G      P++MA+++ H + VK LLE+G    A  S    D  T L +A  +  ENV+  LI  G    ++   L A  LHI  +   T+    L+   + + +V   TG + LH+ A   +  ++  LL    N N T +            I+PL+ A   G++ +V+LL+  GA I      E    + P+HCAA  G   V+  LL+ G  +    ++GL+P+H +      DC + L+   A ++ I
Sbjct:   44 ANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKG----FSPLYMAAQENHLEVVKYLLEHG----ANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVR---LPA--LHIAARNDDTRTAAVLLQ-NDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK----------NGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDE----LTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDI 337          

HSP 6 Score: 112.464 bits (280), Expect = 2.246e-24
Identity = 108/371 (29.11%), Postives = 177/371 (47.71%), Query Frame = 1
Query: 2743 LHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQ-RGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLI--GLKANVNIIDKIGKKPKDYAVTANLM 3846
            LH+A++ G  ++V  LL  G D    + T  + G   +H+A  +G  ++V    ++G +V+A    G + L+ AA    +++++ LL+ GA+ +    DG      P+ +A ++GH+  V LL+ YG+          +  L AL+IA   +       L+++  NPD+  +  G TPLHI       + A + L   AN  +N     GI+ LH+ + +G+  +   LL      +   QI      KT   ++PL+ A   GH+ VV++L+  GA +  A+T     G+ PIH AA       +  LL+    ID+   D LTPLH +   G +   K L+  G KAN   ++  G  P   A   N M
Sbjct:   52 LHLASKEGHVKMVLELLHNGID----LETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDG----FTPLAVALQQGHENVVALLINYGTK--------GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL-SKTGFTPLHIAAHYENLSVAQLLLNRGAN--VNFTPKNGITPLHIASRRGNVIMVRLLL------DRGAQI----DAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQ-AKT---KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALN--GFTPLHIACKKNHM 387          

HSP 7 Score: 56.9954 bits (136), Expect = 2.608e-16
Identity = 58/218 (26.61%), Postives = 92/218 (42.20%), Query Frame = 2
Query:  179 LLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINF-PCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFN--ISDTYVLLD-----------AWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            LL       +L K G++ LH A    ++ +AQ L+N    N+NF P N        + P+HIA   G   ++++LL R    +      K EL           P+ C   N  +    +LLD             +P+H+    DH+DC++ L+Q  A++       +   T L +A        V VLL+ GA  N   ++  +PL  A K+   R
Sbjct:  195 LLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRG-ANVNFTPKNG-------ITPLHIASRRGNVIMVRLLLDRGAQID---AKTKDELT----------PLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMR 388          

HSP 8 Score: 49.6766 bits (117), Expect = 2.608e-16
Identity = 82/395 (20.76%), Postives = 149/395 (37.72%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHI----KKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQ 1989
            +GH  IV+ LL+ GA+P     + + TPLH +  + + +     +Q                   N  Q++    +             D    +C      K++  LL E+K + +S  T          H  L I  +       +   ILL       +   K  + L +A +   + +V  LL RG++PN      +T L  ++   +  + +LL++ G + +          +       ++H+A   +  E    L+  GAN           E    +T LHLA   +    + +  L+    N+      G TP     +   +   ++L+ +G    A + +  + L ++    N +++KFLLQ Q   N K   G T LH +  Q
Sbjct:  417 MGHLNIVKSLLQRGASPNASNVKVE-TPLHMAARAGHCEVAQFLLQ-------------------NNAQVDAKAKD-------------DQTPLHCAARMGHKELVKLLMEHKANPDSATTAG--------HTPLHIAAREGH---AQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPH----------STARNGYTALHIAAKQNQLEVASSLLQYGANA--------NSESLQGITPLHLAS--QEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQ 747          

HSP 9 Score: 51.9878 bits (123), Expect = 4.685e-7
Identity = 45/191 (23.56%), Postives = 77/191 (40.31%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLI-QEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 784
            + G++ LH A   N +++A  L+        +  N+ S  L  + P+H+A + G+  ++ +L+ +  N  L  +                                 +   PLHLV    H+    ML+ Q A V+  SR      T L +AC    ++ V  LL+  A+ N       +PL  AA++G T
Sbjct:  603 RNGYTALHIAAKQNQLEVASSLLQ-------YGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNK---------------------------------NGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGY---TPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHT 750          

HSP 10 Score: 23.483 bits (49), Expect = 4.685e-7
Identity = 10/16 (62.50%), Postives = 12/16 (75.00%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANP 867
            GH  IV +LLK+GA P
Sbjct:  748 GHTDIVTLLLKHGALP 763          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 194.126 bits (492), Expect = 2.725e-49
Identity = 190/753 (25.23%), Postives = 342/753 (45.42%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVR----VLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASIN-------------------------------INSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHK-GIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   +  +  LL  G+++E+ T KG+T    A    + +    L+  G + NA +    S L ++A + + E++K+LL++  + +     G T L  +  Q     +   I+  T                K    + AL      D  R    +L+   +PD++   +    TP+ +A    ++S    L+  GAN+N+    N  T LH+A R  N+ + + L+  G+ I  +++    +E+ P+H A +NG   ++EILL  G+ L +    K+   ++P+H+AA  D    V+ L  Q +A I+                                N+   + F  L     K ++  +  +L   A +     V+ S   T LH+AA +G   IV+ LL+ GA P + + + D     P+H+A  +GH E+ +        V A      T LH AA  G  +++++L++  A+ ++  T G+     P+H+A+ +GH ++ ++LL+     NA  +++ +   T L++A    + +V++ L++ GANP+    N G TPLH+         +  L+    S  +   N G ++LH+ A++   E++  LL+   N N           ++   I+PL+ A   G   +V LL+   A+++      G+K G+ P+H  A  G   +   L++ G S+      G TPLH +   G     KFL+  +A+VN   ++G  P
Sbjct:   79 LHLAS--KEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGT----------------KGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL---SKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK-NGITPLHIASRRGNVIMVRLLLDRGAQIDAKTK----DELTPLHCAARNGHVRVVEILLDQGAPLQA----KTKNGLSPIHMAAQGDHMDCVRQLL-QYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEA---VTES-GLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVET-PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGH----TPLHIAAREGHAQTTRILLDE----NAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKN-GLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARN-GYTALHIAAKQNQLEVASSLLQYGANAN----------SESLQGITPLHLASQEGQPDMVALLISKQANVNL-----GNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTP 770          

HSP 2 Score: 164.081 bits (414), Expect = 4.374e-40
Identity = 156/537 (29.05%), Postives = 246/537 (45.81%), Query Frame = 1
Query: 2236 MCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI--GIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            +  LI +GAN+N   S    + L++A +  ++ + K L+  G+N  L +  G      P+ VA+Q G + ++ +L+ +G+        K   R+  LH+AA ND T T   L        N +      F  L       N+   Q +L  GA+V+     +     T LHIA++ G+  +V+LLL+ GA   A+     +D + P+H A  +GH+ +V++  D G  + A    GL+ +H AA    +D +  LL+     NAE  D     + P+H+A+  GH + VK+LL+ G+  NA    LN    T L+IA  +N    M  L+K  A+ +    + G TPLH+    G    +  L+  G + +S     +   + LH+ A  GH E++ +LL          Q       K   + +PL+ A   GH  +VKLL++  A+   A T     G  P+H AA  G       LL+      +  + G TPLH +   G  D  + L+   AN N   K G  P   AV  N
Sbjct:  124 VAELINYGANVN-AQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDG----FTPLAVALQQGHENVVALLINYGT--------KGKVRLPALHIAARNDDTRTAAVLLQNDP---NPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVN----FTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKT----KDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQ----YNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANA--RALN--GFTPLHIACKKNHMRSMDLLLKHSASLEAVTES-GLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLL----------QNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATT----AGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHN 613          

HSP 3 Score: 145.591 bits (366), Expect = 2.068e-34
Identity = 168/718 (23.40%), Postives = 321/718 (44.71%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYG-------------ANINENVCFDLVLSN------VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCD-----KNAVNAINESG------LILSAIKKNPEI----------------------MKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYL-IYALQYGNEIDVVR-VLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSN-----------IHLRSRLGQGEEV------------------LPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMA-GADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAV 3141
            +++++  L+ +  N+N  + K  S L++A Q N L +V  LL  G++ ++      T L  ++Q+ H+ +  LLINYG             A  ++     ++L N      +  T    +H+A  Y +    Q L+++GAN+  T         +  +T LH+A   +  ++  +  LL+ G  I++KT    TP   A R   +    +LL +G       KN ++ I+ +        +   ++ N EI                      +K LL     +N +   G T LH +  ++    +D  +  S ++              +SG   ++   +   +++V+ +L++ A P+     ++   TP+ +A           L+++ A ++  +  +Q T LH A R  +  + K L+   +N           +H+ +R G  +                     P+HVA + G  +++E+LL  G++ N+         + PLH+A  ++    VK L    S   + +ST  + + AL  + +K+N + V S L+  GA+ + + +    +  T LH+A+Q G  ++V LL+   A+    +  G+++G+ P+HL  + GH+ I  +    G SV AA   G T LH A + G++ +++ LL+  A VN++     R    P+H A+++GH   V LLL++G+  N +
Sbjct:  120 QEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTP--------KNGITPLHIAS--RRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVT----------ESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQ-TPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAA----GKNGLTPLHVAVHHNNLDVVKLLV---SKGGSPHSTARNGYTAL-HIAAKQNQLEVASSLLQYGANANSESL----QGITPLHLASQEGQPDMVALLISKQAN----VNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSK----TRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEI 796          

HSP 4 Score: 116.701 bits (291), Expect = 1.132e-25
Identity = 148/610 (24.26%), Postives = 265/610 (43.44%), Query Frame = 1
Query: 1258 ILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENV-----------------C------FDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNA---VNAINESGLILSAIKKNPEIMKFLLQN--QVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            +LL    N+N T     + L +A +   + +V  LL RG+  +      +T L  + +  H ++ E+L++ GA +                     C      ++  + ++ L +   +HVA         + L+DKGA         + R +    T LH+A   K N +  ++ LL+   ++E+ T  G TP   A     +     LL RG   N+    +   E+ L ++A   + E+ +FLLQN  QVD+  KD+   T LH +     R+G    +     + +    + DS+ +     L  A + G+      +L + A    +        TP+ +A +   +  +  L+  GAN N  +  N  T LHVA+ + N+ + K L+  G + H  +R G       +H+A +    E+   LL +G++ NS    +S++ + PLHLA+       V  L  +Q+   N+N    +    L  LV++   +G+  +L+      G  + + SR   T LH+A   G+ ++V+ LL+  A     + +  R G  P+H A + GH +IV L    G   +     G + L  A   G + ++++L
Sbjct:  254 LLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKA-------NARAL-NGFTPLHIAC--KKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQ--TPLHCAA----RMGHKELV----KLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKM---TKKGFTPLHVACKYGKVDVVELLLERGANPN-AAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNG----YTALHIAAKQNQLEVASSLLQYGANANS----ESLQGITPLHLASQEGQPDMVALLISKQA---NVNLGNKNGLTPL-HLVAQEGHVGIADMLVK----QGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQA----HVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 819          

HSP 5 Score: 114.005 bits (284), Expect = 7.926e-25
Identity = 112/387 (28.94%), Postives = 183/387 (47.29%), Query Frame = 1
Query: 2698 VSGKCIVSRSRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQ-RGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLI--GLKANVNIIDKIGKKPKDYAVTANLM 3846
            +S  C    S+N    LH+A++ G  ++V  LL  G D    + T  + G   +H+A  +G  ++V    ++G +V+A    G + L+ AA    +++++ LL+ GA+ +    DG      P+ +A ++GH+  V LL+ YG+          +  L AL+IA   +       L+++  NPD+  +  G TPLHI       + A + L   AN  +N     GI+ LH+ + +G+  +   LL      +   QI      KT   ++PL+ A   GH+ VV++L+  GA +  A+T     G+ PIH AA       +  LL+    ID+   D LTPLH +   G +   K L+  G KAN   ++  G  P   A   N M
Sbjct:   63 LSASCFFLYSQNGLNGLHLASKEGHVKMVLELLHNGID----LETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDG----FTPLAVALQQGHENVVALLINYGTK--------GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL-SKTGFTPLHIAAHYENLSVAQLLLNRGAN--VNFTPKNGITPLHIASRRGNVIMVRLLL------DRGAQI----DAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQ-AKT---KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALN--GFTPLHIACKKNHM 414          

HSP 6 Score: 111.694 bits (278), Expect = 4.197e-24
Identity = 92/322 (28.57%), Postives = 146/322 (45.34%), Query Frame = 1
Query: 2941 GLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF*LSMCFFERLFYKFSCD 3906
            GL  LH A+  G V ++  LL  G D+      GN +    +H+A+  G +K V  L+ YG+ +NA     ++   + LY+A  EN   V+KYL++ GAN  +   + G TPL +  Q+G    +  LI              + +LH+ A       +  LL+   NP++          KT +  +PL+ A  + +L+V +LL+  GA+++    F    GI P+H A+ RG   ++  LL+ G  ID   +D LTPLH +   G     + L+   A +    K G  P   A   + M       C  + L Y    D
Sbjct:   75 GLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTA----LHIAALAGQEKVVAELINYGANVNA----QSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTED-GFTPLAVALQQGHENVVALLINYGTKG-----KVRLPALHIAARNDDTRTAAVLLQNDPNPDVL--------SKTGF--TPLHIAAHYENLSVAQLLLNRGANVN----FTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMD------CVRQLLQYNAEID 362          

HSP 7 Score: 56.9954 bits (136), Expect = 2.402e-16
Identity = 58/218 (26.61%), Postives = 92/218 (42.20%), Query Frame = 2
Query:  179 LLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINF-PCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFN--ISDTYVLLD-----------AWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            LL       +L K G++ LH A    ++ +AQ L+N    N+NF P N        + P+HIA   G   ++++LL R    +      K EL           P+ C   N  +    +LLD             +P+H+    DH+DC++ L+Q  A++       +   T L +A        V VLL+ GA  N   ++  +PL  A K+   R
Sbjct:  222 LLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRG-ANVNFTPKN-------GITPLHIASRRGNVIMVRLLLDRGAQID---AKTKDELT----------PLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMR 415          

HSP 8 Score: 50.0618 bits (118), Expect = 2.402e-16
Identity = 83/397 (20.91%), Postives = 150/397 (37.78%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANP--RIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHI----KKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQ 1989
            +GH  IV+ LL+ GA+P   I +  +  TPLH +  + + +     +Q                   N  Q++    +             D    +C      K++  LL E+K + +S  T          H  L I  +       +   ILL       +   K  + L +A +   + +V  LL RG++PN      +T L  ++   +  + +LL++ G + +          +       ++H+A   +  E    L+  GAN           E    +T LHLA   +    + +  L+    N+      G TP     +   +   ++L+ +G    A + +  + L ++    N +++KFLLQ Q   N K   G T LH +  Q
Sbjct:  444 MGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQ-------------------NNAQVDAKAKD-------------DQTPLHCAARMGHKELVKLLMEHKANPDSATTAG--------HTPLHIAAREGH---AQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPH----------STARNGYTALHIAAKQNQLEVASSLLQYGANA--------NSESLQGITPLHLAS--QEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQ 777          

HSP 9 Score: 51.6026 bits (122), Expect = 4.874e-7
Identity = 45/191 (23.56%), Postives = 77/191 (40.31%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLI-QEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 784
            + G++ LH A   N +++A  L+ +         N+ S  L  + P+H+A + G+  ++ +L+ +  N  L  +                                 +   PLHLV    H+    ML+ Q A V+  SR      T L +AC    ++ V  LL+  A+ N       +PL  AA++G T
Sbjct:  633 RNGYTALHIAAKQNQLEVASSLLQYG-------ANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNK---------------------------------NGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGY---TPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHT 780          

HSP 10 Score: 23.483 bits (49), Expect = 4.874e-7
Identity = 10/16 (62.50%), Postives = 12/16 (75.00%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANP 867
            GH  IV +LLK+GA P
Sbjct:  778 GHTDIVTLLLKHGALP 793          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 192.971 bits (489), Expect = 3.144e-49
Identity = 190/734 (25.89%), Postives = 329/734 (44.82%), Query Frame = 1
Query: 1717 LLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVR----VLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYG-----------SPI------------------NAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHK-GIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LL  G+++E+ T KG+T    A    + +    L+  G + NA +    S L ++A + + E++K+LL++  + +     G T L  +  Q     +   I+  T                K    + AL      D  R    +L+   +PD++   +    TP+ +A    ++S    L+  GAN+N+    N  T LH+A R  N+ + + L+  G+ I  +++    +E+ P+H A +NG   ++EILL  G+ L +    K+   ++P+H+AA  D    V+ L    +    I+    D    L       +   V+ +L  GA  + + +       T LHIA +      + LLL++ A     +      G+ P+H+A   GHL IVK     G S +A+     T LH AA AG  ++ + LL+  A V+A+A D       P+H A+  GHK+ VKLL+E+            +P+                  NA  +++ +   T L++A    + +V++ L++ GANP+    N G TPLH+         +  L+    S  +   N G ++LH+ A++   E++  LL+   N N           ++   I+PL+ A   G   +V LL+   A+++      G+K G+ P+H  A  G   +   L++ G S+      G TPLH +   G     KFL+  +A+VN   ++G  P
Sbjct:    5 LLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGT----------------KGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL---SKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK-NGITPLHIASRRGNVIMVRLLLDRGAQIDAKTK----DELTPLHCAARNGHVRVVEILLDQGAPLQA----KTKNGLSPIHMAAQGDHMDCVRQLLQYNA---EIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARAL----NGFTPLHIACKKNHMRSMDLLLKHSAS----LEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKD----DQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKN-GLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARN-GYTALHIAAKQNQLEVASSLLQYGANAN----------SESLQGITPLHLASQEGQPDMVALLISKQANVNL-----GNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTP 678          

HSP 2 Score: 189.889 bits (481), Expect = 2.793e-48
Identity = 199/777 (25.61%), Postives = 353/777 (45.43%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAG-----SNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLL 3555
            +++++  L+ +  N+N  + K  S L++A Q N L +V  LL  G++ ++      T L  ++Q+ H+ +  LLINYG               V+L    ++H+A    D  T   L+    N     D+L     +T  T LH+A   +  +L+    LL  G N+      G TP   A R   +    LLL RG   +A      + L  +A   +  +++ LL        K   GL+ +H +   D    +   +      + A+IDD    H      L  A   G+   V  +L + A  +   ++     TP+ +A + N + +M  L++H A+L  ++  +  T LHVA    ++ I K L+  G     SN+ + +         P+H+A + G  E+ + LL   + +++    K+ +   PLH AA       VK L   ++   N +S  + + +  L + ++        +L+   D + +      +  T LH+A + G  ++V+LLLE GA+P A      ++G+ P+H+A    +L++VKL    G S  +    G T LH AA    +++   LL+ GA+ N+E+  G    + P+H+AS++G    V LL+   + +N      N++ LT L++   E    +   L+K GA+     + +G TPLH+ C  G  K + +L+    + +N     G + LH  A++GH ++   LL+    PN          + T+   SPL  A   G+++V+ +L
Sbjct:   31 QEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----------GKVRL---PALHIAARNDDTRTAAVLLQNDPN----PDVLS----KTGFTPLHIAAHYE--NLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQ-----YNAEIDDITLDHLTP---LHVAAHCGHHRMVKVLLDKGAKANARALNG---FTPLHIACKKNHMRSMDLLLKHSASLEAVTE-SGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVET---------PLHMAARAGHCEVAQFLLQNNAQVDA----KAKDDQTPLHCAARMGHKELVKLLMEHKA---NPDSA-TTAGHTPLHIAAREGHAQTTRILL---DENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNA----AGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQG----ITPLHLASQEGQPDMVALLISKQANVNLG----NKNGLTPLHLVAQEGHVGIADMLVKQGAS-VYAASRMGYTPLHVACHYGNIKMVKFLLQ-QQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPN----------EITTNGTSPLGIAKRLGYISVIDVL 727          

HSP 3 Score: 178.333 bits (451), Expect = 9.497e-45
Identity = 200/794 (25.19%), Postives = 338/794 (42.57%), Query Frame = 1
Query: 1408 TSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLT-------------------VDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQN--QVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQ--AADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            T+L  +     +K+   LINYGAN+N                 + +++A   +  E  ++L++ GAN  L                    V LL     +  V L  L I  +++       LL+   N +  +  G TP   A  Y  +    LLL RG + N       + L +++ + N  +++ LL    Q+D+  KD   LT L H   ++  + +   + D      AK  +  S         I+    G+ +D VR L Q  A   D+   H    +TP+ +A        +  L+  GA  N   + N  T LH+A +  ++     L+   +++   +  G    + P+HVA   G   I++ LL  G+S N++    +V+   PLH+AA        +FL                                    L   A V  K       + T LH AA++G  E+V+LL+E+ A+P +    G      P+H+A   GH +  ++  D     +     G T LH A   G VD++E+LL+ GA+ NA   +G    + P+H+A    +   VKLL+  G   ++      R+  TAL+IA  +N+  V   L++ GAN +  E+  G TPLH+  Q G    +  LI    +++N+    G++ LHL A++GH  ++  L++             S    +    +PL+ AC +G++ +VK L++  A ++         G  P+H AA +G   ++  LL+ G   +E   +G +PL
Sbjct:   21 TALHIAALAGQEKVVAELINYGANVNAQ----------SQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDE--LTPL-HCAARNGHVRVVEILLDQGAPLQAKTKNGLSP--------IHMAAQGDHMDCVRQLLQYNAEIDDITLDH----LTPLHVAAHCGHHRMVKVLLDKGAKAN-ARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESG----LTPLHVAAFMGHLNIVKSLLQRGASPNAS----NVKVETPLHMAARAGHCEVAQFL------------------------------------LQNNAQVDAKA----KDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGH----TPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNG----LTPLHVAVHHNNLDVVKLLVSKGGSPHSTA----RNGYTALHIAAKQNQLEVASSLLQYGANAN-SESLQGITPLHLASQEGQPDMVALLIS-KQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGA----------SVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRL----GYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPL 712          

HSP 4 Score: 168.703 bits (426), Expect = 9.975e-42
Identity = 158/537 (29.42%), Postives = 248/537 (46.18%), Query Frame = 1
Query: 2236 MCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI--GIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            +  LI +GAN+N  S     + L++A +  ++ + K L+  G+N  L +  G      P+ VA+Q G + ++ +L+ +G+        K   R+  LH+AA ND T T   L        N +      F  L       N+   Q +L  GA+V+     +     T LHIA++ G+  +V+LLL+ GA   A+     +D + P+H A  +GH+ +V++  D G  + A    GL+ +H AA    +D +  LL+     NAE  D     + P+H+A+  GH + VK+LL+ G+  NA    LN    T L+IA  +N    M  L+K  A+ +    + G TPLH+    G    +  L+  G + ++ NV + T    LH+ A  GH E++ +LL          Q       K   + +PL+ A   GH  +VKLL++  A+   A T     G  P+H AA  G       LL+      +  + G TPLH +   G  D  + L+   AN N   K G  P   AV  N
Sbjct:   35 VAELINYGANVNAQSQ-KGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDG----FTPLAVALQQGHENVVALLINYGT--------KGKVRLPALHIAARNDDTRTAAVLLQNDP---NPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVN----FTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKT----KDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQ----YNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANA--RALN--GFTPLHIACKKNHMRSMDLLLKHSASLEAVTES-GLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVET---PLHMAARAGHCEVAQFLL----------QNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATT----AGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHN 521          

HSP 5 Score: 102.064 bits (253), Expect = 2.906e-21
Identity = 86/303 (28.38%), Postives = 134/303 (44.22%), Query Frame = 1
Query: 2998 LLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF*LSMCFFERLFYKFSCD 3906
            LL  G D+      GN +    +H+A+  G +K V  L+ YG+ +NA     ++   + LY+A  EN   V+KYL++ GAN  +   + G TPL +  Q+G    +  LI              + +LH+ A       +  LL+   NP       D  SK      +PL+ A  + +L+V +LL+  GA+++    F    GI P+H A+ RG   ++  LL+ G  ID   +D LTPLH +   G     + L+   A +    K G  P   A   + M       C  + L Y    D
Sbjct:    5 LLHNGIDLETTTKKGNTA----LHIAALAGQEKVVAELINYGANVNA----QSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTED-GFTPLAVALQQGHENVVALLINYGTKG-----KVRLPALHIAARNDDTRTAAVLLQNDPNP-------DVLSKT---GFTPLHIAAHYENLSVAQLLLNRGANVN----FTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMD------CVRQLLQYNAEID 273          

HSP 6 Score: 56.9954 bits (136), Expect = 1.400e-16
Identity = 58/218 (26.61%), Postives = 92/218 (42.20%), Query Frame = 2
Query:  179 LLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINF-PCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFN--ISDTYVLLD-----------AWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            LL       +L K G++ LH A    ++ +AQ L+N    N+NF P N        + P+HIA   G   ++++LL R    +      K EL           P+ C   N  +    +LLD             +P+H+    DH+DC++ L+Q  A++       +   T L +A        V VLL+ GA  N   ++  +PL  A K+   R
Sbjct:  133 LLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRG-ANVNFTPKNG-------ITPLHIASRRGNVIMVRLLLDRGAQID---AKTKDELT----------PLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMR 326          

HSP 7 Score: 50.8322 bits (120), Expect = 1.400e-16
Identity = 82/395 (20.76%), Postives = 149/395 (37.72%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHI----KKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQ 1989
            +GH  IV+ LL+ GA+P     + + TPLH +  + + +     +Q                   N  Q++    +             D    +C      K++  LL E+K + +S  T          H  L I  +       +   ILL       +   K  + L +A +   + +V  LL RG++PN      +T L  ++   +  + +LL++ G + +          +       ++H+A   +  E    L+  GAN           E    +T LHLA   +    + +  L+    N+      G TP     +   +   ++L+ +G    A + +  + L ++    N +++KFLLQ Q   N K   G T LH +  Q
Sbjct:  355 MGHLNIVKSLLQRGASPNASNVKVE-TPLHMAARAGHCEVAQFLLQ-------------------NNAQVDAKAKD-------------DQTPLHCAARMGHKELVKLLMEHKANPDSATTAG--------HTPLHIAAREGH---AQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPH----------STARNGYTALHIAAKQNQLEVASSLLQYGANA--------NSESLQGITPLHLAS--QEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQ 685          

HSP 8 Score: 51.6026 bits (122), Expect = 5.765e-7
Identity = 45/191 (23.56%), Postives = 78/191 (40.84%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLI-QEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 784
            + G++ LH A   N +++A  L+        +  N+ S  L  + P+H+A + G+  ++ +L+ +  N                              N+ +     +   PLHLV    H+    ML+ Q A V+  SR      T L +AC    ++ V  LL+  A+ N       +PL  AA++G T
Sbjct:  541 RNGYTALHIAAKQNQLEVASSLLQ-------YGANANSESLQGITPLHLASQEGQPDMVALLISKQAN-----------------------------VNLGNK----NGLTPLHLVAQEGHVGIADMLVKQGASVYAASRM---GYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHT 688          

HSP 9 Score: 23.483 bits (49), Expect = 5.765e-7
Identity = 10/16 (62.50%), Postives = 12/16 (75.00%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANP 867
            GH  IV +LLK+GA P
Sbjct:  686 GHTDIVTLLLKHGALP 701          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 206.838 bits (525), Expect = 3.942e-53
Identity = 184/729 (25.24%), Postives = 331/729 (45.40%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSL 3852
            LHLA   K   +  ++ L++ G ++++ T KG+T    A    + E   +L+  G + NA +    + L ++A + + E++KFLL N    +     G T L  +  Q          HD     ++ + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +I+    L+  GA +++ +  N  T LHVA +  N  + K L+  GS I  ++R G    + P+H   ++G ++++ +LL  G+ + S    K+   ++PLH+A   D  + V+ L       +  N    D  N  LT                                  LH+AA  G +++ ++LL+  A+P A+ +    +G  P+H+A +   L++++L    G S+ A  + GLT +H AA  G V+I+  L   GA  N     G  +    +HMA+  G  + V+ LL+ G+ + A      +D+ T L+I+    + ++++ L+K GA PD    + G TPLH++ + G       L+    +S  +    G + LH+ A+ G  E+   LL+   +P+  G+            ++PL+ A  + +  V  LL+  GA  H A       G  P+H AA + +  +  TLLE G   +   + G+ P+H +  EG  D    L+   ANVN+ +K G  P   A   + +S+
Sbjct:   61 LHLAS--KEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQG---------HDQ---VVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNAD---VESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTAR-NDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDG----LTPLHCGARSGHEQVVGMLLDRGAPILS----KTKNGLSPLHMATQGDHLNCVQLL-------LQHNVPVDDVTNDYLT---------------------------------ALHVAAHCGHYKVAKVLLDKKANPNAKAL----NGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETA----LHMAARAGQSEVVRFLLQNGAQVEAKA----KDDQTPLHISARLGKADIVQQLLKQGAYPDAATTS-GYTPLHLSSREGHDDVASVLLE-HGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGK----------SGLTPLHVAAHYDNQKVALLLLDKGASPHGA----AKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSV 695          

HSP 2 Score: 183.341 bits (464), Expect = 6.958e-46
Identity = 199/815 (24.42%), Postives = 375/815 (46.01%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH----------HSFIQDFRIGIDYFIH-DSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYG-SPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D NI     + +L  + ++ H ++   LI  GA+++         ++ K  N A +H+A +    E  + L+  GAN+          + +   T L++A   + N L  + FLL+ G +    T  G TP   A++    +  +LLL    + +    +    L ++A K + +    LLQN  +++ +   G T LH           + + +    +D+    D T + +A    N       +  +   L  G++ID                    VV +L     P L    N   ++P+ +A + + ++ +  L++H   ++ +++ +  T LHVA    +  +AK L+   +N + ++  G      P+H+A +    +++E+LL  G+S+ +     +   + P+H+AA     + V  L H   AS N  + R ++   +     +  V  V+ +L  GA V  K       + T LHI+A++G  +IVQ LL+ GA P A   +G      P+HL++  GH ++  +  + G S       G T LH AA  G ++++++LL+  A  +A      +S + P+H+A+   ++K   LLL+ G SP  A      ++  T L+IA  +N+ ++   L++ GA+ +      G  P+H+  Q G    +  L+   ++++NV   +G++ LHL A++    ++  L          G + D  +K      +PL+ A  +G++ +V  L++ G+ ++ A+T  G+    P+H AA +G  H+I  LL+ G S +E   +G T L
Sbjct:   47 GVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVD---------ASTKKGNTA-LHIASLAGQTEVVRVLVTNGANV--------NAQSQNGFTPLYMAA--QENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGN-------ANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNG--LSPLHMATQGDHLNCVQLLLQHNVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNG----FTPLHIACKKNRLKVMELLLKHGASIQAV----TESGLTPIHVAAFMGHVNIVSQLNHH-GASPNTTNVRGETALHMAARAGQSEV--VRFLLQNGAQVEAKA----KDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSG----YTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDA----AGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAA-----KNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQ-GIAPVHLAAQEGHVDMVSLLL-TRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLAN-------QGAVIDGTTK---MFYTPLHVASHYGNIKMVTFLLQHGSKVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTAL 783          

HSP 3 Score: 156.762 bits (395), Expect = 1.008e-37
Identity = 188/737 (25.51%), Postives = 319/737 (43.28%), Query Frame = 1
Query: 1246 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNI-----------HLRSRLGQGEEV------------------LPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKML--PIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGF 3303
            E++ +L+ +  N+N  +    + L++A Q N L +V  LL  G+  ++      T L  ++Q+ H ++  LL+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++GA +  T           ++T LH+A   K  + N +  LL+ G  I++KT  G TP     R    +   +LL RG    +      S L ++    +   ++ LLQ+ V  +   N  LTALH        +      +    + + K   N ++ +L     ++     N + V+ +L K  A    V       +TPI +A  M  ++ +  L  HGA+ N  ++   ET LH+A R     + + L+  G+ +           H+ +RLG+ + V                   P+H++ + G D++  +LL  G+S      + + +   PLH+AA       VK L  + ++    ++        L       N      +L  GA   G          T LHIAA+    +I   LLEYGAD  A  IT  + GI PVHLA + GH+++V L      +V+ +   GLT LH AA    V + E+L   GA +     DG  +KM   P+H+AS  G+ K V  LL++GS +NA      ++  T L+ A  +   +++  L++ GA+P+    N G T L I  + G+
Sbjct:  104 EVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTA--------RNDITPLHVAS--KRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALH--------VAAHCGHYKVAKVLLDK-KANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAV---TESGLTPIHVAAFMGHVNIVSQLNHHGASPN-TTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFG----IVTKKGFTPLHVAAKYGKIEVVKLLLQKNASP---DAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAA----KNGYTPLHIAAKKNQMDIATTLLEYGAD--ANAIT--KQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVI-----DGT-TKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVN-GNTALAIARRLGY 791          

HSP 4 Score: 124.79 bits (312), Expect = 5.741e-28
Identity = 106/356 (29.78%), Postives = 181/356 (50.84%), Query Frame = 1
Query: 2731 NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIID 3798
            NA+ L  AA+ G+ E     L+ G D    +   +++G+  +HLA++ GH+EIV      G  V A+   G T LH A+ AG  +++ +L+  GA+VNA++ +G      P++MA+++ H + VK LL+ G    A  S    D  T L +A  +  + V+  L+++     ++   L A  LHI  ++  TKA   L+   + + +V   +G + LH+ A  G+  ++  LL      + T +           +I+PL+ A   G+  +VKLL+  G+ I  A+T +   G+ P+HC A  G   V+  LL+ G  I    ++GL+PLH +      +C + L  L+ NV + D
Sbjct:   25 NASYLR-AARSGNLEKALDYLKNGVD----INICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNG----FTPLYMAAQENHLEVVKFLLDNG----ASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR---LPA--LHIAARKDDTKAAALLLQ-NDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTAR----------NDITPLHVASKRGNANMVKLLLDRGSKID-AKTRD---GLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL--LQHNVPVDD 345          

HSP 5 Score: 40.4318 bits (93), Expect = 2.456e-8
Identity = 79/333 (23.72%), Postives = 129/333 (38.74%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLL 1818
            GHD +  VLL++GA+  I TK+   TPLH +     I+ +   +Q  K+A      KS                    L  L  A   D+       +K+  LL      ++   +  G +  NG   L +  KK Q     ++   LL +  + N    +  + + LA Q   + +VS LL R ++ N+     +T L  + Q+    + E+L N GA          V+          +HVA  Y + +   FL+  G+ +          + +   T LH A   +    + IN LL+ G +    T  G+T    A R   I   + L
Sbjct:  526 GHDDVASVLLEHGASFGIVTKK-GFTPLHVAAKYGKIEVVKLLLQ--KNASPDAAGKSG-------------------LTPLHVAAHYDN-------QKVALLL------LDKGASPHGAA-KNGYTPLHIAAKKNQM----DIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGA----------VIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKV--------NAKTKNGYTPLHQAA--QQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 798          

HSP 6 Score: 39.6614 bits (91), Expect = 2.456e-8
Identity = 46/198 (23.23%), Postives = 79/198 (39.90%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPE---------LCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            K G S LH A   +H++  Q L+ H     N P +  +     L  +H+A   G   + K+LL +  NP          L +   K+ L    +L K    I           V      P+H+     H++ +  L         + + +  +TAL +A    + E V  LL++GA        +++PL  +A+ G+
Sbjct:  315 KNGLSPLHMATQGDHLNCVQLLLQH-----NVPVDDVTNDY--LTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQA---------VTESGLTPIHVAAFMGHVNIVSQLNHHGAS--PNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGK 494          

HSP 7 Score: 58.151 bits (139), Expect = 1.265e-7
Identity = 46/199 (23.12%), Postives = 90/199 (45.23%), Query Frame = 2
Query:  218 AGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGL---HNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSEL----------IEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALI-LACELCRLETVNVLLESGANPNVCDISNKSPLFYAAK 772
            +G++ LH +    H D+A  L+ H            S G+       P+H+A ++G+  ++K+LLQ+N +P+   +   + L          +  ++L K + P    K          + + PLH+    + +D    L++      ++ +I  +  A + LA +   ++ V++LL   AN NV + S  +PL  AA+
Sbjct:  514 SGYTPLHLSSREGHDDVASVLLEHG----------ASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAK----------NGYTPLHIAAKKNQMDIATTLLEYG---ADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQ 689          

HSP 8 Score: 57.7658 bits (138), Expect = 1.629e-7
Identity = 49/197 (24.87%), Postives = 93/197 (47.21%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKR 775
            K+G++ LH A    ++++A  L+N     ++F         +++ P+H+A + G  +++K+LL R           + P  C      E +  ++L + + PI  +  N           +PLH+    DHL+C+++L+Q   V ++  +     TAL +A      +   VLL+  ANPN   ++  +PL  A K+
Sbjct:  216 KSGFTPLHIAAHYGNINVATLLLNRGAA-VDFTAR------NDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGA-PILSKTKN---------GLSPLHMATQGDHLNCVQLLLQH-NVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKK 393          

HSP 9 Score: 53.9138 bits (128), Expect = 2.460e-6
Identity = 44/194 (22.68%), Postives = 90/194 (46.39%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDA-----WNPLHLVVIHDHLDCLKMLIQEA-KVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            K G++ LH A   N +DIA  L+        +  ++ +I    + P+H+A + G   ++ +LL R+ N    + V     + P+ L+     +   +  +++   ++D      + PLH+   + ++  +  L+Q   KV  ++++     T L  A +      +NVLL+ GA+PN   ++  + L  A + G
Sbjct:  612 KNGYTPLHIAAKKNQMDIATTLLE-------YGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSAN----VNVSNKSGLTPLHLAAQEDRVSVAEV-LANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGY---TPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLG 790          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 206.838 bits (525), Expect = 4.704e-53
Identity = 184/729 (25.24%), Postives = 331/729 (45.40%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSL 3852
            LHLA   K   +  ++ L++ G ++++ T KG+T    A    + E   +L+  G + NA +    + L ++A + + E++KFLL N    +     G T L  +  Q          HD     ++ + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +I+    L+  GA +++ +  N  T LHVA +  N  + K L+  GS I  ++R G    + P+H   ++G ++++ +LL  G+ + S    K+   ++PLH+A   D  + V+ L       +  N    D  N  LT                                  LH+AA  G +++ ++LL+  A+P A+ +    +G  P+H+A +   L++++L    G S+ A  + GLT +H AA  G V+I+  L   GA  N     G  +    +HMA+  G  + V+ LL+ G+ + A      +D+ T L+I+    + ++++ L+K GA PD    + G TPLH++ + G       L+    +S  +    G + LH+ A+ G  E+   LL+   +P+  G+            ++PL+ A  + +  V  LL+  GA  H A       G  P+H AA + +  +  TLLE G   +   + G+ P+H +  EG  D    L+   ANVN+ +K G  P   A   + +S+
Sbjct:   52 LHLAS--KEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQG---------HDQ---VVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNAD---VESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTAR-NDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDG----LTPLHCGARSGHEQVVGMLLDRGAPILS----KTKNGLSPLHMATQGDHLNCVQLL-------LQHNVPVDDVTNDYLT---------------------------------ALHVAAHCGHYKVAKVLLDKKANPNAKAL----NGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETA----LHMAARAGQSEVVRFLLQNGAQVEAKA----KDDQTPLHISARLGKADIVQQLLKQGAYPDAATTS-GYTPLHLSSREGHDDVASVLLE-HGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGK----------SGLTPLHVAAHYDNQKVALLLLDKGASPHGA----AKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSV 686          

HSP 2 Score: 183.341 bits (464), Expect = 8.055e-46
Identity = 199/815 (24.42%), Postives = 375/815 (46.01%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH----------HSFIQDFRIGIDYFIH-DSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYG-SPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D NI     + +L  + ++ H ++   LI  GA+++         ++ K  N A +H+A +    E  + L+  GAN+          + +   T L++A   + N L  + FLL+ G +    T  G TP   A++    +  +LLL    + +    +    L ++A K + +    LLQN  +++ +   G T LH           + + +    +D+    D T + +A    N       +  +   L  G++ID                    VV +L     P L    N   ++P+ +A + + ++ +  L++H   ++ +++ +  T LHVA    +  +AK L+   +N + ++  G      P+H+A +    +++E+LL  G+S+ +     +   + P+H+AA     + V  L H   AS N  + R ++   +     +  V  V+ +L  GA V  K       + T LHI+A++G  +IVQ LL+ GA P A   +G      P+HL++  GH ++  +  + G S       G T LH AA  G ++++++LL+  A  +A      +S + P+H+A+   ++K   LLL+ G SP  A      ++  T L+IA  +N+ ++   L++ GA+ +      G  P+H+  Q G    +  L+   ++++NV   +G++ LHL A++    ++  L          G + D  +K      +PL+ A  +G++ +V  L++ G+ ++ A+T  G+    P+H AA +G  H+I  LL+ G S +E   +G T L
Sbjct:   38 GVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVD---------ASTKKGNTA-LHIASLAGQTEVVRVLVTNGANV--------NAQSQNGFTPLYMAA--QENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGN-------ANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNG--LSPLHMATQGDHLNCVQLLLQHNVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNG----FTPLHIACKKNRLKVMELLLKHGASIQAV----TESGLTPIHVAAFMGHVNIVSQLNHH-GASPNTTNVRGETALHMAARAGQSEV--VRFLLQNGAQVEAKA----KDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSG----YTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDA----AGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAA-----KNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQ-GIAPVHLAAQEGHVDMVSLLL-TRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLAN-------QGAVIDGTTK---MFYTPLHVASHYGNIKMVTFLLQHGSKVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTAL 774          

HSP 3 Score: 157.147 bits (396), Expect = 7.470e-38
Identity = 190/754 (25.20%), Postives = 325/754 (43.10%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNI-----------HLRSRLGQGEEV------------------LPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKML--PIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSL 3348
            + E++ +L+ +  N+N  +    + L++A Q N L +V  LL  G+  ++      T L  ++Q+ H ++  LL+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++GA +  T           ++T LH+A   K  + N +  LL+ G  I++KT  G TP     R    +   +LL RG    +      S L ++    +   ++ LLQ+ V  +   N  LTALH        +      +    + + K   N ++ +L     ++     N + V+ +L K  A    V       +TPI +A  M  ++ +  L  HGA+ N  ++   ET LH+A R     + + L+  G+ +           H+ +RLG+ + V                   P+H++ + G D++  +LL  G+S      + + +   PLH+AA       VK L  + ++    ++        L       N      +L  GA   G          T LHIAA+    +I   LLEYGAD  A  IT  + GI PVHLA + GH+++V L      +V+ +   GLT LH AA    V + E+L   GA +     DG  +KM   P+H+AS  G+ K V  LL++GS +NA      ++  T L+ A  +   +++  L++ GA+P+    N G T L I  + G+   +  L  +   +L
Sbjct:   93 QTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTA--------RNDITPLHVAS--KRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALH--------VAAHCGHYKVAKVLLDK-KANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAV---TESGLTPIHVAAFMGHVNIVSQLNHHGASPN-TTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFG----IVTKKGFTPLHVAAKYGKIEVVKLLLQKNASP---DAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAA----KNGYTPLHIAAKKNQMDIATTLLEYGAD--ANAIT--KQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVI-----DGT-TKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVN-GNTALAIARRLGYISVVDTLKVVTEETL 797          

HSP 4 Score: 127.102 bits (318), Expect = 1.142e-28
Identity = 106/365 (29.04%), Postives = 182/365 (49.86%), Query Frame = 1
Query: 2704 GKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIID 3798
            G C+  +S        AA+ G+ E     L+ G D    +   +++G+  +HLA++ GH+EIV      G  V A+   G T LH A+ AG  +++ +L+  GA+VNA++ +G      P++MA+++ H + VK LL+ G    A  S    D  T L +A  +  + V+  L+++     ++   L A  LHI  ++  TKA   L+   + + +V   +G + LH+ A  G+  ++  LL      + T +           +I+PL+ A   G+  +VKLL+  G+ I  A+T +   G+ P+HC A  G   V+  LL+ G  I    ++GL+PLH +      +C + L  L+ NV + D
Sbjct:    6 GDCLSDQSDTNASYLRAARSGNLEKALDYLKNGVD----INICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNG----FTPLYMAAQENHLEVVKFLLDNG----ASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR---LPA--LHIAARKDDTKAAALLLQ-NDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTAR----------NDITPLHVASKRGNANMVKLLLDRGSKID-AKTRD---GLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL--LQHNVPVDD 336          

HSP 5 Score: 40.817 bits (94), Expect = 2.264e-8
Identity = 79/333 (23.72%), Postives = 129/333 (38.74%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLL 1818
            GHD +  VLL++GA+  I TK+   TPLH +     I+ +   +Q  K+A      KS                    L  L  A   D+       +K+  LL      ++   +  G +  NG   L +  KK Q     ++   LL +  + N    +  + + LA Q   + +VS LL R ++ N+     +T L  + Q+    + E+L N GA          V+          +HVA  Y + +   FL+  G+ +          + +   T LH A   +    + IN LL+ G +    T  G+T    A R   I   + L
Sbjct:  517 GHDDVASVLLEHGASFGIVTKK-GFTPLHVAAKYGKIEVVKLLLQ--KNASPDAAGKSG-------------------LTPLHVAAHYDN-------QKVALLL------LDKGASPHGAA-KNGYTPLHIAAKKNQM----DIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGA----------VIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKV--------NAKTKNGYTPLHQAA--QQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 789          

HSP 6 Score: 39.6614 bits (91), Expect = 2.264e-8
Identity = 46/198 (23.23%), Postives = 79/198 (39.90%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPE---------LCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            K G S LH A   +H++  Q L+ H     N P +  +     L  +H+A   G   + K+LL +  NP          L +   K+ L    +L K    I           V      P+H+     H++ +  L         + + +  +TAL +A    + E V  LL++GA        +++PL  +A+ G+
Sbjct:  306 KNGLSPLHMATQGDHLNCVQLLLQH-----NVPVDDVTNDY--LTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQA---------VTESGLTPIHVAAFMGHVNIVSQLNHHGAS--PNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGK 485          

HSP 7 Score: 58.151 bits (139), Expect = 1.392e-7
Identity = 46/199 (23.12%), Postives = 90/199 (45.23%), Query Frame = 2
Query:  218 AGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGL---HNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSEL----------IEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALI-LACELCRLETVNVLLESGANPNVCDISNKSPLFYAAK 772
            +G++ LH +    H D+A  L+ H            S G+       P+H+A ++G+  ++K+LLQ+N +P+   +   + L          +  ++L K + P    K          + + PLH+    + +D    L++      ++ +I  +  A + LA +   ++ V++LL   AN NV + S  +PL  AA+
Sbjct:  505 SGYTPLHLSSREGHDDVASVLLEHG----------ASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAK----------NGYTPLHIAAKKNQMDIATTLLEYG---ADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQ 680          

HSP 8 Score: 57.7658 bits (138), Expect = 1.648e-7
Identity = 49/197 (24.87%), Postives = 93/197 (47.21%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKR 775
            K+G++ LH A    ++++A  L+N     ++F         +++ P+H+A + G  +++K+LL R           + P  C      E +  ++L + + PI  +  N           +PLH+    DHL+C+++L+Q   V ++  +     TAL +A      +   VLL+  ANPN   ++  +PL  A K+
Sbjct:  207 KSGFTPLHIAAHYGNINVATLLLNRGAA-VDFTAR------NDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGA-PILSKTKN---------GLSPLHMATQGDHLNCVQLLLQH-NVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKK 384          

HSP 9 Score: 55.4546 bits (132), Expect = 9.681e-7
Identity = 51/214 (23.83%), Postives = 99/214 (46.26%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDA-----WNPLHLVVIHDHLDCLKMLIQEA-KVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETRESNSVVILFK*VTIQSL 838
            K G++ LH A   N +DIA  L+ +         ++ +I    + P+H+A + G   ++ +LL R+ N    + V     + P+ L+     +   +  +++   ++D      + PLH+   + ++  +  L+Q   KV  ++++     T L  A +      +NVLL+ GA+PN   ++  + L  A + G      SVV   K VT ++L
Sbjct:  603 KNGYTPLHIAAKKNQMDIATTLLEYG-------ADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSAN----VNVSNKSGLTPLHLAAQEDRVSVAEV-LANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGY---TPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYI----SVVDTLKVVTEETL 797          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 206.838 bits (525), Expect = 5.217e-53
Identity = 184/729 (25.24%), Postives = 331/729 (45.40%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSL 3852
            LHLA   K   +  ++ L++ G ++++ T KG+T    A    + E   +L+  G + NA +    + L ++A + + E++KFLL N    +     G T L  +  Q          HD     ++ + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +I+    L+  GA +++ +  N  T LHVA +  N  + K L+  GS I  ++R G    + P+H   ++G ++++ +LL  G+ + S    K+   ++PLH+A   D  + V+ L       +  N    D  N  LT                                  LH+AA  G +++ ++LL+  A+P A+ +    +G  P+H+A +   L++++L    G S+ A  + GLT +H AA  G V+I+  L   GA  N     G  +    +HMA+  G  + V+ LL+ G+ + A      +D+ T L+I+    + ++++ L+K GA PD    + G TPLH++ + G       L+    +S  +    G + LH+ A+ G  E+   LL+   +P+  G+            ++PL+ A  + +  V  LL+  GA  H A       G  P+H AA + +  +  TLLE G   +   + G+ P+H +  EG  D    L+   ANVN+ +K G  P   A   + +S+
Sbjct:   61 LHLAS--KEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQG---------HDQ---VVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNAD---VESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTAR-NDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDG----LTPLHCGARSGHEQVVGMLLDRGAPILS----KTKNGLSPLHMATQGDHLNCVQLL-------LQHNVPVDDVTNDYLT---------------------------------ALHVAAHCGHYKVAKVLLDKKANPNAKAL----NGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETA----LHMAARAGQSEVVRFLLQNGAQVEAKA----KDDQTPLHISARLGKADIVQQLLKQGAYPDAATTS-GYTPLHLSSREGHDDVASVLLE-HGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGK----------SGLTPLHVAAHYDNQKVALLLLDKGASPHGA----AKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSV 695          

HSP 2 Score: 182.956 bits (463), Expect = 1.006e-45
Identity = 199/815 (24.42%), Postives = 375/815 (46.01%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH----------HSFIQDFRIGIDYFIH-DSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYG-SPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D NI     + +L  + ++ H ++   LI  GA+++         ++ K  N A +H+A +    E  + L+  GAN+          + +   T L++A   + N L  + FLL+ G +    T  G TP   A++    +  +LLL    + +    +    L ++A K + +    LLQN  +++ +   G T LH           + + +    +D+    D T + +A    N       +  +   L  G++ID                    VV +L     P L    N   ++P+ +A + + ++ +  L++H   ++ +++ +  T LHVA    +  +AK L+   +N + ++  G      P+H+A +    +++E+LL  G+S+ +     +   + P+H+AA     + V  L H   AS N  + R ++   +     +  V  V+ +L  GA V  K       + T LHI+A++G  +IVQ LL+ GA P A   +G      P+HL++  GH ++  +  + G S       G T LH AA  G ++++++LL+  A  +A      +S + P+H+A+   ++K   LLL+ G SP  A      ++  T L+IA  +N+ ++   L++ GA+ +      G  P+H+  Q G    +  L+   ++++NV   +G++ LHL A++    ++  L          G + D  +K      +PL+ A  +G++ +V  L++ G+ ++ A+T  G+    P+H AA +G  H+I  LL+ G S +E   +G T L
Sbjct:   47 GVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVD---------ASTKKGNTA-LHIASLAGQTEVVRVLVTNGANV--------NAQSQNGFTPLYMAA--QENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGN-------ANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNG--LSPLHMATQGDHLNCVQLLLQHNVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNG----FTPLHIACKKNRLKVMELLLKHGASIQAV----TESGLTPIHVAAFMGHVNIVSQLNHH-GASPNTTNVRGETALHMAARAGQSEV--VRFLLQNGAQVEAKA----KDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSG----YTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDA----AGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAA-----KNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQ-GIAPVHLAAQEGHVDMVSLLL-TRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLAN-------QGAVIDGTTK---MFYTPLHVASHYGNIKMVTFLLQHGSKVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTAL 783          

HSP 3 Score: 157.147 bits (396), Expect = 8.067e-38
Identity = 190/752 (25.27%), Postives = 324/752 (43.09%), Query Frame = 1
Query: 1246 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNI-----------HLRSRLGQGEEV------------------LPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKML--PIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSL 3348
            E++ +L+ +  N+N  +    + L++A Q N L +V  LL  G+  ++      T L  ++Q+ H ++  LL+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++GA +  T           ++T LH+A   K  + N +  LL+ G  I++KT  G TP     R    +   +LL RG    +      S L ++    +   ++ LLQ+ V  +   N  LTALH        +      +    + + K   N ++ +L     ++     N + V+ +L K  A    V       +TPI +A  M  ++ +  L  HGA+ N  ++   ET LH+A R     + + L+  G+ +           H+ +RLG+ + V                   P+H++ + G D++  +LL  G+S      + + +   PLH+AA       VK L  + ++    ++        L       N      +L  GA   G          T LHIAA+    +I   LLEYGAD  A  IT  + GI PVHLA + GH+++V L      +V+ +   GLT LH AA    V + E+L   GA +     DG  +KM   P+H+AS  G+ K V  LL++GS +NA      ++  T L+ A  +   +++  L++ GA+P+    N G T L I  + G+   +  L  +   +L
Sbjct:  104 EVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTA--------RNDITPLHVAS--KRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALH--------VAAHCGHYKVAKVLLDK-KANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAV---TESGLTPIHVAAFMGHVNIVSQLNHHGASPN-TTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFG----IVTKKGFTPLHVAAKYGKIEVVKLLLQKNASP---DAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAA----KNGYTPLHIAAKKNQMDIATTLLEYGAD--ANAIT--KQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVI-----DGT-TKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVN-GNTALAIARRLGYISVVDTLKVVTEETL 806          

HSP 4 Score: 124.405 bits (311), Expect = 7.416e-28
Identity = 106/356 (29.78%), Postives = 181/356 (50.84%), Query Frame = 1
Query: 2731 NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIID 3798
            NA+ L  AA+ G+ E     L+ G D    +   +++G+  +HLA++ GH+EIV      G  V A+   G T LH A+ AG  +++ +L+  GA+VNA++ +G      P++MA+++ H + VK LL+ G    A  S    D  T L +A  +  + V+  L+++     ++   L A  LHI  ++  TKA   L+   + + +V   +G + LH+ A  G+  ++  LL      + T +           +I+PL+ A   G+  +VKLL+  G+ I  A+T +   G+ P+HC A  G   V+  LL+ G  I    ++GL+PLH +      +C + L  L+ NV + D
Sbjct:   25 NASYLR-AARSGNLEKALDYLKNGVD----INICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNG----FTPLYMAAQENHLEVVKFLLDNG----ASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR---LPA--LHIAARKDDTKAAALLLQ-NDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTAR----------NDITPLHVASKRGNANMVKLLLDRGSKID-AKTRD---GLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL--LQHNVPVDD 345          

HSP 5 Score: 40.4318 bits (93), Expect = 2.122e-8
Identity = 79/333 (23.72%), Postives = 129/333 (38.74%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLL 1818
            GHD +  VLL++GA+  I TK+   TPLH +     I+ +   +Q  K+A      KS                    L  L  A   D+       +K+  LL      ++   +  G +  NG   L +  KK Q     ++   LL +  + N    +  + + LA Q   + +VS LL R ++ N+     +T L  + Q+    + E+L N GA          V+          +HVA  Y + +   FL+  G+ +          + +   T LH A   +    + IN LL+ G +    T  G+T    A R   I   + L
Sbjct:  526 GHDDVASVLLEHGASFGIVTKK-GFTPLHVAAKYGKIEVVKLLLQ--KNASPDAAGKSG-------------------LTPLHVAAHYDN-------QKVALLL------LDKGASPHGAA-KNGYTPLHIAAKKNQM----DIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGA----------VIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKV--------NAKTKNGYTPLHQAA--QQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 798          

HSP 6 Score: 40.0466 bits (92), Expect = 2.122e-8
Identity = 46/198 (23.23%), Postives = 79/198 (39.90%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPE---------LCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            K G S LH A   +H++  Q L+ H     N P +  +     L  +H+A   G   + K+LL +  NP          L +   K+ L    +L K    I           V      P+H+     H++ +  L         + + +  +TAL +A    + E V  LL++GA        +++PL  +A+ G+
Sbjct:  315 KNGLSPLHMATQGDHLNCVQLLLQH-----NVPVDDVTNDY--LTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQA---------VTESGLTPIHVAAFMGHVNIVSQLNHHGAS--PNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGK 494          

HSP 7 Score: 58.5362 bits (140), Expect = 1.109e-7
Identity = 45/199 (22.61%), Postives = 90/199 (45.23%), Query Frame = 2
Query:  218 AGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGL---HNLRPIHIACEFGRTSILKMLLQRNVNPELCMEV----------IKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALI-LACELCRLETVNVLLESGANPNVCDISNKSPLFYAAK 772
            +G++ LH +    H D+A  L+ H            S G+       P+H+A ++G+  ++K+LLQ+N +P+   +             ++ +  ++L K + P    K          + + PLH+    + +D    L++      ++ +I  +  A + LA +   ++ V++LL   AN NV + S  +PL  AA+
Sbjct:  514 SGYTPLHLSSREGHDDVASVLLEHG----------ASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAK----------NGYTPLHIAAKKNQMDIATTLLEYG---ADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQ 689          

HSP 8 Score: 57.7658 bits (138), Expect = 1.490e-7
Identity = 49/197 (24.87%), Postives = 93/197 (47.21%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKR 775
            K+G++ LH A    ++++A  L+N     ++F         +++ P+H+A + G  +++K+LL R           + P  C      E +  ++L + + PI  +  N           +PLH+    DHL+C+++L+Q   V ++  +     TAL +A      +   VLL+  ANPN   ++  +PL  A K+
Sbjct:  216 KSGFTPLHIAAHYGNINVATLLLNRGAA-VDFTAR------NDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGA-PILSKTKN---------GLSPLHMATQGDHLNCVQLLLQH-NVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKK 393          

HSP 9 Score: 55.4546 bits (132), Expect = 7.518e-7
Identity = 51/214 (23.83%), Postives = 99/214 (46.26%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDA-----WNPLHLVVIHDHLDCLKMLIQEA-KVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETRESNSVVILFK*VTIQSL 838
            K G++ LH A   N +DIA  L+        +  ++ +I    + P+H+A + G   ++ +LL R+ N    + V     + P+ L+     +   +  +++   ++D      + PLH+   + ++  +  L+Q   KV  ++++     T L  A +      +NVLL+ GA+PN   ++  + L  A + G      SVV   K VT ++L
Sbjct:  612 KNGYTPLHIAAKKNQMDIATTLLE-------YGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSAN----VNVSNKSGLTPLHLAAQEDRVSVAEV-LANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGY---TPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYI----SVVDTLKVVTEETL 806          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 206.453 bits (524), Expect = 6.477e-53
Identity = 183/729 (25.10%), Postives = 331/729 (45.40%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSL 3852
            LHLA   K   +  ++ L++ G ++++ T KG+T    A    + E   +L+  G + NA +    + L ++A + + E++KFLL N    +     G T L  +  Q          HD     ++ + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +I+    L+  GA +++ +  N  T LHVA +  N  + K L+  GS I  ++R G    + P+H   ++G ++++ +LL  G+ +    + K+   ++PLH+A   D  + V+ L       +  N    D  N  LT                                  LH+AA  G +++ ++LL+  A+P A+ +    +G  P+H+A +   L++++L    G S+ A  + GLT +H AA  G V+I+  L   GA  N     G  +    +HMA+  G  + V+ LL+ G+ + A      +D+ T L+I+    + ++++ L+K GA PD    + G TPLH++ + G       L+    +S  +    G + LH+ A+ G  E+   LL+   +P+  G+            ++PL+ A  + +  V  LL+  GA  H A       G  P+H AA + +  +  TLLE G   +   + G+ P+H +  EG  D    L+   ANVN+ +K G  P   A   + +S+
Sbjct:   63 LHLAS--KEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQG---------HDQ---VVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNAD---VESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTAR-NDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDG----LTPLHCGARSGHEQVVGMLLDRGAPI----LSKTKNGLSPLHMATQGDHLNCVQLL-------LQHNVPVDDVTNDYLT---------------------------------ALHVAAHCGHYKVAKVLLDKKANPNAKAL----NGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETA----LHMAARAGQSEVVRFLLQNGAQVEAKA----KDDQTPLHISARLGKADIVQQLLKQGAYPDAATTS-GYTPLHLSSREGHDDVASVLLE-HGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGK----------SGLTPLHVAAHYDNQKVALLLLDKGASPHGA----AKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSV 697          

HSP 2 Score: 182.956 bits (463), Expect = 1.189e-45
Identity = 199/815 (24.42%), Postives = 375/815 (46.01%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH----------HSFIQDFRIGIDYFIH-DSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYG-SPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D NI     + +L  + ++ H ++   LI  GA+++         ++ K  N A +H+A +    E  + L+  GAN+          + +   T L++A   + N L  + FLL+ G +    T  G TP   A++    +  +LLL    + +    +    L ++A K + +    LLQN  +++ +   G T LH           + + +    +D+    D T + +A    N       +  +   L  G++ID                    VV +L     P L    N   ++P+ +A + + ++ +  L++H   ++ +++ +  T LHVA    +  +AK L+   +N + ++  G      P+H+A +    +++E+LL  G+S+ +     +   + P+H+AA     + V  L H   AS N  + R ++   +     +  V  V+ +L  GA V  K       + T LHI+A++G  +IVQ LL+ GA P A   +G      P+HL++  GH ++  +  + G S       G T LH AA  G ++++++LL+  A  +A      +S + P+H+A+   ++K   LLL+ G SP  A      ++  T L+IA  +N+ ++   L++ GA+ +      G  P+H+  Q G    +  L+   ++++NV   +G++ LHL A++    ++  L          G + D  +K      +PL+ A  +G++ +V  L++ G+ ++ A+T  G+    P+H AA +G  H+I  LL+ G S +E   +G T L
Sbjct:   49 GVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVD---------ASTKKGNTA-LHIASLAGQTEVVRVLVTNGANV--------NAQSQNGFTPLYMAA--QENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGN-------ANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNG--LSPLHMATQGDHLNCVQLLLQHNVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNG----FTPLHIACKKNRLKVMELLLKHGASIQAV----TESGLTPIHVAAFMGHVNIVSQLNHH-GASPNTTNVRGETALHMAARAGQSEV--VRFLLQNGAQVEAKA----KDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSG----YTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDA----AGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAA-----KNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQ-GIAPVHLAAQEGHVDMVSLLL-TRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLAN-------QGAVIDGTTK---MFYTPLHVASHYGNIKMVTFLLQHGSKVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTAL 785          

HSP 3 Score: 156.762 bits (395), Expect = 1.007e-37
Identity = 190/752 (25.27%), Postives = 324/752 (43.09%), Query Frame = 1
Query: 1246 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNI-----------HLRSRLGQGEEV------------------LPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKML--PIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSL 3348
            E++ +L+ +  N+N  +    + L++A Q N L +V  LL  G+  ++      T L  ++Q+ H ++  LL+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++GA +  T           ++T LH+A   K  + N +  LL+ G  I++KT  G TP     R    +   +LL RG    +      S L ++    +   ++ LLQ+ V  +   N  LTALH        +      +    + + K   N ++ +L     ++     N + V+ +L K  A    V       +TPI +A  M  ++ +  L  HGA+ N  ++   ET LH+A R     + + L+  G+ +           H+ +RLG+ + V                   P+H++ + G D++  +LL  G+S      + + +   PLH+AA       VK L  + ++    ++        L       N      +L  GA   G          T LHIAA+    +I   LLEYGAD  A  IT  + GI PVHLA + GH+++V L      +V+ +   GLT LH AA    V + E+L   GA +     DG  +KM   P+H+AS  G+ K V  LL++GS +NA      ++  T L+ A  +   +++  L++ GA+P+    N G T L I  + G+   +  L  +   +L
Sbjct:  106 EVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTA--------RNDITPLHVAS--KRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALH--------VAAHCGHYKVAKVLLDK-KANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAV---TESGLTPIHVAAFMGHVNIVSQLNHHGASPN-TTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFG----IVTKKGFTPLHVAAKYGKIEVVKLLLQKNASP---DAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAA----KNGYTPLHIAAKKNQMDIATTLLEYGAD--ANAIT--KQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVI-----DGT-TKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVN-GNTALAIARRLGYISVVDTLKVVTEETL 808          

HSP 4 Score: 124.405 bits (311), Expect = 8.242e-28
Identity = 106/356 (29.78%), Postives = 181/356 (50.84%), Query Frame = 1
Query: 2731 NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIID 3798
            NA+ L  AA+ G+ E     L+ G D    +   +++G+  +HLA++ GH+EIV      G  V A+   G T LH A+ AG  +++ +L+  GA+VNA++ +G      P++MA+++ H + VK LL+ G    A  S    D  T L +A  +  + V+  L+++     ++   L A  LHI  ++  TKA   L+   + + +V   +G + LH+ A  G+  ++  LL      + T +           +I+PL+ A   G+  +VKLL+  G+ I  A+T +   G+ P+HC A  G   V+  LL+ G  I    ++GL+PLH +      +C + L  L+ NV + D
Sbjct:   27 NASYLR-AARSGNLEKALDYLKNGVD----INICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNG----FTPLYMAAQENHLEVVKFLLDNG----ASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR---LPA--LHIAARKDDTKAAALLLQ-NDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTAR----------NDITPLHVASKRGNANMVKLLLDRGSKID-AKTRD---GLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL--LQHNVPVDD 347          

HSP 5 Score: 40.4318 bits (93), Expect = 2.412e-8
Identity = 79/333 (23.72%), Postives = 129/333 (38.74%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLL 1818
            GHD +  VLL++GA+  I TK+   TPLH +     I+ +   +Q  K+A      KS                    L  L  A   D+       +K+  LL      ++   +  G +  NG   L +  KK Q     ++   LL +  + N    +  + + LA Q   + +VS LL R ++ N+     +T L  + Q+    + E+L N GA          V+          +HVA  Y + +   FL+  G+ +          + +   T LH A   +    + IN LL+ G +    T  G+T    A R   I   + L
Sbjct:  528 GHDDVASVLLEHGASFGIVTKK-GFTPLHVAAKYGKIEVVKLLLQ--KNASPDAAGKSG-------------------LTPLHVAAHYDN-------QKVALLL------LDKGASPHGAA-KNGYTPLHIAAKKNQM----DIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGA----------VIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKV--------NAKTKNGYTPLHQAA--QQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 800          

HSP 6 Score: 40.0466 bits (92), Expect = 2.412e-8
Identity = 46/198 (23.23%), Postives = 79/198 (39.90%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPE---------LCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            K G S LH A   +H++  Q L+ H     N P +  +     L  +H+A   G   + K+LL +  NP          L +   K+ L    +L K    I           V      P+H+     H++ +  L         + + +  +TAL +A    + E V  LL++GA        +++PL  +A+ G+
Sbjct:  317 KNGLSPLHMATQGDHLNCVQLLLQH-----NVPVDDVTNDY--LTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQA---------VTESGLTPIHVAAFMGHVNIVSQLNHHGAS--PNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGK 496          

HSP 7 Score: 58.151 bits (139), Expect = 1.162e-7
Identity = 46/199 (23.12%), Postives = 90/199 (45.23%), Query Frame = 2
Query:  218 AGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGL---HNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSEL----------IEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALI-LACELCRLETVNVLLESGANPNVCDISNKSPLFYAAK 772
            +G++ LH +    H D+A  L+ H            S G+       P+H+A ++G+  ++K+LLQ+N +P+   +   + L          +  ++L K + P    K          + + PLH+    + +D    L++      ++ +I  +  A + LA +   ++ V++LL   AN NV + S  +PL  AA+
Sbjct:  516 SGYTPLHLSSREGHDDVASVLLEHG----------ASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAK----------NGYTPLHIAAKKNQMDIATTLLEYG---ADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQ 691          

HSP 8 Score: 58.151 bits (139), Expect = 1.471e-7
Identity = 49/197 (24.87%), Postives = 93/197 (47.21%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKR 775
            K+G++ LH A    ++++A  L+N     ++F         +++ P+H+A + G  +++K+LL R           + P  C      E +  ++L + + PI  +  N           +PLH+    DHL+C+++L+Q   V ++  +     TAL +A      +   VLL+  ANPN   ++  +PL  A K+
Sbjct:  218 KSGFTPLHIAAHYGNINVATLLLNRGAA-VDFTAR------NDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGA-PILSKTKN---------GLSPLHMATQGDHLNCVQLLLQH-NVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKK 395          

HSP 9 Score: 55.4546 bits (132), Expect = 8.353e-7
Identity = 51/214 (23.83%), Postives = 99/214 (46.26%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDA-----WNPLHLVVIHDHLDCLKMLIQEA-KVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETRESNSVVILFK*VTIQSL 838
            K G++ LH A   N +DIA  L+ +         ++ +I    + P+H+A + G   ++ +LL R+ N    + V     + P+ L+     +   +  +++   ++D      + PLH+   + ++  +  L+Q   KV  ++++     T L  A +      +NVLL+ GA+PN   ++  + L  A + G      SVV   K VT ++L
Sbjct:  614 KNGYTPLHIAAKKNQMDIATTLLEYG-------ADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSAN----VNVSNKSGLTPLHLAAQEDRVSVAEV-LANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGY---TPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYI----SVVDTLKVVTEETL 808          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 206.068 bits (523), Expect = 7.355e-53
Identity = 184/729 (25.24%), Postives = 331/729 (45.40%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSL 3852
            LHLA   K   +  ++ L++ G ++++ T KG+T    A    + E   +L+  G + NA +    + L ++A + + E++KFLL N    +     G T L  +  Q          HD     ++ + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +I+    L+  GA +++ +  N  T LHVA +  N  + K L+  GS I  ++R G    + P+H   ++G ++++ +LL  G+ + S    K+   ++PLH+A   D  + V+ L       +  N    D  N  LT                                  LH+AA  G +++ ++LL+  A+P A+ +    +G  P+H+A +   L++++L    G S+ A  + GLT +H AA  G V+I+  L   GA  N     G  +    +HMA+  G  + V+ LL+ G+ + A      +D+ T L+I+    + ++++ L+K GA PD    + G TPLH++ + G       L+    +S  +    G + LH+ A+ G  E+   LL+   +P+  G+            ++PL+ A  + +  V  LL+  GA  H A       G  P+H AA + +  +  TLLE G   +   + G+ P+H +  EG  D    L+   ANVN+ +K G  P   A   + +S+
Sbjct:   52 LHLAS--KEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQG---------HDQ---VVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNAD---VESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTAR-NDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDG----LTPLHCGARSGHEQVVGMLLDRGAPILS----KTKNGLSPLHMATQGDHLNCVQLL-------LQHNVPVDDVTNDYLT---------------------------------ALHVAAHCGHYKVAKVLLDKKANPNAKAL----NGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETA----LHMAARAGQSEVVRFLLQNGAQVEAKA----KDDQTPLHISARLGKADIVQQLLKQGAYPDAATTS-GYTPLHLSSREGHDDVASVLLE-HGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGK----------SGLTPLHVAAHYDNQKVALLLLDKGASPHGA----AKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSV 686          

HSP 2 Score: 182.57 bits (462), Expect = 1.221e-45
Identity = 199/815 (24.42%), Postives = 375/815 (46.01%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH----------HSFIQDFRIGIDYFIH-DSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYG-SPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D NI     + +L  + ++ H ++   LI  GA+++         ++ K  N A +H+A +    E  + L+  GAN+          + +   T L++A   + N L  + FLL+ G +    T  G TP   A++    +  +LLL    + +    +    L ++A K + +    LLQN  +++ +   G T LH           + + +    +D+    D T + +A    N       +  +   L  G++ID                    VV +L     P L    N   ++P+ +A + + ++ +  L++H   ++ +++ +  T LHVA    +  +AK L+   +N + ++  G      P+H+A +    +++E+LL  G+S+ +     +   + P+H+AA     + V  L H   AS N  + R ++   +     +  V  V+ +L  GA V  K       + T LHI+A++G  +IVQ LL+ GA P A   +G      P+HL++  GH ++  +  + G S       G T LH AA  G ++++++LL+  A  +A      +S + P+H+A+   ++K   LLL+ G SP  A      ++  T L+IA  +N+ ++   L++ GA+ +      G  P+H+  Q G    +  L+   ++++NV   +G++ LHL A++    ++  L          G + D  +K      +PL+ A  +G++ +V  L++ G+ ++ A+T  G+    P+H AA +G  H+I  LL+ G S +E   +G T L
Sbjct:   38 GVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVD---------ASTKKGNTA-LHIASLAGQTEVVRVLVTNGANV--------NAQSQNGFTPLYMAA--QENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGN-------ANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNG--LSPLHMATQGDHLNCVQLLLQHNVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNG----FTPLHIACKKNRLKVMELLLKHGASIQAV----TESGLTPIHVAAFMGHVNIVSQLNHH-GASPNTTNVRGETALHMAARAGQSEV--VRFLLQNGAQVEAKA----KDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSG----YTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDA----AGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAA-----KNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQ-GIAPVHLAAQEGHVDMVSLLL-TRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLAN-------QGAVIDGTTK---MFYTPLHVASHYGNIKMVTFLLQHGSKVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTAL 774          

HSP 3 Score: 156.762 bits (395), Expect = 1.053e-37
Identity = 190/754 (25.20%), Postives = 325/754 (43.10%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNI-----------HLRSRLGQGEEV------------------LPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKML--PIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSL 3348
            + E++ +L+ +  N+N  +    + L++A Q N L +V  LL  G+  ++      T L  ++Q+ H ++  LL+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++GA +  T           ++T LH+A   K  + N +  LL+ G  I++KT  G TP     R    +   +LL RG    +      S L ++    +   ++ LLQ+ V  +   N  LTALH        +      +    + + K   N ++ +L     ++     N + V+ +L K  A    V       +TPI +A  M  ++ +  L  HGA+ N  ++   ET LH+A R     + + L+  G+ +           H+ +RLG+ + V                   P+H++ + G D++  +LL  G+S      + + +   PLH+AA       VK L  + ++    ++        L       N      +L  GA   G          T LHIAA+    +I   LLEYGAD  A  IT  + GI PVHLA + GH+++V L      +V+ +   GLT LH AA    V + E+L   GA +     DG  +KM   P+H+AS  G+ K V  LL++GS +NA      ++  T L+ A  +   +++  L++ GA+P+    N G T L I  + G+   +  L  +   +L
Sbjct:   93 QTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTA--------RNDITPLHVAS--KRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALH--------VAAHCGHYKVAKVLLDK-KANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAV---TESGLTPIHVAAFMGHVNIVSQLNHHGASPN-TTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFG----IVTKKGFTPLHVAAKYGKIEVVKLLLQKNASP---DAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAA----KNGYTPLHIAAKKNQMDIATTLLEYGAD--ANAIT--KQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVI-----DGT-TKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVN-GNTALAIARRLGYISVVDTLKVVTEETL 797          

HSP 4 Score: 127.102 bits (318), Expect = 1.354e-28
Identity = 106/365 (29.04%), Postives = 182/365 (49.86%), Query Frame = 1
Query: 2704 GKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIID 3798
            G C+  +S        AA+ G+ E     L+ G D    +   +++G+  +HLA++ GH+EIV      G  V A+   G T LH A+ AG  +++ +L+  GA+VNA++ +G      P++MA+++ H + VK LL+ G    A  S    D  T L +A  +  + V+  L+++     ++   L A  LHI  ++  TKA   L+   + + +V   +G + LH+ A  G+  ++  LL      + T +           +I+PL+ A   G+  +VKLL+  G+ I  A+T +   G+ P+HC A  G   V+  LL+ G  I    ++GL+PLH +      +C + L  L+ NV + D
Sbjct:    6 GDCLSDQSDTNASYLRAARSGNLEKALDYLKNGVD----INICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNG----FTPLYMAAQENHLEVVKFLLDNG----ASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR---LPA--LHIAARKDDTKAAALLLQ-NDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTAR----------NDITPLHVASKRGNANMVKLLLDRGSKID-AKTRD---GLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL--LQHNVPVDD 336          

HSP 5 Score: 40.0466 bits (92), Expect = 3.389e-8
Identity = 79/333 (23.72%), Postives = 129/333 (38.74%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLL 1818
            GHD +  VLL++GA+  I TK+   TPLH +     I+ +   +Q  K+A      KS                    L  L  A   D+       +K+  LL      ++   +  G +  NG   L +  KK Q     ++   LL +  + N    +  + + LA Q   + +VS LL R ++ N+     +T L  + Q+    + E+L N GA          V+          +HVA  Y + +   FL+  G+ +          + +   T LH A   +    + IN LL+ G +    T  G+T    A R   I   + L
Sbjct:  517 GHDDVASVLLEHGASFGIVTKK-GFTPLHVAAKYGKIEVVKLLLQ--KNASPDAAGKSG-------------------LTPLHVAAHYDN-------QKVALLL------LDKGASPHGAA-KNGYTPLHIAAKKNQM----DIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGA----------VIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKV--------NAKTKNGYTPLHQAA--QQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 789          

HSP 6 Score: 39.6614 bits (91), Expect = 3.389e-8
Identity = 45/193 (23.32%), Postives = 81/193 (41.97%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPV-ILSKSSKPIFCQ---KFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGE 781
            K G S LH A   +H++  Q L+ H     N P +  +     L  +H+A   G   + K+LL +  NP    + +      P+ I  K ++    +   K   S   V      P+H+     H++ +  L         + + +  +TAL +A    + E V  LL++GA        +++PL  +A+ G+
Sbjct:  306 KNGLSPLHMATQGDHLNCVQLLLQH-----NVPVDDVTNDY--LTALHVAAHCGHYKVAKVLLDKKANPN--AKALNG--FTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGAS--PNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGK 485          

HSP 7 Score: 58.151 bits (139), Expect = 1.469e-7
Identity = 46/199 (23.12%), Postives = 90/199 (45.23%), Query Frame = 2
Query:  218 AGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGL---HNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSEL----------IEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALI-LACELCRLETVNVLLESGANPNVCDISNKSPLFYAAK 772
            +G++ LH +    H D+A  L+ H            S G+       P+H+A ++G+  ++K+LLQ+N +P+   +   + L          +  ++L K + P    K          + + PLH+    + +D    L++      ++ +I  +  A + LA +   ++ V++LL   AN NV + S  +PL  AA+
Sbjct:  505 SGYTPLHLSSREGHDDVASVLLEHG----------ASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAK----------NGYTPLHIAAKKNQMDIATTLLEYG---ADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQ 680          

HSP 8 Score: 57.7658 bits (138), Expect = 1.710e-7
Identity = 49/197 (24.87%), Postives = 93/197 (47.21%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKR 775
            K+G++ LH A    ++++A  L+N     ++F         +++ P+H+A + G  +++K+LL R           + P  C      E +  ++L + + PI  +  N           +PLH+    DHL+C+++L+Q   V ++  +     TAL +A      +   VLL+  ANPN   ++  +PL  A K+
Sbjct:  207 KSGFTPLHIAAHYGNINVATLLLNRGAA-VDFTAR------NDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGA-PILSKTKN---------GLSPLHMATQGDHLNCVQLLLQH-NVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKK 384          

HSP 9 Score: 55.4546 bits (132), Expect = 9.546e-7
Identity = 51/214 (23.83%), Postives = 99/214 (46.26%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDA-----WNPLHLVVIHDHLDCLKMLIQEA-KVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETRESNSVVILFK*VTIQSL 838
            K G++ LH A   N +DIA  L+        +  ++ +I    + P+H+A + G   ++ +LL R+ N    + V     + P+ L+     +   +  +++   ++D      + PLH+   + ++  +  L+Q   KV  ++++     T L  A +      +NVLL+ GA+PN   ++  + L  A + G      SVV   K VT ++L
Sbjct:  603 KNGYTPLHIAAKKNQMDIATTLLE-------YGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSAN----VNVSNKSGLTPLHLAAQEDRVSVAEV-LANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGY---TPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYI----SVVDTLKVVTEETL 797          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 204.142 bits (518), Expect = 3.725e-52
Identity = 180/725 (24.83%), Postives = 335/725 (46.21%), Query Frame = 1
Query: 1648 ETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLV--FIHNNVT---MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            +  +  LHLA   K   +  +  LL  G +++S T KG+T    A    + E   +L+  G + NA +    + L ++A + + +++K+LL+N  + +     G T L  +  Q              N  +A + +ND+   ++   L  A +  +      +L+   + D+    + N  T    TP+ +A    +++    L+  GA +++ ++ N  T LHVA +  N  + K L+  G  I  ++R G    + P+H A ++G D+++E+LL       + ++ ++   ++PLH+AA  D    VK L  Q  A ++                                DV+   +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G       L+  A ++ ++    G + LH+ A+ G  +++  LL+ +   +  G+            ++PL+ A  + +  V  LL++ GA  H         G  P+H AA + +  +  TLL  G   +   + G+TPLH +  EG  D    L+   AN+++  K G
Sbjct:   62 QNGLNALHLAA--KEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQ------------GHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF-TARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDG----LTPLHCAARSGHDQVVELLL----ERKAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QYKAPVD--------------------------------DVTLDYL-------TALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREGQVDVASVLLE-AGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK----------NGLTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSG 695          

HSP 2 Score: 202.216 bits (513), Expect = 1.237e-51
Identity = 203/823 (24.67%), Postives = 381/823 (46.29%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDS--------NQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D N      + +L  + ++ H  + + L+  G++++         S  K  N A +H+A +    E  + L+ +GAN+          + +   T L++A   + N ++ + +LLE G N  + T  G TP   A++    +A  +LL    + +    +    L ++A K + +    LLQN  ++        N+    G T LH           + + +    +D+   +  T + +A    N +   L        L  G +ID                    VV +L +   P L    N   ++P+ +A + + +  + HL+++ A ++ ++  +  T LHVA    +  + K L+   +N + R+  G      P+H+A +    +++E+L+ +G+S+ +     +   + P+H+AA     + V  L  Q  AS ++ + R ++  AL        V  V+ +L  GA V      +R+R   T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G +++  +  + G + S A   G T LH AA  GS+D+ ++LL+  A  ++   +G    + P+H+A+   ++K   LLLE G+  +A      ++  T L+IA  +N+  +   L+  GA  +      G TPLH+  Q G T  +  L+    +++++   +G++SLHL A++    ++  L +        G   D+++K      +PL  AC +G++ +V  L+K GA+++ A+T  G+    P+H AA +G  H+I  LL+ G   +    +G T L
Sbjct:   54 GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVD---------SATKKGNTA-LHIASLAGQAEVVKVLVKEGANI--------NAQSQNGFTPLYMAA--QENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKL-------LLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNG--LSPLHMAAQGDHVECVKHLLQYKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNG----FTPLHIACKKNRIKVMELLVKYGASIQAI----TESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVTNIRGET--ALHMAARAGQVEVVRCLLRNGALVD-----ARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDA----ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNG----LTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQ-GVTPLHLASQEGHTDMVTLLLD-KGANIHMSTKSGLTSLHLAAQEDKVNVADILTK-------HGADRDAYTK---LGYTPLIVACHYGNVKMVNFLLKQGANVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 798          

HSP 3 Score: 192.971 bits (489), Expect = 1.012e-48
Identity = 162/592 (27.36%), Postives = 280/592 (47.30%), Query Frame = 1
Query: 2209 AVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLT------------------------HQQSASINI-NSTRSDSFNALLTLVSKRNVIGVQSVLMAG---ADVSGKCIVSRSRNA--TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT--------------------------GQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            A    ++  +   ++ G ++N   + N    LH+A +  ++ + +EL+  GS++   ++ G       +H+A   G  E++++L+  G+++N+    +S     PL++AA  +    VK+L                         H Q+ +I + N T+       L + ++++     ++L+     ADV  K +V+R+  +  T LHIAA  G+  +  LLL  GA   A   T  R+GI P+H+A++ G+  +VKL  D G  + A    GLT LH AA +G   ++E+LL+  A + A   +G    + P+HMA++  H + VK LL+Y +P++ V      D LTAL++A       V K L+   ANP+ +  N G TPLHI C++   K +M L+    +S+     +G++ +H+ A  GH  +   LL+   +P++T                          G + D+ +++     +PL+ A   G   +V+LL++  A    A T     G  P+H +A  G+  V   LLEAG +     + G TPLH +   G  D  K L+  +A  +   K G  P
Sbjct:   38 AARAGNLDKVVEYLKGGIDIN-TCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGN----TALHIASLAGQAEVVKVLVKEGANINA----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGA---AVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNG----LSPLHMAAQGDHVECVKHLLQYKAPVDDV----TLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACKKNRIK-VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ---TPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 599          

HSP 4 Score: 171.014 bits (432), Expect = 4.975e-42
Identity = 170/735 (23.13%), Postives = 317/735 (43.13%), Query Frame = 1
Query: 1639 REVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIR--HGANLNYISSPNQET-----VLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            ++ ++N + L  A   ++ +L+ +   L+ G++I +    G      A +   +     LL RG   ++      + L ++++    E++K L++   + N +   G T L+ +  ++    + Y + +  N           S + + G+  L  ALQ G+   V  +L+             V +  + +A   +   +   L++  H A++      N+ T      LH+A    N+ +A  L+  G+ +   +R G    + P+HVA + G   ++++LL  G  +++    K+ + + PLH AA +     V+ L  +++  +   +   +  + L       +V  V+ +L   A V    +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G                       ++S+ L A   H                        S  T    +PL+ A  +G L V KLL++  A    A    G  G+ P+H AA      V   LLE G S     ++G TPLH +  +        L+   A  N + K G  P
Sbjct:   27 KKSDSNASFLRAA---RAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN----------QSTATEDGFTPLAVALQQGHNQAVAILLENDTK-------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNG----ITPLHVASKRGNTNMVKLLLDRGGQIDA----KTRDGLTPLHCAARSGHDQVVELLLERKAPLL---ARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTL----DYLTALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREG--------------------QVDVASVLLEAGAAH------------------------SLATKKGFTPLHVAAKYGSLDVAKLLLQRRA----AADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTP 665          

HSP 5 Score: 159.844 bits (403), Expect = 1.337e-38
Identity = 184/753 (24.44%), Postives = 322/753 (42.76%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS--------------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH-HSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITG-----------------------------DRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            + E++ +L+    NIN  +    + L++A Q N + +V  LL  G++ +       T L  ++Q+ H +   +L+             +  A  ++     L+L N    +  S              +H+A  Y +      L+++GA +  T            +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R    +   LLL R     A      S L ++A   + E +K LLQ +   +      LTALH  +    +R+         T + + K   N ++ +L     ++     N I V+ +L K  A    +       +TPI +A  M  ++ +  L+++GA+ + +++   ET LH+A R   + + + L+  G+ +  R+R    EE  P+H+A + G  EI+++LL   +  ++     +     PLH++A          L    +A    +S  +      L + +K   + V  +L+   A AD +GK         T LH+AA   + ++  LLLE GA P A    G                              + G+ P+HLA++ GH ++V L  D G ++  +   GLT LH AA    V++ +IL K GAD +A    G      P+ +A   G+ K V  LL+ G+ +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+   +
Sbjct:  109 QAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA--------RNGITPLHVAS--KRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRV---------TKLLLDK-RANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAI---TESGLTPIHVAAFMGHLNIVLLLLQNGASPD-VTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAR----EEQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQVDVASVLLEAGAA----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK------NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLG----YTPLIVACHYGNVKMVNFLLKQGANVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAN-GNTALAIAKRLGYISVV 810          

HSP 6 Score: 131.339 bits (329), Expect = 5.284e-30
Identity = 127/490 (25.92%), Postives = 211/490 (43.06%), Query Frame = 1
Query: 2470 GSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIG-VQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLE--YGSPINA--VFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADI------------------HWAET-----------FEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTA 3837
            GSS       KS    + L  A   +L   V++L       I+IN+   +  NAL  L +K   +G VQ +L  G+ V      +  +  T LHIA+  G  E+V++L++ GA+  A+     ++G  P+++A +  H+++VK   + G + S A + G T L  A   G    + ILL        E     + ++  +H+A+ K   KS  LLL+  + + + +  + +R      T L+IA      NV   L+  GA  D    N G TPLH+  +RG T  +  L+      ++     G++ LH  A  GH+++   LL  K  P L          +T   +SPL+ A    H+  VK L+++ A +                  H+  T                G  P+H A  + +  V+  L++ G SI    E GLTP+H +   G  +    L+   A+ ++ +  G+     A  A
Sbjct:   18 GSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYL----KGGIDINTCNQNGLNAL-HLAAKEGHVGLVQELLGRGSSVDS----ATKKGNTALHIASLAGQAEVVKVLVKEGANINAQ----SQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL--------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-GITPLHVASKRGNTNMVKLLLD-RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKA-PLLA---------RTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARA 474          

HSP 7 Score: 100.908 bits (250), Expect = 1.143e-20
Identity = 129/537 (24.02%), Postives = 231/537 (43.02%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYL-IYALQYGNEIDVVRVLKQAADPDLVFIHNNVT---MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMA-GADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            ++ L  + Q  H +  + L+ Y A +++          V L    ++HVA         + L+DK AN                 T LH+A   K N +  +  L++ G +I++ T  G TP   A     +    LLL  G   +  N   E+ L ++A     E+++ LL+N    + +     T LH +     R+G    +     + +  +   D++ +  +GY  ++      ++DV  VL +A        H+  T    TP+ +A +  S+     L++  A  +  +  N  T LHVA    N  +A  L+  G++ H  ++ G      P+H+A +    +I   LL +G+  N+     + + V PLHLA+    T  V  L   + A+I++ ST+S   +  L L ++ + + V  +L   GAD      +      T L +A   G+ ++V  LL+ GA+  A+     ++G  P+H A + GH  I+ +    G   +A    G T L  A   G + +++ L
Sbjct:  333 LSPLHMAAQGDHVECVKHLLQYKAPVDD----------VTLDYLTALHVAAHCGHYRVTKLLLDKRAN--------PNARALNGFTPLHIAC--KKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIAS----RLGKTEIVQ----LLLQHMAHPDAATT--NGYTPLHISAREGQVDVASVLLEAGAA-----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADS-AGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNG----YTPLHIAAKKNQMQIASTLLNYGAETNTV----TKQGVTPLHLASQEGHTDMVTLLL-DKGANIHM-STKSGLTS--LHLAAQEDKVNVADILTKHGADRDAYTKLGY----TPLIVACHYGNVKMVNFLLKQGANVNAKT----KNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 8 Score: 64.3142 bits (155), Expect = 1.568e-19
Identity = 86/395 (21.77%), Postives = 162/395 (41.01%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQ---LIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRK-------ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH  IV +LL+ GA+P +   R + T LH +  +  ++ +   ++   L+ +              + + +I        + ++L+     D    N +   ++    E +VD+ SV    G +++       +  KK   PL         ++  +LL  R   +       + L +A   +   +   LL +G+ P+       T L  + +K   ++   L+NYGA  N           V       +H+A      +    L+DKGAN+ ++         ++ +T LHLA   + + +N  + L + G + ++ T  G TP + A  Y  ++  N LL +G + NA      + L  +A + +  I+  LLQ+    N     G TAL
Sbjct:  441 MGHLNIVLLLLQNGASPDVTNIRGE-TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEI--------VQLLLQHMAHPDAATTNGY-TPLHISAREGQVDVASVLLEAGAAHS-------LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETN----------TVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMS--------TKSGLTSLHLAA--QEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 798          

HSP 9 Score: 53.5286 bits (127), Expect = 1.568e-19
Identity = 47/201 (23.38%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            ++G++ LH A    +V++A  L+N     ++F   +       + P+H+A + G T+++K+LL R           + P  C      + +  ++L + + P+  +  N           +PLH+    DH++C+K L+Q  K  ++  ++    TAL +A          +LL+  ANPN   ++  +PL  A K+   +
Sbjct:  231 ESGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARN------GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKA-PLLARTKN---------GLSPLHMAAQGDHVECVKHLLQ-YKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIK 412          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 199.134 bits (505), Expect = 3.108e-51
Identity = 183/721 (25.38%), Postives = 329/721 (45.63%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTN-------IFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            LHLA   K   +  +  LL  G +++S T KG+T    A    + E   +L+  G + NA +    + L ++A + + +++K+LL+N  + +     G T L  +  Q     +   + + T        + IA   D+  S +L        LQ  +  DV   +       +V        TP+ +A    +++    L+  GA +++ +  N  T LHVA +  N  + K L+  G  I  ++R G    + P+H A ++G D+++E+LL       + ++ ++   ++PLH+AA  D    VK L  Q  A ++                                DV+   +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G       L+  A ++ ++    G + LH+ A+ G  +++  LL+ +          DS  K     ++PL+ A  + +  V  LL++ GA  H         G  P+H AA + +  +  TLL  G   +   + G+TPLH +  EG  D    L+   AN+++  K G
Sbjct:   47 LHLAA--KEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAAL-------LLQNDHNADVQSKM-------MVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR-NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDG----LTPLHCAARSGHDQVVELLL----ERKAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QYKAPVD--------------------------------DVTLDYL-------TALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDARA----REEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREGQVDVASVLLE-AGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRA-------AADSAGKN---GLTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSG 674          

HSP 2 Score: 190.66 bits (483), Expect = 1.616e-48
Identity = 198/823 (24.06%), Postives = 382/823 (46.42%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDS--------NQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D N      + +L  + ++ H  + + L+  G++++         S  K  N A +H+A +    E  + L+ +GAN+          + +   T L++A   + N ++ + +LLE G N  + T  G TP   A++    +A  +LL    + +    +    L ++A K + +    LLQN  ++        N+    G T LH           + + +    +D+   +  T + +A    N       +  +   L  G +ID                    VV +L +   P L    N   ++P+ +A + + +  + HL+++ A ++ ++  +  T LHVA    +  + K L+   +N + R+  G      P+H+A +    +++E+L+ +G+S+ +     +   + P+H+AA     + V  L  Q  AS ++ + R ++    L + ++   + V   L+     +G  + +R+R   T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G +++  +  + G + S A   G T LH AA  GS+D+ ++LL+  A  ++   +G    + P+H+A+   ++K   LLLE G+  +A      ++  T L+IA  +N+  +   L+  GA  +      G TPLH+  Q G T  +  L+    +++++   +G++SLHL A++    ++  L +        G   D+++K      +PL  AC +G++ +V  L+K GA+++ A+T  G+    P+H AA +G  H+I  LL+ G   +    +G T L
Sbjct:   33 GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVD---------SATKKGNTA-LHIASLAGQAEVVKVLVKEGANI--------NAQSQNGFTPLYMAA--QENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGN-------TNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNG--LSPLHMAAQGDHVECVKHLLQYKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNG----FTPLHIACKKNRIKVMELLVKYGASIQAI----TESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVTNIRGETA---LHMAARAGQVEVVRCLLR----NGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNG----LTPLHVAAHYDNQKVALLLLEKGASPHATA----KNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQ-GVTPLHLASQEGHTDMVTLLLD-KGANIHMSTKSGLTSLHLAAQEDKVNVADILTK-------HGADRDAYTK---LGYTPLIVACHYGNVKMVNFLLKQGANVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 777          

HSP 3 Score: 185.267 bits (469), Expect = 7.722e-47
Identity = 162/592 (27.36%), Postives = 280/592 (47.30%), Query Frame = 1
Query: 2209 AVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFL------------------------THQQSASINI-NSTRSDSFNALLTLVSKRNVIGVQSVLMAG---ADVSGKCIVSRSRNA--TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT--------------------------GQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            A    ++  +   ++ G ++N  +  N    LH+A +  ++ + +EL+  GS++   ++ G       +H+A   G  E++++L+  G+++N+    +S     PL++AA  +    VK+L                         H Q+ +I + N T+       L + ++++     ++L+     ADV  K +V+R+  +  T LHIAA  G+  +  LLL  GA   A   T  R+GI P+H+A++ G+  +VKL  D G  + A    GLT LH AA +G   ++E+LL+  A + A   +G    + P+HMA++  H + VK LL+Y +P++ V      D LTAL++A       V K L+   ANP+ +  N G TPLHI C++   K +M L+    +S+     +G++ +H+ A  GH  +   LL+   +P++T                          G + D+ +++     +PL+ A   G   +V+LL++  A    A T     G  P+H +A  G+  V   LLEAG +     + G TPLH +   G  D  K L+  +A  +   K G  P
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQ-NGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGN----TALHIASLAGQAEVVKVLVKEGANINA----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGA---AVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNG----LSPLHMAAQGDHVECVKHLLQYKAPVDDV----TLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACKKNRIK-VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ---TPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 578          

HSP 4 Score: 158.303 bits (399), Expect = 1.416e-38
Identity = 169/735 (22.99%), Postives = 316/735 (42.99%), Query Frame = 1
Query: 1639 REVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYIS-------SPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            ++ ++N + L  A   ++ +L+ +   L+ G++I +    G      A +   +     LL RG   ++      + L ++++    E++K L++   + N +   G T L+ +  ++    + Y + +  N   A  D          G+  L  ALQ G+   V  +L+             V +  + +A   +   +   L+++  N +  S       + +  T LH+A    N+ +A  L+  G+ +   +R G    + P+HVA + G   ++++LL  G  +++    K+ + + PLH AA +     V+ L  +++  +   +   +  + L       +V  V+ +L   A V    +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI                                  +A +G  +++  LL              + S  T    +PL+ A  +G L V KLL++  A    A    G  G+ P+H AA      V   LLE G S     ++G TPLH +  +        L+   A  N + K G  P
Sbjct:    6 QKSDSNASFLRAA---RAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATED----------GFTPLAVALQQGHNQAVAILLENDTK-------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNG----ITPLHVASKRGNTNMVKLLLDRGGQIDA----KTRDGLTPLHCAARSGHDQVVELLLERKAPLL---ARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTL----DYLTALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDARA----REEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHI----------------------------------SAREGQVDVASVLLEAGA----------AHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRA----AADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTP 644          

HSP 5 Score: 150.599 bits (379), Expect = 4.253e-36
Identity = 195/821 (23.75%), Postives = 336/821 (40.93%), Query Frame = 1
Query: 1111 KKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANIN-----------------ENVCFDLVLSN-----VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLK----QAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYIS---------------------------SPN-----QETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITG-----------------------------DRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGF 3303
            K + YL  +  +DIN+ C      N NGL+ L +  K+    L +EL    L    +++    K  + L +A       +V  L+  G++ N       T L  + Q+ H  + + L+  GAN +                  N    ++L N     V+L    ++H+A    D ++   L+    N  +   ++  R  E+  T LH+A      ++N    LL  G  ++     G TP   A +        LLL RG   +A      + L  +A   + ++++ LL+ +     +   GL+ LH +   D    + + +      + A +DD      +   YL  AL         RV K    + A+P+   ++     TP+ +A + N I  M  L+++GA++  I+                           SP+      ET LH+A R   + + + L+  G+ +  R+R    EE  P+H+A + G  EI+++LL   +  ++     +     PLH++A          L    +A    +S  +      L + +K   + V  +L+   A AD +GK         T LH+AA   + ++  LLLE GA P A    G                              + G+ P+HLA++ GH ++V L  D G ++  +   GLT LH AA    V++ +IL K GAD +A    G      P+ +A   G+ K V  LL+ G+ +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+
Sbjct:   25 KVVEYL--KGGIDINT-C------NQNGLNALHLAAKEGHVGLVQEL----LGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRL---PALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAA--HYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQ-----YKAPVDD------VTLDYLT-ALHVAAHCGHYRVTKLLLDKRANPNARALNG---FTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAR----EEQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQVDVASVLLEAGAA----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK------NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLG----YTPLIVACHYGNVKMVNFLLKQGANVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAN-GNTALAIAKRLGY 785          

HSP 6 Score: 127.872 bits (320), Expect = 3.927e-29
Identity = 124/476 (26.05%), Postives = 210/476 (44.12%), Query Frame = 1
Query: 2485 STMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIG-VQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLE--YGSPINA--VFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADI------------------HWAET-----------FEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGK 3810
            +TM+ KS    + L  A   +L   V++L       I+IN+   +  NAL  L +K   +G VQ +L  G+ V      +  +  T LHIA+  G  E+V++L++ GA+  A+     ++G  P+++A +  H+++VK   + G + S A + G T L  A   G    + ILL        E     + ++  +H+A+ K   KS  LLL+  + + + +  + +R      T L+IA      NV   L+  GA  D    N G TPLH+  +RG T  +  L+      ++     G++ LH  A  GH+++   LL  K  P L          +T   +SPL+ A    H+  VK L+++ A +                  H+  T                G  P+H A  + +  V+  L++ G SI    E GLTP+H +   G  +    L+   A+ ++ +  G+
Sbjct:    2 TTMLQKSDSNASFLRAARAGNLDKVVEYL----KGGIDINTCNQNGLNAL-HLAAKEGHVGLVQELLGRGSSVDS----ATKKGNTALHIASLAGQAEVVKVLVKEGANINAQ----SQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL--------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-GITPLHVASKRGNTNMVKLLLD-RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKA-PLLA---------RTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGE 444          

HSP 7 Score: 65.4698 bits (158), Expect = 2.239e-20
Identity = 86/395 (21.77%), Postives = 162/395 (41.01%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQ---LIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRK-------ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH  IV +LL+ GA+P +   R + T LH +  +  ++ +   ++   L+ +              + + +I        + ++L+     D    N +   ++    E +VD+ SV    G +++       +  KK   PL         ++  +LL  R   +       + L +A   +   +   LL +G+ P+       T L  + +K   ++   L+NYGA  N           V       +H+A      +    L+DKGAN+ ++         ++ +T LHLA   + + +N  + L + G + ++ T  G TP + A  Y  ++  N LL +G + NA      + L  +A + +  I+  LLQ+    N     G TAL
Sbjct:  420 MGHLNIVLLLLQNGASPDVTNIRGE-TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEI--------VQLLLQHMAHPDAATTNGYT-PLHISAREGQVDVASVLLEAGAAHS-------LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETN----------TVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMS--------TKSGLTSLHLAA--QEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 777          

HSP 8 Score: 55.4546 bits (132), Expect = 2.239e-20
Identity = 47/197 (23.86%), Postives = 92/197 (46.70%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKR 775
            ++G++ LH A    +V++A  L+N     ++F   +       + P+H+A + G T+++K+LL R           + P  C      + +  ++L + + P+  +  N           +PLH+    DH++C+K L+Q  K  ++  ++    TAL +A          +LL+  ANPN   ++  +PL  A K+
Sbjct:  210 ESGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARN------GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKA-PLLARTKN---------GLSPLHMAAQGDHVECVKHLLQY-KAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKK 387          

HSP 9 Score: 97.0561 bits (240), Expect = 1.194e-19
Identity = 127/534 (23.78%), Postives = 229/534 (42.88%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYL-IYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMA-GADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            ++ L  + Q  H +  + L+ Y A +++          V L    ++HVA         + L+DK AN                 T LH+A   K N +  +  L++ G +I++ T  G TP   A     +    LLL  G   +  N   E+ L ++A     E+++ LL+N    + +     T LH +     R+G    +     + +  +   D++ +  +GY  ++      ++DV  VL +A     +        TP+ +A +  S+     L++  A  +  +  N  T LHVA    N  +A  L+  G++ H  ++ G      P+H+A +    +I   LL +G+  N+     + + V PLHLA+    T  V  L   + A+I++ ST+S   +  L L ++ + + V  +L   GAD      +      T L +A   G+ ++V  LL+ GA+  A+     ++G  P+H A + GH  I+ +    G   +A    G T L  A   G + +++ L
Sbjct:  312 LSPLHMAAQGDHVECVKHLLQYKAPVDD----------VTLDYLTALHVAAHCGHYRVTKLLLDKRAN--------PNARALNGFTPLHIAC--KKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIAS----RLGKTEIV----QLLLQHMAHPDAATT--NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKG--FTPLHVAAKYGSLDVAKLLLQRRAAADS-AGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNG----YTPLHIAAKKNQMQIASTLLNYGAETNTV----TKQGVTPLHLASQEGHTDMVTLLL-DKGANIHM-STKSGLTS--LHLAAQEDKVNVADILTKHGADRDAYTKLGY----TPLIVACHYGNVKMVNFLLKQGANVNAKT----KNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 792          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 200.675 bits (509), Expect = 4.095e-51
Identity = 191/728 (26.24%), Postives = 340/728 (46.70%), Query Frame = 1
Query: 1648 ETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLV--FIHNNVT---MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            +  +  LHLA   K   +  +  LL  G +++S T KG+T    A    + E   +L+  G + NA +    + L ++A + + +++K+LL+N  + +     G T L  +  Q              N  +A + +ND+   ++   L  A +  +      +L+   + D+    + N  T    TP+ +A    +++    L+  GA +++ ++ N  T LHVA +  N  + K L+  G  I  ++R G    + P+H A ++G D+++E+LL       + ++ ++   ++PLH+AA  D    VK L   ++    ++    D   AL       +    + +L   A+ + + +       T LHIA +    ++++LL++YGA    + IT    G+ P+H+A   GHL IV L    G S       G T LH AA AG V+++  LL+ GA V+A A    R +  P+H+AS  G  + V+LLL++ +  +A  +    +  T L+I+  E + +V   L+++GA   +     G TPLH+  + G +  +  L+    ++ +     G + LH+ A+K   +++  LL         G  T++ +K+    ++PL+ A   GH  +V LL+  GA+IH +       G+  +H AA   K +V   L + G   D   + G TPL  +   G      FL+   ANVN   K G  P
Sbjct:   41 QNGLNALHLAA--KEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQ------------GHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF-TARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDG----LTPLHCAARSGHDQVVELLL----ERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAP---VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGAS--IQAIT--ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARA----REEQTPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKK-GFTPLHVAAKYG-SLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLN-------YGAETNTVTKQ---GVTPLHLASQEGHTDMVTLLLDKGANIHMSTK----SGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTP 710          

HSP 2 Score: 196.438 bits (498), Expect = 8.521e-50
Identity = 165/604 (27.32%), Postives = 284/604 (47.02%), Query Frame = 1
Query: 2209 AVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLT------------------------HQQSASINI-NSTRSDSFNALLTLVSKRNVIGVQSVLMAG---ADVSGKCIVSRSRNA--TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT--------------------------GQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSL 3852
            A    ++  +   ++ G ++N   + N    LH+A +  ++ + +EL+  GS++   ++ G       +H+A   G  E++++L+  G+++N+    +S     PL++AA  +    VK+L                         H Q+ +I + N T+       L + ++++     ++L+     ADV  K +V+R+  +  T LHIAA  G+  +  LLL  GA   A   T  R+GI P+H+A++ G+  +VKL  D G  + A    GLT LH AA +G   ++E+LL+  A + A   +G    + P+HMA++  H + VK LL+Y +P++ V      D LTAL++A       V K L+   ANP+ +  N G TPLHI C++   K +M L+    +S+     +G++ +H+ A  GH  +   LL+   +P++T                          G + D+ +++     +PL+ A   G   +V+LL++  A    A T     G  P+H +A  G+  V   LLEAG +     + G TPLH +   G  D  K L+  +A  +   K G  P   A   N M +
Sbjct:   17 AARAGNLDKVVEYLKGGIDIN-TCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGN----TALHIASLAGQAEVVKVLVKEGANINA----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGA---AVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNG----LSPLHMAAQGDHVECVKHLLQYKAPVDDV----TLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACKKNRIK-VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ---TPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQI 590          

HSP 3 Score: 184.496 bits (467), Expect = 3.942e-46
Identity = 191/780 (24.49%), Postives = 345/780 (44.23%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDS--------NQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILL--KAGAD---------------------------VNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT---GQITDSFSKKTSY 3495
            G D N      + +L  + ++ H  + + L+  G++++         S  K  N A +H+A +    E  + L+ +GAN+          + +   T L++A   + N ++ + +LLE G N  + T  G TP   A++    +A  +LL    + +    +    L ++A K + +    LLQN  ++        N+    G T LH           + + +    +D+   +  T + +A    N +   L        L  G +ID                    VV +L +   P L    N   ++P+ +A + + +  + HL+++ A ++ ++  +  T LHVA    +  + K L+   +N + R+  G      P+H+A +    +++E+L+ +G+S+ +     +   + P+H+AA     + V  L  Q  AS ++ + R ++  AL        V  V+ +L  GA V      +R+R   T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G +++  +  + G + S A   G T LH AA  GS+D+ ++LL  +A AD                             AE     +  + P+H+AS++GH   V LLL+ G+ I+       +  LT+L++A  E++ NV   L K GA+ D     LG TPL + C  G  K + +L+    +++N     G + LH  A++GH  +   LL+    PN T   G    + +K+  Y
Sbjct:   33 GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVD---------SATKKGNTA-LHIASLAGQAEVVKVLVKEGANI--------NAQSQNGFTPLYMAA--QENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKL-------LLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNG--LSPLHMAAQGDHVECVKHLLQYKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNG----FTPLHIACKKNRIKVMELLVKYGASIQAI----TESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVTNIRGET--ALHMAARAGQVEVVRCLLRNGALVD-----ARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDA----ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMS----TKSGLTSLHLAAQEDKVNVADILTKHGADRDAY-TKLGYTPLIVACHYGNVKMVNFLLK-QGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGY 752          

HSP 4 Score: 178.333 bits (451), Expect = 3.002e-44
Identity = 170/732 (23.22%), Postives = 321/732 (43.85%), Query Frame = 1
Query: 1639 REVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIR--HGANLNYISSPNQET-----VLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            ++ ++N + L  A   ++ +L+ +   L+ G++I +    G      A +   +     LL RG   ++      + L ++++    E++K L++   + N +   G T L+ +  ++    + Y + +  N           S + + G+  L  ALQ G+   V  +L+             V +  + +A   +   +   L++  H A++      N+ T      LH+A    N+ +A  L+  G+ +   +R G    + P+HVA + G   ++++LL  G  +++    K+ + + PLH AA +     V+ L  +++  +   +   +  + L       +V  V+ +L   A V    +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G                       ++S+ L A   H                        S  T    +PL+ A  +G L V KLL++  A    A    G  G  P+H AA + +  +  TLL  G   +   + G+TPLH +  EG  D    L+   AN+++  K G
Sbjct:    6 QKSDSNASFLRAA---RAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN----------QSTATEDGFTPLAVALQQGHNQAVAILLENDTK-------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNG----ITPLHVASKRGNTNMVKLLLDRGGQIDA----KTRDGLTPLHCAARSGHDQVVELLLERKAPLL---ARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTL----DYLTALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREG--------------------QVDVASVLLEAGAAH------------------------SLATKKGFTPLHVAAKYGSLDVAKLLLQRRA----AADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSG 641          

HSP 5 Score: 167.548 bits (423), Expect = 5.786e-41
Identity = 183/724 (25.28%), Postives = 320/724 (44.20%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS--------------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH-HSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            + E++ +L+    NIN  +    + L++A Q N + +V  LL  G++ +       T L  ++Q+ H +   +L+             +  A  ++     L+L N    +  S              +H+A  Y +      L+++GA +  T            +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R    +   LLL R     A      S L ++A   + E +K LLQ +   +      LTALH  +    +R+         T + + K   N ++ +L     ++     N I V+ +L K  A    +       +TPI +A  M  ++ +  L+++GA+ + +++   ET LH+A R   + + + L+  G+ +  R+R    EE  P+H+A + G  EI+++LL   +  ++     +     PLH++A          L    +A    +S  +      L + +K   + V  +L+   A AD +GK         T LHIAA+    +I   LL YGA+      T  + G+ P+HLA++ GH ++V L  D G ++  +   GLT LH AA    V++ +IL K GAD +A    G      P+ +A   G+ K V  LL+ G+ +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+   +
Sbjct:   88 QAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA--------RNGITPLHVAS--KRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRV---------TKLLLDK-RANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAI---TESGLTPIHVAAFMGHLNIVLLLLQNGASPD-VTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAR----EEQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQVDVASVLLEAGAA----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK------NGYTPLHIAAKKNQMQIASTLLNYGAE----TNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLG----YTPLIVACHYGNVKMVNFLLKQGANVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAN-GNTALAIAKRLGYISVV 756          

HSP 6 Score: 88.5817 bits (218), Expect = 6.005e-17
Identity = 117/536 (21.83%), Postives = 216/536 (40.30%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYL-IYALQYGNEIDVVRVLKQAADPDLVFIHNNVT---MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            ++ L  + Q  H +  + L+ Y A +++          V L    ++HVA         + L+DK AN                 T LH+A   K N +  +  L++ G +I++ T  G TP   A     +    LLL  G   +  N   E+ L ++A     E+++ LL+N    + +     T LH +     R+G    +     + +  +   D++ +  +GY  ++      ++DV  VL +A        H+  T    TP+ +A +  S+     L++  A  +  +  N  T LH+A +   + IA  L+  G+  +  ++ G    V P+H+A Q G  +++ +LL  G++++    + +   +  LHLAA  D  +    LT         +    D++  L                                  T L +A   G+ ++V  LL+ GA+  A+     ++G  P+H A + GH  I+ +    G   +A    G T L  A   G + +++ L
Sbjct:  312 LSPLHMAAQGDHVECVKHLLQYKAPVDD----------VTLDYLTALHVAAHCGHYRVTKLLLDKRAN--------PNARALNGFTPLHIAC--KKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIAS----RLGKTEIVQ----LLLQHMAHPDAATT--NGYTPLHISAREGQVDVASVLLEAGAA-----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADS-AGKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQG----VTPLHLASQEGHTDMVTLLLDKGANIH----MSTKSGLTSLHLAAQEDKVNVADILTK--------HGADRDAYTKL--------------------------------GYTPLIVACHYGNVKMVNFLLKQGANVNAKT----KNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 759          

HSP 7 Score: 55.0694 bits (131), Expect = 7.238e-17
Identity = 80/365 (21.92%), Postives = 147/365 (40.27%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQ---LIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRK-------ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS 1881
            +GH  IV +LL+ GA+P +   R + T LH +  +  ++ +   ++   L+ +              + + +I        + ++L+     D    N +   ++    E +VD+ SV    G +++       +  KK   PL         ++  +LL  R   +       + L +A + N + + S LL  G++ N    Q +T L  + Q+ H  M  LL++ GANI+ +            +   S+H+A           L   GA          +R+  T +    L +     ++  +NFLL+ G N+ +KT  G TP   A +       N+LL  G   NA  A   + L ++
Sbjct:  420 MGHLNIVLLLLQNGASPDVTNIRGE-TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEI--------VQLLLQHMAHPDAATTNGY-TPLHISAREGQVDVASVLLEAGAAHS-------LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMST----------KSGLTSLHLAAQEDKVNVADILTKHGA----------DRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA 747          

HSP 8 Score: 53.5286 bits (127), Expect = 7.238e-17
Identity = 47/201 (23.38%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            ++G++ LH A    +V++A  L+N     ++F   +       + P+H+A + G T+++K+LL R           + P  C      + +  ++L + + P+  +  N           +PLH+    DH++C+K L+Q  K  ++  ++    TAL +A          +LL+  ANPN   ++  +PL  A K+   +
Sbjct:  210 ESGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARN------GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKA-PLLARTKN---------GLSPLHMAAQGDHVECVKHLLQ-YKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIK 391          

HSP 9 Score: 72.0182 bits (175), Expect = 5.737e-12
Identity = 101/438 (23.06%), Postives = 177/438 (40.41%), Query Frame = 1
Query: 1375 SDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYL-IYALQYGNEIDVVR-VLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVL 2682
            ++PN       T L  + +K   K+ ELL+ YGA+I            +  +    IHVA           L+  GA    + D+ + R      T LH+A   ++  +  +  LL  G  ++++  +  TP   A R  K E   LLL      +A      + L +SA +   ++   LL+     +     G T LH        +   Y   D   + + +    DS+   K+GY  ++     N++ +   +L   A+ + V       +TP+ LA +      +  L+  GAN+ ++S+ +  T LH+A +   + +A  L   G++    ++LG      P+ VA   G  +++  LL  G+++N+    K+     PLH AA    T  +  L  Q  A  N  +      N  L +  +   I V   L
Sbjct:  368 ANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQA----------ITESGLTPIHVAAFMGHLNIVLLLLQNGA----SPDVTNIR----GETALHMAA--RAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLH--------VAAKYGSLDVAKLLLQRRAAADSAG--KNGYTPLHIAAKKNQMQIASTLLNYGAETNTV---TKQGVTPLHLASQEGHTDMVTLLLDKGANI-HMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLG----YTPLIVACHYGNVKMVNFLLKQGANVNA----KTKNGYTPLHQAAQQGHTHIINVLL-QHGAKPNATTANG---NTALAIAKRLGYISVVDTL 759          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 199.519 bits (506), Expect = 5.058e-51
Identity = 174/717 (24.27%), Postives = 326/717 (45.47%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   +  ++ LL+   N+++ T KG+T    A    + E   +L+  G + NA +    + L ++A + + E+++FLL N    +     G T L  +  Q          HD     ++ + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +I+    L+   A +++ +  N  T LHVA +  N  + K L+  G+ I  ++R G    + P+H   ++G ++++E+LL      ++ ++ K+   ++PLH+A   D  + V+ L       +  N    D  N  LT                                  LH+AA  G +++ ++LL+  A P A+ +    +G  P+H+A +   + +++L    G S+ A  + GLT +H AA  G V+I+  L+  GA  N     G  +    +HMA+  G  + V+ L++ G+ + A      +D+ T L+I+    + ++++ L++ GA+P+    + G TPLH+  + G      +L+    +SL++    G + LH+ A+ G  E++  LL+   +P+  G+            ++PL+ A  + +  V  LL+  GA  H A       G  P+H AA + +  +  +LLE G   +     G+  +H +  EG  D    L+   ANVN+ +K G  P
Sbjct:   61 LHLAS--KEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQG---------HDQ---VVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNAD---VESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTAR-NDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDG----LTPLHCGARSGHEQVVEMLL----DRSAPILSKTKNGLSPLHMATQGDHLNCVQLL-------LQHNVPVDDVTNDYLT---------------------------------ALHVAAHCGHYKVAKVLLDKKASPNAKAL----NGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETA----LHMAARSGQAEVVRYLVQDGAQVEAKA----KDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-GYTPLHLAAREGHEDVAAFLLD-HGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK----------SGLTPLHVAAHYDNQKVALLLLDQGASPHAA----AKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTP 683          

HSP 2 Score: 188.348 bits (477), Expect = 1.519e-47
Identity = 195/759 (25.69%), Postives = 331/759 (43.61%), Query Frame = 1
Query: 1246 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKID-DNDSSHSLKSGYLIYALQYGNEIDVVRV----LKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPN 3450
            E++ +L+ +  N+N  +    + L++A Q N L +V  LL  G+  ++      T L  ++Q+ H ++  LL+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++ A +  T           ++T LH+A   K  + N +  LL+ G  I++KT  G TP     R    +   +LL R     +      S L ++    +   ++ LLQ+ V  +   N  LTALH                   +  +AK+  D  +S + K+      L    + + +RV    LK  A    V       +TPI +A  M  ++ +  L+ HGA+ N  ++   ET LH+A R+    + + L+  G+ +  +++    ++  P+H++ + G  +I++ LL  G+S N+     +     PLHLAA         FL                                    L  GA +S    ++  +  T LH+AA+ G  E+  LLL+  A P A      + G+ P+H+A    + ++  L  D G S  AA   G T LH AA    +DI   LL+ GAD NA    G  S    +H+A+++GH   V LLL   + +N      N+  LT L++A  E+R NV + L+  GA+ D Q   +G TPLH+ C  G  K + +L+   ++ +N     G ++LH  A++GH  +   LL+   +PN
Sbjct:  104 EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTA--------RNDITPLHVAS--KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALH-------------VAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAV---TESGLTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAK----DDQTPLHISARLGKADIVQQLLQQGASPNAA----TTSGYTPLHLAAREGHEDVAAFL------------------------------------LDHGASLS----ITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA----AGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIAS----VHLAAQEGHVDMVSLLLSRNANVNLS----NKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ-TKMGYTPLHVGCHYGNIKIVNFLLQ-HSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPN 773          

HSP 3 Score: 159.844 bits (403), Expect = 8.816e-39
Identity = 158/570 (27.72%), Postives = 258/570 (45.26%), Query Frame = 1
Query: 2245 LIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQS------------------------ASININSTRSDSFNAL-----LTLVSKR-NVIGVQSVLMAGADVSGKCIVSRSRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTK---FLIGLKANVNIIDKIGKKPKDYAVTANLMSL 3852
            L+ +GAN+N   S N  T L++A +  ++ + + L+  G++  L +  G      P+ VA+Q G D+++ +LL      N T   K   R+  LH+AA  D T     L    +                        A++ +N   +  F A      L + SKR N   V+ +L  GA +  K     +R+  T LH  A+ G  ++V++LL    D  A +++  ++G+ P+H+AT+  HL  V+L     V V    +  LT LH AA+ G   + ++LL   A  NA+A +G      P+H+A +K   + ++LLL++G+ I AV        LT +++A      N++  L+  GA+P+   N  G T LH+  + G  + + YL+    + +        + LH++A  G  ++   LL+   +PN            T+   +PL+ A   GH  V   L+  GA +    +    KG  P+H AA  GK  V   LL+   S D   + GLTPLH   +   YD  K    L+   A+ +   K G  P   A   N M +
Sbjct:  109 LVTNGANVN-AQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDG----FTPLAVALQQGHDQVVSLLLE-----NDT---KGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAK-----TRDGLTPLHCGARSGHEQVVEMLL----DRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNG----FTPLHIACKKNRIRVMELLLKHGASIQAV----TESGLTPIHVAAFMGHVNIVSQLMHHGASPNTT-NVRGETALHMAARSGQAEVVRYLVQ-DGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAA----------TTSGYTPLHLAAREGHEDVAAFLLDHGASL----SITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLH---VAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDI 629          

HSP 4 Score: 120.553 bits (301), Expect = 8.190e-27
Identity = 103/356 (28.93%), Postives = 181/356 (50.84%), Query Frame = 1
Query: 2731 NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIID 3798
            NA+ L  AA+ G  E     ++ G D    +   +++G+  +HLA++ GH+E+V        +V AA   G T LH A+ AG  +++++L+  GA+VNA++ +G      P++MA+++ H + V+ LL+ G    A  S    D  T L +A  +  + V+  L+++     ++   L A  LHI  ++  TKA   L+   +++ +V   +G + LH+ A  G+  ++  LL      + T +           +I+PL+ A   G+  +VKLL+  GA I  A+T +   G+ P+HC A  G   V+  LL+    I    ++GL+PLH +      +C + L  L+ NV + D
Sbjct:   25 NASYLR-AARAGHLEKALDYIKNGVD----VNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNG----FTPLYMAAQENHLEVVRFLLDNG----ASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR---LPA--LHIAARKDDTKAAALLLQ-NDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTAR----------NDITPLHVASKRGNANMVKLLLDRGAKID-AKTRD---GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLL--LQHNVPVDD 345          

HSP 5 Score: 74.3294 bits (181), Expect = 1.123e-12
Identity = 137/604 (22.68%), Postives = 240/604 (39.74%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTK-RHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQ----------FNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASIN 2598
            G+  +V++LL  GA  +I  K R  +TPLH  C + +       + L +SAP  +  K+   L           +NC  L +L+  V +DDV            +C   K+  +L + K   N+          NG   L +  KK     R  ++++LL H  +I        + + +A  +  + +VS L+  G+ PN    +  T+L  + +    ++   L+  GA +      D             +H++      +  Q L+ +GA+              +  T LHLA   +    +   FLL+ G ++   T KG TP   A +Y K+E  +LLL +    +A      + L ++A   N ++   LL      +     G T LH                       AK +  D + SL        L+YG   D   V +Q              +  + LA +   +  +  L+   AN+N +S+ +  T LH+A +   + +A+ L+  G+++  ++++G      P+HV    G  +I+  LL   + +N+    K+      LH AA    T  +  L  Q +AS N
Sbjct:  262 GNANMVKLLLDRGA--KIDAKTRDGLTPLH--CGARSGHEQVVEMLLDRSAP--ILSKTKNGLSPLHMATQGDHLNCVQL-LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKAL-------NGFTPLHIACKKN----RIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQT----------PLHISARLGKADIVQQLLQQGAS--------PNAATTSGYTPLHLAA--REGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH---------------------IAAKKNQMDIATSL--------LEYG--ADANAVTRQG-------------IASVHLAAQEGHVDMVSLLLSRNANVN-LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMG----YTPLHVGCHYGNIKIVNFLLQHSAKVNA----KTKNGYTALHQAAQQGHTHIINVLL-QNNASPN 773          

HSP 6 Score: 60.8474 bits (146), Expect = 1.406e-8
Identity = 53/213 (24.88%), Postives = 100/213 (46.95%), Query Frame = 2
Query:  179 LLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            LL   T   +  K+G++ LH A    ++++A  L+N +   ++F         +++ P+H+A + G  +++K+LL R           + P  C      E +  ++L +S+ PI  +  N           +PLH+    DHL+C+++L+Q   V ++  +     TAL +A      +   VLL+  A+PN   ++  +PL  A K+   R
Sbjct:  204 LLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAA-VDFTAR------NDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSA-PILSKTKN---------GLSPLHMATQGDHLNCVQLLLQH-NVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIR 397          

HSP 7 Score: 54.6842 bits (130), Expect = 1.084e-6
Identity = 50/201 (24.88%), Postives = 84/201 (41.79%), Query Frame = 1
Query: 1369 RGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +G+ P+       T L  + +K    +   L+ YGA+ N           V     AS+H+A      +    L+ + AN+ L+         ++ +T LHLA   + + +N    L+  G +++++T  G TP      Y  I+  N LL      NA      + L  +A + +  I+  LLQN    N+    G TAL
Sbjct:  603 QGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANA----------VTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSN--------KSGLTPLHLAA--QEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTAL 783          

HSP 8 Score: 53.5286 bits (127), Expect = 2.314e-6
Identity = 43/201 (21.39%), Postives = 87/201 (43.28%), Query Frame = 2
Query:  179 LLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLH-NLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRK--TALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAK 772
            LL +         +G++ LH A    H D+A  L++H          S SI       P+H+A ++G+  +  +LLQ++ +P+   +   + L            +       S      + + PLH+    + +D    L++    +    + ++R+   ++ LA +   ++ V++LL   AN N+ + S  +PL  AA+
Sbjct:  501 LLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGA--------SLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLE----YGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQ 689          

HSP 9 Score: 51.6026 bits (122), Expect = 9.074e-6
Identity = 51/210 (24.29%), Postives = 94/210 (44.76%), Query Frame = 2
Query:  179 LLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDA---------WNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            LL +        K G++ LH A   N +DIA  L+        +  ++ ++    +  +H+A + G   ++ +LL RN N  L     KS L  P+ L+         + N+++  V   A         + PLH+   + ++  +  L+Q  AKV  ++++     TAL  A +      +NVLL++ A+PN   ++  + L  A + G
Sbjct:  600 LLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLE-------YGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSN---KSGLT-PLHLAAQE-----DRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGY---TALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLG 790          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 198.749 bits (504), Expect = 5.125e-51
Identity = 183/721 (25.38%), Postives = 329/721 (45.63%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTN-------IFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            LHLA   K   +  +  LL  G +++S T KG+T    A    + E   +L+  G + NA +    + L ++A + + +++K+LL+N  + +     G T L  +  Q     +   + + T        + IA   D+  S +L        LQ  +  DV   +       +V        TP+ +A    +++    L+  GA +++ +  N  T LHVA +  N  + K L+  G  I  ++R G    + P+H A ++G D+++E+LL       + ++ ++   ++PLH+AA  D    VK L  Q  A ++                                DV+   +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G       L+  A ++ ++    G + LH+ A+ G  +++  LL+ +          DS  K     ++PL+ A  + +  V  LL++ GA  H         G  P+H AA + +  +  TLL  G   +   + G+TPLH +  EG  D    L+   AN+++  K G
Sbjct:   64 LHLAA--KEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAAL-------LLQNDHNADVQSKM-------MVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR-NGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDG----LTPLHCAARSGHDQVVELLL----ERKAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QYKAPVD--------------------------------DVTLDYL-------TALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDARA----REEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREGQVDVASVLLE-AGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRA-------AADSAGKN---GLTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSG 691          

HSP 2 Score: 189.889 bits (481), Expect = 3.234e-48
Identity = 198/823 (24.06%), Postives = 382/823 (46.42%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDS--------NQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D N      + +L  + ++ H  + + L+  G++++         S  K  N A +H+A +    E  + L+ +GAN+          + +   T L++A   + N ++ + +LLE G N  + T  G TP   A++    +A  +LL    + +    +    L ++A K + +    LLQN  ++        N+    G T LH           + + +    +D+   +  T + +A    N       +  +   L  G +ID                    VV +L +   P L    N   ++P+ +A + + +  + HL+++ A ++ ++  +  T LHVA    +  + K L+   +N + R+  G      P+H+A +    +++E+L+ +G+S+ +     +   + P+H+AA     + V  L  Q  AS ++ + R ++    L + ++   + V   L+     +G  + +R+R   T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G +++  +  + G + S A   G T LH AA  GS+D+ ++LL+  A  ++   +G    + P+H+A+   ++K   LLLE G+  +A      ++  T L+IA  +N+  +   L+  GA  +      G TPLH+  Q G T  +  L+    +++++   +G++SLHL A++    ++  L +        G   D+++K      +PL  AC +G++ +V  L+K GA+++ A+T  G+    P+H AA +G  H+I  LL+ G   +    +G T L
Sbjct:   50 GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVD---------SATKKGNTA-LHIASLAGQAEVVKVLVKEGANI--------NAQSQNGFTPLYMAA--QENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGN-------TNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNG--LSPLHMAAQGDHVECVKHLLQYKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNG----FTPLHIACKKNRIKVMELLVKYGASIQAI----TESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVTNIRGETA---LHMAARAGQVEVVRCLLR----NGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNG----LTPLHVAAHYDNQKVALLLLEKGASPHATA----KNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQ-GVTPLHLASQEGHTDMVTLLLD-KGANIHMSTKSGLTSLHLAAQEDKVNVADILTK-------HGADRDAYTK---LGYTPLIVACHYGNVKMVNFLLKQGANVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 794          

HSP 3 Score: 184.496 bits (467), Expect = 1.634e-46
Identity = 162/592 (27.36%), Postives = 280/592 (47.30%), Query Frame = 1
Query: 2209 AVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFL------------------------THQQSASINI-NSTRSDSFNALLTLVSKRNVIGVQSVLMAG---ADVSGKCIVSRSRNA--TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT--------------------------GQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            A    ++  +   ++ G ++N  +  N    LH+A +  ++ + +EL+  GS++   ++ G       +H+A   G  E++++L+  G+++N+    +S     PL++AA  +    VK+L                         H Q+ +I + N T+       L + ++++     ++L+     ADV  K +V+R+  +  T LHIAA  G+  +  LLL  GA   A   T  R+GI P+H+A++ G+  +VKL  D G  + A    GLT LH AA +G   ++E+LL+  A + A   +G    + P+HMA++  H + VK LL+Y +P++ V      D LTAL++A       V K L+   ANP+ +  N G TPLHI C++   K +M L+    +S+     +G++ +H+ A  GH  +   LL+   +P++T                          G + D+ +++     +PL+ A   G   +V+LL++  A    A T     G  P+H +A  G+  V   LLEAG +     + G TPLH +   G  D  K L+  +A  +   K G  P
Sbjct:   34 AARAGNLDKVVEYLKGGIDINTCNQ-NGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGN----TALHIASLAGQAEVVKVLVKEGANINA----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGA---AVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNG----LSPLHMAAQGDHVECVKHLLQYKAPVDDV----TLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACKKNRIK-VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ---TPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 595          

HSP 4 Score: 160.614 bits (405), Expect = 3.771e-39
Identity = 170/735 (23.13%), Postives = 316/735 (42.99%), Query Frame = 1
Query: 1639 REVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYIS-------SPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            R+ ++N + L  A   ++ +L+ +   L+ G++I +    G      A +   +     LL RG   ++      + L ++++    E++K L++   + N +   G T L+ +  ++    + Y + +  N   A  D          G+  L  ALQ G+   V  +L+             V +  + +A   +   +   L+++  N +  S       + +  T LH+A    N+ +A  L+  G+ +   +R G    + P+HVA + G   ++++LL  G  +++    K+ + + PLH AA +     V+ L  +++  +   +   +  + L       +V  V+ +L   A V    +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI                                  +A +G  +++  LL              + S  T    +PL+ A  +G L V KLL++  A    A    G  G+ P+H AA      V   LLE G S     ++G TPLH +  +        L+   A  N + K G  P
Sbjct:   23 RQSDSNASFLRAA---RAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATED----------GFTPLAVALQQGHNQAVAILLENDTK-------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNG----ITPLHVASKRGNTNMVKLLLDRGGQIDA----KTRDGLTPLHCAARSGHDQVVELLLERKAPLL---ARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTL----DYLTALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDARA----REEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHI----------------------------------SAREGQVDVASVLLEAGA----------AHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRA----AADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTP 661          

HSP 5 Score: 150.214 bits (378), Expect = 5.698e-36
Identity = 195/821 (23.75%), Postives = 336/821 (40.93%), Query Frame = 1
Query: 1111 KKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANIN-----------------ENVCFDLVLSN-----VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLK----QAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYIS---------------------------SPN-----QETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITG-----------------------------DRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGF 3303
            K + YL  +  +DIN+ C      N NGL+ L +  K+    L +EL    L    +++    K  + L +A       +V  L+  G++ N       T L  + Q+ H  + + L+  GAN +                  N    ++L N     V+L    ++H+A    D ++   L+    N  +   ++  R  E+  T LH+A      ++N    LL  G  ++     G TP   A +        LLL RG   +A      + L  +A   + ++++ LL+ +     +   GL+ LH +   D    + + +      + A +DD      +   YL  AL         RV K    + A+P+   ++     TP+ +A + N I  M  L+++GA++  I+                           SP+      ET LH+A R   + + + L+  G+ +  R+R    EE  P+H+A + G  EI+++LL   +  ++     +     PLH++A          L    +A    +S  +      L + +K   + V  +L+   A AD +GK         T LH+AA   + ++  LLLE GA P A    G                              + G+ P+HLA++ GH ++V L  D G ++  +   GLT LH AA    V++ +IL K GAD +A    G      P+ +A   G+ K V  LL+ G+ +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+
Sbjct:   42 KVVEYL--KGGIDINT-C------NQNGLNALHLAAKEGHVGLVQEL----LGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRL---PALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAA--HYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQ-----YKAPVDD------VTLDYLT-ALHVAAHCGHYRVTKLLLDKRANPNARALNG---FTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAR----EEQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQVDVASVLLEAGAA----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK------NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLG----YTPLIVACHYGNVKMVNFLLKQGANVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAN-GNTALAIAKRLGY 802          

HSP 6 Score: 123.635 bits (309), Expect = 8.532e-28
Identity = 121/477 (25.37%), Postives = 206/477 (43.19%), Query Frame = 1
Query: 2482 NSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIG-VQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLE--YGSPINA--VFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADI------------------HWAET-----------FEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGK 3810
            N   I +S    + L  A   +L   V++L       I+IN+   +  NAL  L +K   +G VQ +L  G+ V      +  +  T LHIA+  G  E+V++L++ GA+  A+     ++G  P+++A +  H+++VK   + G + S A + G T L  A   G    + ILL        E     + ++  +H+A+ K   KS  LLL+  + + + +  + +R      T L+IA      NV   L+  GA  D    N G TPLH+  +RG T  +  L+      ++     G++ LH  A  GH+++   LL  K               +T   +SPL+ A    H+  VK L+++ A +                  H+  T                G  P+H A  + +  V+  L++ G SI    E GLTP+H +   G  +    L+   A+ ++ +  G+
Sbjct:   18 NPPRIRQSDSNASFLRAARAGNLDKVVEYL----KGGIDINTCNQNGLNAL-HLAAKEGHVGLVQELLGRGSSVDS----ATKKGNTALHIASLAGQAEVVKVLVKEGANINAQ----SQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL--------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-GITPLHVASKRGNTNMVKLLLD-RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKA----------PLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGE 461          

HSP 7 Score: 65.0846 bits (157), Expect = 2.859e-20
Identity = 86/395 (21.77%), Postives = 162/395 (41.01%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQ---LIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRK-------ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH  IV +LL+ GA+P +   R + T LH +  +  ++ +   ++   L+ +              + + +I        + ++L+     D    N +   ++    E +VD+ SV    G +++       +  KK   PL         ++  +LL  R   +       + L +A   +   +   LL +G+ P+       T L  + +K   ++   L+NYGA  N           V       +H+A      +    L+DKGAN+ ++         ++ +T LHLA   + + +N  + L + G + ++ T  G TP + A  Y  ++  N LL +G + NA      + L  +A + +  I+  LLQ+    N     G TAL
Sbjct:  437 MGHLNIVLLLLQNGASPDVTNIRGE-TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEI--------VQLLLQHMAHPDAATTNGYT-PLHISAREGQVDVASVLLEAGAAHS-------LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETN----------TVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMS--------TKSGLTSLHLAA--QEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 794          

HSP 8 Score: 55.4546 bits (132), Expect = 2.859e-20
Identity = 47/197 (23.86%), Postives = 92/197 (46.70%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKR 775
            ++G++ LH A    +V++A  L+N     ++F   +       + P+H+A + G T+++K+LL R           + P  C      + +  ++L + + P+  +  N           +PLH+    DH++C+K L+Q  K  ++  ++    TAL +A          +LL+  ANPN   ++  +PL  A K+
Sbjct:  227 ESGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARN------GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKA-PLLARTKN---------GLSPLHMAAQGDHVECVKHLLQY-KAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKK 404          

HSP 9 Score: 97.0561 bits (240), Expect = 1.106e-19
Identity = 127/534 (23.78%), Postives = 229/534 (42.88%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYL-IYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMA-GADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            ++ L  + Q  H +  + L+ Y A +++          V L    ++HVA         + L+DK AN                 T LH+A   K N +  +  L++ G +I++ T  G TP   A     +    LLL  G   +  N   E+ L ++A     E+++ LL+N    + +     T LH +     R+G    +     + +  +   D++ +  +GY  ++      ++DV  VL +A     +        TP+ +A +  S+     L++  A  +  +  N  T LHVA    N  +A  L+  G++ H  ++ G      P+H+A +    +I   LL +G+  N+     + + V PLHLA+    T  V  L   + A+I++ ST+S   +  L L ++ + + V  +L   GAD      +      T L +A   G+ ++V  LL+ GA+  A+     ++G  P+H A + GH  I+ +    G   +A    G T L  A   G + +++ L
Sbjct:  329 LSPLHMAAQGDHVECVKHLLQYKAPVDD----------VTLDYLTALHVAAHCGHYRVTKLLLDKRAN--------PNARALNGFTPLHIAC--KKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIAS----RLGKTEIVQ----LLLQHMAHPDAATT--NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKG--FTPLHVAAKYGSLDVAKLLLQRRAAADS-AGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNG----YTPLHIAAKKNQMQIASTLLNYGAETNTV----TKQGVTPLHLASQEGHTDMVTLLL-DKGANIHM-STKSGLTS--LHLAAQEDKVNVADILTKHGADRDAYTKLGY----TPLIVACHYGNVKMVNFLLKQGANVNAKT----KNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 809          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. UniProt/SwissProt
Match: sp|Q01484|ANK2_HUMAN (Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4)

HSP 1 Score: 206.068 bits (523), Expect = 6.091e-52
Identity = 182/725 (25.10%), Postives = 336/725 (46.34%), Query Frame = 1
Query: 1648 ETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLV--FIHNNVT---MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            +  +  LHLA   K   +  +  LL  G +++S T KG+T    A    + E   +L+  G + NA +    + L ++A + + +++K+LL+N  + +     G T L  +  Q              N  +A + +ND+   ++   L  A +  +      +L+   + D+    + N  T    TP+ +A    +++    L+  GA +++ ++ N  T LHVA +  N  + K L+  G  I  ++R G    + P+H A ++G D+++E+LL  G+ L    + ++   ++PLH+AA  D    VK L  Q  A ++                                DV+   +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G       L+  A ++ ++    G + LH+ A+ G  +++  LL+ +   +  G+            ++PL+ A  + +  V  LL++ GA  H         G  P+H AA + +  +  TLL  G   +   + G+TPLH +  EG  D    L+   AN+++  K G
Sbjct:   62 QNGLNALHLAA--KEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQ------------GHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF-TARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDG----LTPLHCAARSGHDQVVELLLERGAPL----LARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVD--------------------------------DVTLDYL-------TALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREGQVDVASVLLE-AGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK----------NGLTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSG 695          

HSP 2 Score: 205.682 bits (522), Expect = 8.784e-52
Identity = 205/823 (24.91%), Postives = 381/823 (46.29%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDS--------NQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D N      + +L  + ++ H  + + L+  G++++         S  K  N A +H+A +    E  + L+ +GAN+          + +   T L++A   + N ++ + +LLE G N  + T  G TP   A++    +A  +LL    + +    +    L ++A K + +    LLQN  ++        N+    G T LH           + + +    +D+   +  T + +A    N +   L        L  G +ID                    VV +L +   P L    N   ++P+ +A + + +  + HL++H A ++ ++  +  T LHVA    +  + K L+   +N + R+  G      P+H+A +    +++E+L+ +G+S+ +     +   + P+H+AA     + V  L  Q  AS ++ + R ++  AL        V  V+ +L  GA V      +R+R   T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G +++  +  + G + S A   G T LH AA  GS+D+ ++LL+  A  ++   +G    + P+H+A+   ++K   LLLE G+  +A      ++  T L+IA  +N+  +   L+  GA  +I     G TPLH+  Q G T  +  L+    +++++   +G++SLHL A++    ++  L +        G   D+ +K      +PL  AC +G++ +V  L+K GA+++ A+T  G+    P+H AA +G  H+I  LL+ G   +    +G T L
Sbjct:   54 GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVD---------SATKKGNTA-LHIASLAGQAEVVKVLVKEGANI--------NAQSQNGFTPLYMAA--QENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKL-------LLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNG--LSPLHMAAQGDHVECVKHLLQHKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNG----FTPLHIACKKNRIKVMELLVKYGASIQAI----TESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVTNIRGET--ALHMAARAGQVEVVRCLLRNGALVD-----ARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDA----ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNG----LTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQ-GVTPLHLASQEGHTDMVTLLLD-KGANIHMSTKSGLTSLHLAAQEDKVNVADILTK-------HGADQDAHTK---LGYTPLIVACHYGNVKMVNFLLKQGANVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 798          

HSP 3 Score: 193.741 bits (491), Expect = 3.719e-48
Identity = 162/592 (27.36%), Postives = 281/592 (47.47%), Query Frame = 1
Query: 2209 AVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLT------------------------HQQSASINI-NSTRSDSFNALLTLVSKRNVIGVQSVLMAG---ADVSGKCIVSRSRNA--TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT--------------------------GQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            A    ++  +   ++ G ++N   + N    LH+A +  ++ + +EL+  GS++   ++ G       +H+A   G  E++++L+  G+++N+    +S     PL++AA  +    VK+L                         H Q+ +I + N T+       L + ++++     ++L+     ADV  K +V+R+  +  T LHIAA  G+  +  LLL  GA   A   T  R+GI P+H+A++ G+  +VKL  D G  + A    GLT LH AA +G   ++E+LL+ GA + A   +G    + P+HMA++  H + VK LL++ +P++ V      D LTAL++A       V K L+   ANP+ +  N G TPLHI C++   K +M L+    +S+     +G++ +H+ A  GH  +   LL+   +P++T                          G + D+ +++     +PL+ A   G   +V+LL++  A    A T     G  P+H +A  G+  V   LLEAG +     + G TPLH +   G  D  K L+  +A  +   K G  P
Sbjct:   38 AARAGNLDKVVEYLKGGIDIN-TCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGN----TALHIASLAGQAEVVKVLVKEGANINA----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGA---AVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNG----LSPLHMAAQGDHVECVKHLLQHKAPVDDV----TLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACKKNRIK-VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ---TPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 599          

HSP 4 Score: 171.785 bits (434), Expect = 2.028e-41
Identity = 171/735 (23.27%), Postives = 317/735 (43.13%), Query Frame = 1
Query: 1639 REVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIR--HGANLNYISSPNQET-----VLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            ++ ++N + L  A   ++ +L+ +   L+ G++I +    G      A +   +     LL RG   ++      + L ++++    E++K L++   + N +   G T L+ +  ++    + Y + +  N           S + + G+  L  ALQ G+   V  +L+             V +  + +A   +   +   L++  H A++      N+ T      LH+A    N+ +A  L+  G+ +   +R G    + P+HVA + G   ++++LL  G  +++    K+ + + PLH AA +     V+ L  + +  +   +   +  + L       +V  V+ +L   A V    +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G                       ++S+ L A   H                        S  T    +PL+ A  +G L V KLL++  A    A    G  G+ P+H AA      V   LLE G S     ++G TPLH +  +        L+   A  NI+ K G  P
Sbjct:   27 KKSDSNASFLRAA---RAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN----------QSTATEDGFTPLAVALQQGHNQAVAILLENDTK-------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNG----ITPLHVASKRGNTNMVKLLLDRGGQIDA----KTRDGLTPLHCAARSGHDQVVELLLERGAPLL---ARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL----DYLTALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREG--------------------QVDVASVLLEAGAAH------------------------SLATKKGFTPLHVAAKYGSLDVAKLLLQRRA----AADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTP 665          

HSP 5 Score: 164.851 bits (416), Expect = 2.750e-39
Identity = 185/753 (24.57%), Postives = 324/753 (43.03%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS--------------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH-HSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITG-----------------------------DRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            + E++ +L+    NIN  +    + L++A Q N + +V  LL  G++ +       T L  ++Q+ H +   +L+             +  A  ++     L+L N    +  S              +H+A  Y +      L+++GA +  T            +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R    +   LLL RG    A      S L ++A   + E +K LLQ++   +      LTALH  +    +R+         T + + K   N ++ +L     ++     N I V+ +L K  A    +       +TPI +A  M  ++ +  L+++GA+ + +++   ET LH+A R   + + + L+  G+ +  R+R    EE  P+H+A + G  EI+++LL   +  ++     +     PLH++A          L    +A    +S  +      L + +K   + V  +L+   A AD +GK         T LH+AA   + ++  LLLE GA P A    G                              + G+ P+HLA++ GH ++V L  D G ++  +   GLT LH AA    V++ +IL K GAD +A    G      P+ +A   G+ K V  LL+ G+ +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+   +
Sbjct:  109 QAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA--------RNGITPLHVAS--KRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRV---------TKLLLDK-RANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAI---TESGLTPIHVAAFMGHLNIVLLLLQNGASPD-VTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAR----EEQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQVDVASVLLEAGAA----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK------NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLG----YTPLIVACHYGNVKMVNFLLKQGANVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAN-GNTALAIAKRLGYISVV 810          

HSP 6 Score: 128.642 bits (322), Expect = 2.735e-28
Identity = 126/490 (25.71%), Postives = 210/490 (42.86%), Query Frame = 1
Query: 2470 GSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIG-VQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLE--YGSPINA--VFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADI------------------HWAET-----------FEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTA 3837
            GSS       KS    + L  A   +L   V++L       I+IN+   +  NAL  L +K   +G VQ +L  G+ V      +  +  T LHIA+  G  E+V++L++ GA+  A+     ++G  P+++A +  H+++VK   + G + S A + G T L  A   G    + ILL        E     + ++  +H+A+ K   KS  LLL+  + + + +  + +R      T L+IA      NV   L+  GA  D    N G TPLH+  +RG T  +  L+      ++     G++ LH  A  GH+++   LL  +  P L          +T   +SPL+ A    H+  VK L++  A +                  H+  T                G  P+H A  + +  V+  L++ G SI    E GLTP+H +   G  +    L+   A+ ++ +  G+     A  A
Sbjct:   18 GSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYL----KGGIDINTCNQNGLNAL-HLAAKEGHVGLVQELLGRGSSVDS----ATKKGNTALHIASLAGQAEVVKVLVKEGANINAQ----SQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL--------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-GITPLHVASKRGNTNMVKLLLD-RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLE-RGAPLLA---------RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARA 474          

HSP 7 Score: 98.9821 bits (245), Expect = 3.214e-19
Identity = 122/539 (22.63%), Postives = 230/539 (42.67%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSL--KSGY--LIYALQYGNEIDVVRVLKQ---AADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            +T+L  +    H ++T+LL++  AN N             L     +H+A   +  +  + L+  GA++        +   E+ +T +H+A  +    LN +  LL+ G + +    +G+T    A R  ++E    LL  G   +A     ++ L +++     EI++ LLQ+    +     G T LH S  ++ ++       D  ++ +    +  ++HSL  K G+  L  A +YG+ +DV ++L Q   AAD           +TP+ +A   ++      L+  GA+  + ++ N  T LH+A +   + IA  L+  G+  ++ ++ G    V P+H+A Q G  +++ +LL  G++++    + +   +  LHLAA  D  +    LT                                      GAD      +      T L +A   G+ ++V  LL+ GA+  A+     ++G  P+H A + GH  I+ +    G   +A    G T L  A   G + +++ L
Sbjct:  366 LTALHVAAHCGHYRVTKLLLDKRANPNARA----------LNGFTPLHIACKKNRIKVMELLVKYGASI--------QAITESGLTPIHVAAFM--GHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHIS-AREGQV-------DVASVLL----EAGAAHSLATKKGFTPLHVAAKYGS-LDVAKLLLQRRAAADS-----AGKNGLTPLHVAAHYDNQKVALLLLEKGAS-PHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQG----VTPLHLASQEGHTDMVTLLLDKGANIH----MSTKSGLTSLHLAAQEDKVNVADILTKH------------------------------------GADQDAHTKLGY----TPLIVACHYGNVKMVNFLLKQGANVNAKT----KNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 8 Score: 63.5438 bits (153), Expect = 1.048e-18
Identity = 86/395 (21.77%), Postives = 166/395 (42.03%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQ---LIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRK-------ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH  IV +LL+ GA+P +   R + T LH +  +  ++ +   ++   L+ +              + + +I        + ++L+     D    N +   ++    E +VD+ SV    G +++       +  KK   PL         ++  +LL  R   +       + L +A   +   +   LL +G+ P+       T L  + +K   ++   L+NYGA  N       +++   +T    +H+A      +    L+DKGAN+ ++         ++ +T LHLA   + + +N  + L + G + ++ T  G TP + A  Y  ++  N LL +G + NA      + L  +A + +  I+  LLQ+    N     G TAL
Sbjct:  441 MGHLNIVLLLLQNGASPDVTNIRGE-TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEI--------VQLLLQHMAHPDAATTNGY-TPLHISAREGQVDVASVLLEAGAAHS-------LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETN-------IVTKQGVT---PLHLASQEGHTDMVTLLLDKGANIHMS--------TKSGLTSLHLAA--QEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 798          

HSP 9 Score: 53.9138 bits (128), Expect = 1.048e-18
Identity = 47/201 (23.38%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            ++G++ LH A    +V++A  L+N     ++F   +       + P+H+A + G T+++K+LL R           + P  C      + +  ++L + + P+  +  N           +PLH+    DH++C+K L+Q  K  ++  ++    TAL +A          +LL+  ANPN   ++  +PL  A K+   +
Sbjct:  231 ESGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARN------GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGA-PLLARTKN---------GLSPLHMAAQGDHVECVKHLLQH-KAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIK 412          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 2.600e-51
Identity = 180/725 (24.83%), Postives = 335/725 (46.21%), Query Frame = 1
Query: 1648 ETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLV--FIHNNVT---MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            +  +  LHLA   K   +  +  LL  G +++S T KG+T    A    + E   +L+  G + NA +    + L ++A + + +++K+LL+N  + +     G T L  +  Q              N  +A + +ND+   ++   L  A +  +      +L+   + D+    + N  T    TP+ +A    +++    L+  GA +++ ++ N  T LHVA +  N  + K L+  G  I  ++R G    + P+H A ++G D+++E+LL       + ++ ++   ++PLH+AA  D    VK L  Q  A ++                                DV+   +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G       L+  A ++ ++    G + LH+ A+ G  +++  LL+ +   +  G+            ++PL+ A  + +  V  LL++ GA  H         G  P+H AA + +  +  TLL  G   +   + G+TPLH +  EG  D    L+   AN+++  K G
Sbjct:   62 QNGLNALHLAA--KEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQ------------GHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDF-TARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDG----LTPLHCAARSGHDQVVELLL----ERKAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QYKAPVD--------------------------------DVTLDYL-------TALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREGQVDVASVLLE-AGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK----------NGLTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSG 695          

HSP 2 Score: 202.216 bits (513), Expect = 8.631e-51
Identity = 203/823 (24.67%), Postives = 381/823 (46.29%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDS--------NQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRN-ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D N      + +L  + ++ H  + + L+  G++++         S  K  N A +H+A +    E  + L+ +GAN+          + +   T L++A   + N ++ + +LLE G N  + T  G TP   A++    +A  +LL    + +    +    L ++A K + +    LLQN  ++        N+    G T LH           + + +    +D+   +  T + +A    N +   L        L  G +ID                    VV +L +   P L    N   ++P+ +A + + +  + HL+++ A ++ ++  +  T LHVA    +  + K L+   +N + R+  G      P+H+A +    +++E+L+ +G+S+ +     +   + P+H+AA     + V  L  Q  AS ++ + R ++  AL        V  V+ +L  GA V      +R+R   T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G +++  +  + G + S A   G T LH AA  GS+D+ ++LL+  A  ++   +G    + P+H+A+   ++K   LLLE G+  +A      ++  T L+IA  +N+  +   L+  GA  +      G TPLH+  Q G T  +  L+    +++++   +G++SLHL A++    ++  L +        G   D+++K      +PL  AC +G++ +V  L+K GA+++ A+T  G+    P+H AA +G  H+I  LL+ G   +    +G T L
Sbjct:   54 GIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVD---------SATKKGNTA-LHIASLAGQAEVVKVLVKEGANI--------NAQSQNGFTPLYMAA--QENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKL-------LLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNG--LSPLHMAAQGDHVECVKHLLQYKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNG----FTPLHIACKKNRIKVMELLVKYGASIQAI----TESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVTNIRGET--ALHMAARAGQVEVVRCLLRNGALVD-----ARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDA----ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNG----LTPLHVAAHYDNQKVALLLLEKGASPHAT----AKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQ-GVTPLHLASQEGHTDMVTLLLD-KGANIHMSTKSGLTSLHLAAQEDKVNVADILTK-------HGADRDAYTK---LGYTPLIVACHYGNVKMVNFLLKQGANVN-AKTKNGYT---PLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 798          

HSP 3 Score: 192.971 bits (489), Expect = 7.063e-48
Identity = 162/592 (27.36%), Postives = 280/592 (47.30%), Query Frame = 1
Query: 2209 AVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLT------------------------HQQSASINI-NSTRSDSFNALLTLVSKRNVIGVQSVLMAG---ADVSGKCIVSRSRNA--TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT--------------------------GQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            A    ++  +   ++ G ++N   + N    LH+A +  ++ + +EL+  GS++   ++ G       +H+A   G  E++++L+  G+++N+    +S     PL++AA  +    VK+L                         H Q+ +I + N T+       L + ++++     ++L+     ADV  K +V+R+  +  T LHIAA  G+  +  LLL  GA   A   T  R+GI P+H+A++ G+  +VKL  D G  + A    GLT LH AA +G   ++E+LL+  A + A   +G    + P+HMA++  H + VK LL+Y +P++ V      D LTAL++A       V K L+   ANP+ +  N G TPLHI C++   K +M L+    +S+     +G++ +H+ A  GH  +   LL+   +P++T                          G + D+ +++     +PL+ A   G   +V+LL++  A    A T     G  P+H +A  G+  V   LLEAG +     + G TPLH +   G  D  K L+  +A  +   K G  P
Sbjct:   38 AARAGNLDKVVEYLKGGIDIN-TCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGN----TALHIASLAGQAEVVKVLVKEGANINA----QSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGA---AVDFTA-RNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNG----LSPLHMAAQGDHVECVKHLLQYKAPVDDV----TLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALN-GFTPLHIACKKNRIK-VMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ---TPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 599          

HSP 4 Score: 171.014 bits (432), Expect = 3.474e-41
Identity = 170/735 (23.13%), Postives = 317/735 (43.13%), Query Frame = 1
Query: 1639 REVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIR--HGANLNYISSPNQET-----VLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            ++ ++N + L  A   ++ +L+ +   L+ G++I +    G      A +   +     LL RG   ++      + L ++++    E++K L++   + N +   G T L+ +  ++    + Y + +  N           S + + G+  L  ALQ G+   V  +L+             V +  + +A   +   +   L++  H A++      N+ T      LH+A    N+ +A  L+  G+ +   +R G    + P+HVA + G   ++++LL  G  +++    K+ + + PLH AA +     V+ L  +++  +   +   +  + L       +V  V+ +L   A V    +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G                       ++S+ L A   H                        S  T    +PL+ A  +G L V KLL++  A    A    G  G+ P+H AA      V   LLE G S     ++G TPLH +  +        L+   A  N + K G  P
Sbjct:   27 KKSDSNASFLRAA---RAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGAN----------QSTATEDGFTPLAVALQQGHNQAVAILLENDTK-------GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNG----ITPLHVASKRGNTNMVKLLLDRGGQIDA----KTRDGLTPLHCAARSGHDQVVELLLERKAPLL---ARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTL----DYLTALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA----LHMAARAGQVEVVRCLLRNGALVDA----RAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREG--------------------QVDVASVLLEAGAAH------------------------SLATKKGFTPLHVAAKYGSLDVAKLLLQRRA----AADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTP 665          

HSP 5 Score: 159.844 bits (403), Expect = 9.335e-38
Identity = 184/753 (24.44%), Postives = 322/753 (42.76%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS--------------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH-HSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITG-----------------------------DRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
            + E++ +L+    NIN  +    + L++A Q N + +V  LL  G++ +       T L  ++Q+ H +   +L+             +  A  ++     L+L N    +  S              +H+A  Y +      L+++GA +  T            +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R    +   LLL R     A      S L ++A   + E +K LLQ +   +      LTALH  +    +R+         T + + K   N ++ +L     ++     N I V+ +L K  A    +       +TPI +A  M  ++ +  L+++GA+ + +++   ET LH+A R   + + + L+  G+ +  R+R    EE  P+H+A + G  EI+++LL   +  ++     +     PLH++A          L    +A    +S  +      L + +K   + V  +L+   A AD +GK         T LH+AA   + ++  LLLE GA P A    G                              + G+ P+HLA++ GH ++V L  D G ++  +   GLT LH AA    V++ +IL K GAD +A    G      P+ +A   G+ K V  LL+ G+ +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+   +
Sbjct:  109 QAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA--------RNGITPLHVAS--KRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRV---------TKLLLDK-RANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAI---TESGLTPIHVAAFMGHLNIVLLLLQNGASPD-VTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAR----EEQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQVDVASVLLEAGAA----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGK------NGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLG----YTPLIVACHYGNVKMVNFLLKQGANVNAK----TKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTAN-GNTALAIAKRLGYISVV 810          

HSP 6 Score: 131.339 bits (329), Expect = 3.691e-29
Identity = 127/490 (25.92%), Postives = 211/490 (43.06%), Query Frame = 1
Query: 2470 GSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIG-VQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLE--YGSPINA--VFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADI------------------HWAET-----------FEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTA 3837
            GSS       KS    + L  A   +L   V++L       I+IN+   +  NAL  L +K   +G VQ +L  G+ V      +  +  T LHIA+  G  E+V++L++ GA+  A+     ++G  P+++A +  H+++VK   + G + S A + G T L  A   G    + ILL        E     + ++  +H+A+ K   KS  LLL+  + + + +  + +R      T L+IA      NV   L+  GA  D    N G TPLH+  +RG T  +  L+      ++     G++ LH  A  GH+++   LL  K  P L          +T   +SPL+ A    H+  VK L+++ A +                  H+  T                G  P+H A  + +  V+  L++ G SI    E GLTP+H +   G  +    L+   A+ ++ +  G+     A  A
Sbjct:   18 GSSQRRKRPKKSDSNASFLRAARAGNLDKVVEYL----KGGIDINTCNQNGLNAL-HLAAKEGHVGLVQELLGRGSSVDS----ATKKGNTALHIASLAGQAEVVKVLVKEGANINAQ----SQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILL--------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-GITPLHVASKRGNTNMVKLLLD-RGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKA-PLLA---------RTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARA 474          

HSP 7 Score: 100.908 bits (250), Expect = 7.989e-20
Identity = 129/537 (24.02%), Postives = 231/537 (43.02%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYL-IYALQYGNEIDVVRVLKQAADPDLVFIHNNVT---MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMA-GADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            ++ L  + Q  H +  + L+ Y A +++          V L    ++HVA         + L+DK AN                 T LH+A   K N +  +  L++ G +I++ T  G TP   A     +    LLL  G   +  N   E+ L ++A     E+++ LL+N    + +     T LH +     R+G    +     + +  +   D++ +  +GY  ++      ++DV  VL +A        H+  T    TP+ +A +  S+     L++  A  +  +  N  T LHVA    N  +A  L+  G++ H  ++ G      P+H+A +    +I   LL +G+  N+     + + V PLHLA+    T  V  L   + A+I++ ST+S   +  L L ++ + + V  +L   GAD      +      T L +A   G+ ++V  LL+ GA+  A+     ++G  P+H A + GH  I+ +    G   +A    G T L  A   G + +++ L
Sbjct:  333 LSPLHMAAQGDHVECVKHLLQYKAPVDD----------VTLDYLTALHVAAHCGHYRVTKLLLDKRAN--------PNARALNGFTPLHIAC--KKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIAS----RLGKTEIVQ----LLLQHMAHPDAATT--NGYTPLHISAREGQVDVASVLLEAGAA-----HSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADS-AGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNG----YTPLHIAAKKNQMQIASTLLNYGAETNTV----TKQGVTPLHLASQEGHTDMVTLLL-DKGANIHM-STKSGLTS--LHLAAQEDKVNVADILTKHGADRDAYTKLGY----TPLIVACHYGNVKMVNFLLKQGANVNAKT----KNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 8 Score: 64.3142 bits (155), Expect = 9.581e-19
Identity = 86/395 (21.77%), Postives = 162/395 (41.01%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQ---LIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRK-------ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH  IV +LL+ GA+P +   R + T LH +  +  ++ +   ++   L+ +              + + +I        + ++L+     D    N +   ++    E +VD+ SV    G +++       +  KK   PL         ++  +LL  R   +       + L +A   +   +   LL +G+ P+       T L  + +K   ++   L+NYGA  N           V       +H+A      +    L+DKGAN+ ++         ++ +T LHLA   + + +N  + L + G + ++ T  G TP + A  Y  ++  N LL +G + NA      + L  +A + +  I+  LLQ+    N     G TAL
Sbjct:  441 MGHLNIVLLLLQNGASPDVTNIRGE-TALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEI--------VQLLLQHMAHPDAATTNGY-TPLHISAREGQVDVASVLLEAGAAHS-------LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETN----------TVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMS--------TKSGLTSLHLAA--QEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTAL 798          

HSP 9 Score: 53.5286 bits (127), Expect = 9.581e-19
Identity = 47/201 (23.38%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            ++G++ LH A    +V++A  L+N     ++F   +       + P+H+A + G T+++K+LL R           + P  C      + +  ++L + + P+  +  N           +PLH+    DH++C+K L+Q  K  ++  ++    TAL +A          +LL+  ANPN   ++  +PL  A K+   +
Sbjct:  231 ESGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARN------GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKA-PLLARTKN---------GLSPLHMAAQGDHVECVKHLLQ-YKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIK 412          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 9.924e-50
Identity = 174/717 (24.27%), Postives = 326/717 (45.47%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   +  ++ LL+   N+++ T KG+T    A    + E   +L+  G + NA +    + L ++A + + E+++FLL N    +     G T L  +  Q          HD     ++ + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +I+    L+   A +++ +  N  T LHVA +  N  + K L+  G+ I  ++R G    + P+H   ++G ++++E+LL      ++ ++ K+   ++PLH+A   D  + V+ L       +  N    D  N  LT                                  LH+AA  G +++ ++LL+  A P A+ +    +G  P+H+A +   + +++L    G S+ A  + GLT +H AA  G V+I+  L+  GA  N     G  +    +HMA+  G  + V+ L++ G+ + A      +D+ T L+I+    + ++++ L++ GA+P+    + G TPLH+  + G      +L+    +SL++    G + LH+ A+ G  E++  LL+   +P+  G+            ++PL+ A  + +  V  LL+  GA  H A       G  P+H AA + +  +  +LLE G   +     G+  +H +  EG  D    L+   ANVN+ +K G  P
Sbjct:   61 LHLAS--KEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQG---------HDQ---VVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNAD---VESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTAR-NDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDG----LTPLHCGARSGHEQVVEMLL----DRSAPILSKTKNGLSPLHMATQGDHLNCVQLL-------LQHNVPVDDVTNDYLT---------------------------------ALHVAAHCGHYKVAKVLLDKKASPNAKAL----NGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETA----LHMAARSGQAEVVRYLVQDGAQVEAKA----KDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-GYTPLHLAAREGHEDVAAFLLD-HGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK----------SGLTPLHVAAHYDNQKVALLLLDQGASPHAA----AKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTP 683          

HSP 2 Score: 186.808 bits (473), Expect = 3.458e-46
Identity = 207/807 (25.65%), Postives = 349/807 (43.25%), Query Frame = 1
Query: 1105 HIKKINYLLS-EYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKID-DNDSSHSLKSGYLIYALQYGNEIDVVRV----LKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPN 3450
            H++ ++ LL  E  VD     T  G   N  LHI  +  +        E++ +L+ +  N+N  +    + L++A Q N L +V  LL  G+  ++      T L  ++Q+ H ++  LL+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++ A +  T           ++T LH+A   K  + N +  LL+ G  I++KT  G TP     R    +   +LL R     +      S L ++    +   ++ LLQ+ V  +   N  LTALH                   +  +AK+  D  +S + K+      L    + + +RV    LK  A    V       +TPI +A  M  ++ +  L+ HGA+ N  ++   ET LH+A R+    + + L+  G+ +  +++    ++  P+H++ + G  +I++ LL  G+S N+     +     PLHLAA         FL                                    L  GA +S    ++  +  T LH+AA+ G  E+  LLL+  A P A      + G+ P+H+A    + ++  L  D G S  AA   G T LH AA    +DI   LL+ GAD NA    G  S    +H+A+++GH   V LLL   + +N      N+  LT L++A  E+R NV + L+  GA+ D Q   +G TPLH+ C  G  K + +L+   ++ +N     G ++LH  A++GH  +   LL+   +PN
Sbjct:   69 HVEVVSELLQREANVD---AATKKG---NTALHIASLAGQA-------EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTA--------RNDITPLHVAS--KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALH-------------VAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAV---TESGLTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAK----DDQTPLHISARLGKADIVQQLLQQGASPNAA----TTSGYTPLHLAAREGHEDVAAFL------------------------------------LDHGASLS----ITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA----AGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIAS----VHLAAQEGHVDMVSLLLSRNANVNLS----NKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ-TKMGYTPLHVGCHYGNIKIVNFLLQ-HSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPN 773          

HSP 3 Score: 158.688 bits (400), Expect = 1.399e-37
Identity = 158/570 (27.72%), Postives = 258/570 (45.26%), Query Frame = 1
Query: 2245 LIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQS------------------------ASININSTRSDSFNAL-----LTLVSKR-NVIGVQSVLMAGADVSGKCIVSRSRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTK---FLIGLKANVNIIDKIGKKPKDYAVTANLMSL 3852
            L+ +GAN+N   S N  T L++A +  ++ + + L+  G++  L +  G      P+ VA+Q G D+++ +LL      N T   K   R+  LH+AA  D T     L    +                        A++ +N   +  F A      L + SKR N   V+ +L  GA +  K     +R+  T LH  A+ G  ++V++LL    D  A +++  ++G+ P+H+AT+  HL  V+L     V V    +  LT LH AA+ G   + ++LL   A  NA+A +G      P+H+A +K   + ++LLL++G+ I AV        LT +++A      N++  L+  GA+P+   N  G T LH+  + G  + + YL+    + +        + LH++A  G  ++   LL+   +PN            T+   +PL+ A   GH  V   L+  GA +    +    KG  P+H AA  GK  V   LL+   S D   + GLTPLH   +   YD  K    L+   A+ +   K G  P   A   N M +
Sbjct:  109 LVTNGANVN-AQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDG----FTPLAVALQQGHDQVVSLLLE-----NDT---KGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAK-----TRDGLTPLHCGARSGHEQVVEMLL----DRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNG----FTPLHIACKKNRIRVMELLLKHGASIQAV----TESGLTPIHVAAFMGHVNIVSQLMHHGASPNTT-NVRGETALHMAARSGQAEVVRYLVQ-DGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAA----------TTSGYTPLHLAAREGHEDVAAFLLDHGASL----SITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLH---VAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDI 629          

HSP 4 Score: 119.783 bits (299), Expect = 1.303e-25
Identity = 103/356 (28.93%), Postives = 181/356 (50.84%), Query Frame = 1
Query: 2731 NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIID 3798
            NA+ L  AA+ G  E     ++ G D    +   +++G+  +HLA++ GH+E+V        +V AA   G T LH A+ AG  +++++L+  GA+VNA++ +G      P++MA+++ H + V+ LL+ G    A  S    D  T L +A  +  + V+  L+++     ++   L A  LHI  ++  TKA   L+   +++ +V   +G + LH+ A  G+  ++  LL      + T +           +I+PL+ A   G+  +VKLL+  GA I  A+T +   G+ P+HC A  G   V+  LL+    I    ++GL+PLH +      +C + L  L+ NV + D
Sbjct:   25 NASYLR-AARAGHLEKALDYIKNGVD----VNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNG----FTPLYMAAQENHLEVVRFLLDNG----ASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR---LPA--LHIAARKDDTKAAALLLQ-NDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTAR----------NDITPLHVASKRGNANMVKLLLDRGAKID-AKTRD---GLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLL--LQHNVPVDD 345          

HSP 5 Score: 73.559 bits (179), Expect = 1.611e-11
Identity = 137/604 (22.68%), Postives = 240/604 (39.74%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTK-RHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQ----------FNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASIN 2598
            G+  +V++LL  GA  +I  K R  +TPLH  C + +       + L +SAP  +  K+   L           +NC  L +L+  V +DDV            +C   K+  +L + K   N+          NG   L +  KK     R  ++++LL H  +I        + + +A  +  + +VS L+  G+ PN    +  T+L  + +    ++   L+  GA +      D             +H++      +  Q L+ +GA+              +  T LHLA   +    +   FLL+ G ++   T KG TP   A +Y K+E  +LLL +    +A      + L ++A   N ++   LL      +     G T LH                       AK +  D + SL        L+YG   D   V +Q              +  + LA +   +  +  L+   AN+N +S+ +  T LH+A +   + +A+ L+  G+++  ++++G      P+HV    G  +I+  LL   + +N+    K+      LH AA    T  +  L  Q +AS N
Sbjct:  262 GNANMVKLLLDRGA--KIDAKTRDGLTPLH--CGARSGHEQVVEMLLDRSAP--ILSKTKNGLSPLHMATQGDHLNCVQL-LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKAL-------NGFTPLHIACKKN----RIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQT----------PLHISARLGKADIVQQLLQQGAS--------PNAATTSGYTPLHLAA--REGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH---------------------IAAKKNQMDIATSL--------LEYG--ADANAVTRQG-------------IASVHLAAQEGHVDMVSLLLSRNANVN-LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMG----YTPLHVGCHYGNIKIVNFLLQHSAKVNA----KTKNGYTALHQAAQQGHTHIINVLL-QNNASPN 773          

HSP 6 Score: 60.8474 bits (146), Expect = 1.138e-7
Identity = 53/213 (24.88%), Postives = 100/213 (46.95%), Query Frame = 2
Query:  179 LLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            LL   T   +  K+G++ LH A    ++++A  L+N +   ++F         +++ P+H+A + G  +++K+LL R           + P  C      E +  ++L +S+ PI  +  N           +PLH+    DHL+C+++L+Q   V ++  +     TAL +A      +   VLL+  A+PN   ++  +PL  A K+   R
Sbjct:  204 LLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAA-VDFTAR------NDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSA-PILSKTKN---------GLSPLHMATQGDHLNCVQLLLQH-NVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIR 397          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 197.593 bits (501), Expect = 2.434e-49
Identity = 177/717 (24.69%), Postives = 329/717 (45.89%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   +  ++ LL+   N+++ T KG+T    A    + E   +L+  G + NA +    + L ++A + + E++KFLL N    +     G T L  +  Q          HD     ++ + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +I+    L+   A +++ +  N  T LHVA +  N  + K L+  G+ I  ++R G    + P+H   ++G ++++E+LL   + +    + K+   ++PLH+A   D  + V+ L       +  N    D  N  LT                                  LH+AA  G +++ ++LL+  A+P A+ +    +G  P+H+A +   +++++L    G S+ A  + GLT +H AA  G V+I+  L+  GA  N     G  +    +HMA+  G  + V+ L++ G+ + A      +D+ T L+I+    + ++++ L++ GA+P+    + G TPLH++ + G      +L+    +SL++    G + LH+ A+ G  E++  LL+   +P+  G+            ++PL+ A  + +  V  LL+  GA  H A       G  P+H AA + +  +  TLLE G   +     G+  +H +  EG  D    L+G  ANVN+ +K G  P
Sbjct:   78 LHLAS--KEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQG---------HDQ---VVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNAD---VESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTAR-NDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDG----LTPLHCGARSGHEQVVEMLLDRAAPI----LSKTKNGLSPLHMATQGDHLNCVQLL-------LQHNVPVDDVTNDYLT---------------------------------ALHVAAHCGHYKVAKVLLDKKANPNAKAL----NGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETA----LHMAARSGQAEVVRYLVQDGAQVEAKA----KDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-GYTPLHLSAREGHEDVAAFLLD-HGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGK----------SGLTPLHVAAHYDNQKVALLLLDQGASPHAA----AKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTP 700          

HSP 2 Score: 174.096 bits (440), Expect = 3.750e-42
Identity = 195/805 (24.22%), Postives = 365/805 (45.34%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH----------HSFIQDFRIGIDYFIH-DSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEID--------------------VVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDE 3693
            G D NI     + +L  + ++ H ++   L+   AN++         +  K  N A +H+A +    E  + L+  GAN+          + +   T L++A   + N L  + FLL+ G +    T  G TP   A++    +  +LLL    + +    +    L ++A K + +    LLQN  +++ +   G T LH           + + +    +D+    D T + +A    N       +  +   L  G +ID                    VV +L   A P L    N   ++P+ +A + + ++ +  L++H   ++ +++ +  T LHVA    +  +AK L+   +N + ++  G      P+H+A +    +++E+LL  G+S+ +     +   + P+H+AA     + V  L H   AS N  + R ++  AL           V+ ++  GA V  K       + T LHI+A++G  +IVQ LL+ GA P A   +G      P+HL+   GH ++     D G S+S     G T LH AA  G +++  +LL+  A  +A      +S + P+H+A+   ++K   LLL+ G+  +A      ++  T L+IA  +N+ ++   L++ GA+ +      G   +H+  Q G    +  L+G  N+++N+   +G++ LHL A++    ++  L+         G   D+   +T    +PL+  C +G++ +V  L++  A ++ A+T  G+    P+H AA +G  H+I  LL+   S +E
Sbjct:   64 GVDINICNQNGLNALHLASKEGHVEVVSELLQREANVD---------AATKKGNTA-LHIASLAGQAEVVKVLVTNGANV--------NAQSQNGFTPLYMAA--QENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGN-------ANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNG--LSPLHMATQGDHLNCVQLLLQHNVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNG----FTPLHIACKKNRIKVMELLLKHGASIQAV----TESGLTPIHVAAFMGHVNIVSQLMHH-GASPNTTNVRGET--ALHMAARSGQAEVVRYLVQDGAQVEAKA----KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSG----YTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDA----AGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAA----KNGYTPLHIAAKKNQMDIATTLLEYGADANAV-TRQGIASVHLAAQEGHVDMVSLLLG-RNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVN-------QGAHVDA---QTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVN-AKTKNGY---TPLHQAAQQGHTHIINVLLQNNASPNE 791          

HSP 3 Score: 146.362 bits (368), Expect = 1.245e-33
Identity = 189/765 (24.71%), Postives = 335/765 (43.79%), Query Frame = 1
Query: 1105 HIKKINYLLS-EYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSR--------------------------SRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPD 3246
            H++ ++ LL  E  VD     T  G   N  LHI  +         + E++ +L+ +  N+N  +    + L++A Q N L +V  LL  G+  ++      T L  ++Q+ H ++  LL+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++ A +  T           ++T LH+A   K  + N +  LL+ G  I++KT  G TP     R    +   +LL R     +      S L ++    +   ++ LLQ+ V  +   N  LTALH        +      +    + + K   N ++ +L     ++     N I V+ +L K  A    V       +TPI +A  M  ++ +  L+ HGA+ N  +    ET LH+A R+    + + L+  G+ +  +++  Q     P+H++ + G  +I++ LL  G+S N+     +     PLHL+A         FL     AS++I + +   F  L  + +K   + V ++L+   A  D +GK  ++                           ++N  T LHIAA+    +I   LLEYGAD  A  +T  R GI  VHLA + GH+++V L      +V+ +   GLT LH AA    V++ E+L+  GA V+A+   G      P+H+    G+ K V  LL++ + +NA      ++  T L+ A  +   +++  L+++ A+P+
Sbjct:   86 HVEVVSELLQREANVD---AATKKG---NTALHIASLAG-------QAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTA--------RNDITPLHVAS--KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALH--------VAAHCGHYKVAKVLLDK-KANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAV---TESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNV-RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQ----TPLHISARLGKADIVQQLLQQGASPNAA----TTSGYTPLHLSAREGHEDVAAFLL-DHGASLSITTKKG--FTPL-HVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGAD--ANAVT--RQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMG----YTPLHVGCHYGNIKIVNFLLQHSAKVNA----KTKNGYTPLHQAAQQGHTHIINVLLQNNASPN 790          

HSP 4 Score: 120.939 bits (302), Expect = 6.911e-26
Identity = 105/356 (29.49%), Postives = 181/356 (50.84%), Query Frame = 1
Query: 2731 NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIID 3798
            NA+ L  AA+ G  E     ++ G D    +   +++G+  +HLA++ GH+E+V        +V AA   G T LH A+ AG  +++++L+  GA+VNA++ +G      P++MA+++ H + VK LL+ G    A  S    D  T L +A  +  + V+  L+++     ++   L A  LHI  ++  TKA   L+   N++ +V   +G + LH+ A  G+  ++  LL      + T +           +I+PL+ A   G+  +VKLL+  GA I  A+T +   G+ P+HC A  G   V+  LL+    I    ++GL+PLH +      +C + L  L+ NV + D
Sbjct:   42 NASYLR-AARAGHLEKALDYIKNGVD----INICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNG----FTPLYMAAQENHLEVVKFLLDNG----ASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR---LPA--LHIAARKDDTKAAALLLQNDNNA-DVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTAR----------NDITPLHVASKRGNANMVKLLLDRGAKID-AKTRD---GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLL--LQHNVPVDD 362          

HSP 5 Score: 90.1225 bits (222), Expect = 1.446e-16
Identity = 127/584 (21.75%), Postives = 229/584 (39.21%), Query Frame = 1
Query: 1252 IDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            + +LL H + +++  +   + L +A       +   LL + ++PN       T L  + +K   K+ ELL+ +GA+I            V  +    IHVA           L+  GA+   T ++  E       T LH+A   +S     + +L++ G  +E+K     TP   + R  K +    LL +G   NA      + L LSA + + ++  FLL +    +     G T LH                                          A +YG +++V  +L +++A PD         +TP+ +A   ++      L+  GA+  + ++ N  T LH+A +   + IA  L+  G++ +  +R G    +  +H+A Q G  +++ +LL   +++N    L +   + PLHLAA  D  +  + L +Q                                    GA V  +  +      T LH+    G+ +IV  LL++ A   A+     ++G  P+H A + GH  I+ +      S +     G T L  A   G + +++ L
Sbjct:  350 VQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQ----------AVTESGLTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGE-------TALHMAA--RSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLH-----------------------------------------VAAKYG-KLEVANLLLQKSASPDAA---GKSGLTPLHVAAHYDNQKVALLLLDQGAS-PHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQG----IASVHLAAQEGHVDMVSLLLGRNANVN----LSNKSGLTPLHLAAQEDRVNVAEVLVNQ------------------------------------GAHVDAQTKM----GYTPLHVGCHYGNIKIVNFLLQHSAKVNAKT----KNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 6 Score: 57.3806 bits (137), Expect = 8.346e-10
Identity = 51/213 (23.94%), Postives = 99/213 (46.48%), Query Frame = 2
Query:  179 LLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            LL       +  K+G++ LH A    ++++A  L+N +   ++F   +      ++ P+H+A + G  +++K+LL R           + P  C      E +  ++L +++ PI  +  N           +PLH+    DHL+C+++L+Q   V ++  +     TAL +A      +   VLL+  ANPN   ++  +PL  A K+   +
Sbjct:  221 LLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAA-VDFTARN------DITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAA-PILSKTKN---------GLSPLHMATQGDHLNCVQLLLQH-NVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIK 414          

HSP 7 Score: 29.6462 bits (65), Expect = 8.346e-10
Identity = 83/395 (21.01%), Postives = 149/395 (37.72%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNN----NGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQ 1989
            +GH  IV  L+ +GA+P     R + T LH +  S                 EVV +     L  +  Q+               A   DD Q   H   I+  L   K DI       G S N    +G   L +  ++      +++   LL H  +++ T  K  + L +A +   L + + LL + + P+      +T L  +    ++K+  LL++ GA+ +                   +H+A   +  +    L++ GA+                +  +HLA   +   ++ ++ LL    N+      G TP   A +  ++    +L+ +G   +A   +  + L +     N +I+ FLLQ+    N K   G T LH +  Q
Sbjct:  443 MGHVNIVSQLMHHGASPNTTNVRGE-TALHMAARSGQA--------------EVVRY-----LVQDGAQVE--------------AKAKDD-QTPLH---ISARLG--KADIVQQLLQQGASPNAATTSGYTPLHLSAREGH----EDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPH----------AAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV--------TRQGIASVHLAA--QEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQ 773          

HSP 8 Score: 46.2098 bits (108), Expect = 3.952e-6
Identity = 42/194 (21.65%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  227 SILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNI---------SDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            + LH A    H  +A+ L++          N  +  L+   P+HIAC+  R  ++++LL+   +    ++ +    + P+ ++      F    NI         S     +     LH+       + ++ L+Q+ A+V  +++     +T L ++  L + + V  LL+ GA+PN    S  +PL  +A+ G
Sbjct:  369 TALHVAAHCGHYKVAKVLLDKK-------ANPNAKALNGFTPLHIACKKNRIKVMELLLKHGAS----IQAVTESGLTPIHVAA-----FMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKD---DQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREG 543          

HSP 9 Score: 28.4906 bits (62), Expect = 3.952e-6
Identity = 74/333 (22.22%), Postives = 124/333 (37.24%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLL 1818
            GH+ +   LL +GA+  I TK+   TPLH +     ++   A + L KSA      KS                    L  L  A   D+       +K+  LL +     ++          NG   L +  KK Q     ++   LL +  + N    +  + + LA Q   + +VS LL R ++ N+     +T L  + Q+    + E+L+N GA+++                   +HV   Y + +   FL+   A +          + +   T LH A   +    + IN LL+   +    T  G+T    A R   I   + L
Sbjct:  543 GHEDVAAFLLDHGASLSITTKKG-FTPLHVAAKYGKLE--VANLLLQKSASPDAAGKSG-------------------LTPLHVAAHYDN-------QKVALLLLDQGASPHAAA-------KNGYTPLHIAAKKNQM----DIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYT----------PLHVGCHYGNIKIVNFLLQHSAKV--------NAKTKNGYTPLHQAA--QQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 196.052 bits (497), Expect = 6.904e-49
Identity = 176/722 (24.38%), Postives = 329/722 (45.57%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDL--VFIHNNVT---MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   +  ++ LL+   N+++ T KG+T    A    + E   +L+  G + NA +    + L ++A + + E+++FLL N    +     G T L  +  Q          HD     ++ + +ND+   ++   L  A +  +      +L+   + D+    + N  T    TP+ +A    +I+    L+   A +++ +  N  T LHVA +  N  + K L+  G+ I  ++R G    + P+H   ++G ++++E+LL   + +    + K+   ++PLH+A   D  + V+ L       +  N    D  N  LT                                  LH+AA  G +++ ++LL+  A+P A+ +    +G  P+H+A +   + +++L    G S+ A  + GLT +H AA  G V+I+  L+  GA  N     G  +    +HMA+  G  + V+ L++ G+ + A      +D+ T L+I+    + ++++ L++ GA+P+    + G TPLH++ + G      +L+    +SL++    G + LH+ A+ G  E++  LL+   +P+  G+            ++PL+ A  + +  V  LL+  GA  H A       G  P+H AA + +  +  +LLE G   +     G+  +H +  EG  D    L+   ANVN+ +K G  P
Sbjct:   78 LHLAS--KEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQG---------HDQ---VVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTAR-NDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDG----LTPLHCGARSGHEQVVEMLLDRAAPI----LSKTKNGLSPLHMATQGDHLNCVQLL-------LQHNVPVDDVTNDYLT---------------------------------ALHVAAHCGHYKVAKVLLDKKANPNAKAL----NGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETA----LHMAARSGQAEVVRYLVQDGAQVEAKA----KDDQTPLHISARLGKADIVQQLLQQGASPNAATTS-GYTPLHLSAREGHEDVAAFLLD-HGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK----------SGLTPLHVAAHYDNQKVALLLLDQGASPHAA----AKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTP 708          

HSP 2 Score: 177.948 bits (450), Expect = 2.197e-43
Identity = 164/587 (27.94%), Postives = 273/587 (46.51%), Query Frame = 1
Query: 2080 KSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQS------ASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNA--TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            ++G+L  AL Y         +K   D   V I N   +  + LA +   +  +  L++  AN++  +     T LH+A       + K L+  G+N++ +S+ G      P+++A Q    E++  LL  G+S +    L + +   PL +A        V  L    +       +++I + + D+  A L L +  N           AD+  K +V+R+  +  T LHIAA  G+  +  LLL   A   A   T  R+ I P+H+A++ G+  +VKL  D G  + A    GLT LH  A +G   ++E+LL   A + ++  +G    + P+HMA++  H   V+LLL++  P++ V      D LTAL++A       V K L+   ANP+ +  N G TPLHI C++   + +M L+    +S+     +G++ +H+ A  GH  +   L+    +PN T    ++           L+ A   G   VV+ LV+ GA +      +      P+H +A  GK  ++  LL+ G S +     G TPLH S  EG  D   FL+   A+++I  K G  P
Sbjct:   50 RAGHLEKALDY---------IKNGVD---VNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATK-KGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNG----FTPLYMAAQENHLEVVRFLLDNGASQS----LATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTN-----------ADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAA---AVDFTA-RNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNG----LSPLHMATQGDHLNCVQLLLQHNVPVDDV----TNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALN-GFTPLHIACKKNRIR-VMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETA----------LHMAARSGQAEVVRYLVQDGAQVEA----KAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTP 576          

HSP 3 Score: 172.17 bits (435), Expect = 1.195e-41
Identity = 196/807 (24.29%), Postives = 366/807 (45.35%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDS--------NQKDNYGLTALH----------HSFIQDFRIGIDYFIH-DSTNIFIAKIDDNDSSHSL--KSGYLIYA------------LQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDE 3693
            G D NI     + +L  + ++ H ++   L+   AN++         +  K  N A +H+A +    E  + L+  GAN+          + +   T L++A   + N L  + FLL+ G +    T  G TP   A++    +  +LLL    + +    +    L ++A K + +    LLQN  ++        N+    G T LH           + + +    +D+    D T + +A    N +   L    G  I A             + G+E  VV +L   A P L    N   ++P+ +A + + ++ +  L++H   ++ +++ +  T LHVA    +  +AK L+   +N + ++  G      P+H+A +     ++E+LL  G+S+ +     +   + P+H+AA     + V  L H   AS N  + R ++   +     +  V  V+ ++  GA V  K       + T LHI+A++G  +IVQ LL+ GA P A   +G      P+HL+   GH ++     D G S+S     G T LH AA  G +++  +LL+  A  +A      +S + P+H+A+   ++K   LLL+ G+  +A      ++  T L+IA  +N+ ++   L++ GA+ +      G   +H+  Q G    +  L+   N+++N+   +G++ LHL A++    ++  L+         G   D+   +T    +PL+  C +G++ +V  L++  A ++ A+T  G+    P+H AA +G  H+I  LL+   S +E
Sbjct:   64 GVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVD---------AATKKGNTA-LHIASLAGQAEVVKVLVTNGANV--------NAQSQNGFTPLYMAA--QENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHE-QVVEMLLDRAAPILSKTKNG--LSPLHMATQGDHLNCVQLLLQHNVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNG----FTPLHIACKKNRIRVMELLLKHGASIQAV----TESGLTPIHVAAFMGHVNIVSQLMHH-GASPNTTNVRGETALHMAARSGQAEV--VRYLVQDGAQVEAKA----KDDQTPLHISARLGKADIVQQLLQQGASPNAATTSG----YTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA----AGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAA----KNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQ-GIASVHLAAQEGHVDMVSLLLS-RNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVN-------QGAHVDA---QTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVN-AKTKNGY---TPLHQAAQQGHTHIINVLLQNNASPNE 799          

HSP 4 Score: 150.984 bits (380), Expect = 4.021e-35
Identity = 193/792 (24.37%), Postives = 343/792 (43.31%), Query Frame = 1
Query: 1105 HIKKINYLLS-EYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGA---------------------------NINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSR--------------------------SRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGF 3303
            H++ ++ LL  E  VD     T  G   N  LHI  +  +        E++ +L+ +  N+N  +    + L++A Q N L +V  LL  G+  ++      T L  ++Q+ H ++  LL+                               + N ++   +V++    +    +H+A  Y +      L+++ A +  T           ++T LH+A   K  + N +  LL+ G  I++KT  G TP     R    +   +LL R     +      S L ++    +   ++ LLQ+ V  +   N  LTALH        +      +    + + K   N ++ +L     ++     N I V+ +L K  A    V       +TPI +A  M  ++ +  L+ HGA+ N  ++   ET LH+A R+    + + L+  G+ +  +++  Q     P+H++ + G  +I++ LL  G+S N+     +     PLHL+A         FL     AS++I + +   F  L  + +K   + V S+L+   A  D +GK  ++                           ++N  T LHIAA+    +I   LLEYGAD  A  +T  R GI  VHLA + GH+++V L      +V+ +   GLT LH AA    V++ E+L+  GA V+A+   G      P+H+    G+ K V  LL++ + +NA      ++  T L+ A  +   +++  L+++ A+P+    N G T L I  + G+
Sbjct:   86 HVEVVSELLQREANVD---AATKKG---NTALHIASLAGQA-------EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTA--------RNDITPLHVAS--KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALH--------VAAHCGHYKVAKVLLDK-KANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAV---TESGLTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQ----TPLHISARLGKADIVQQLLQQGASPNAA----TTSGYTPLHLSAREGHEDVAAFLL-DHGASLSITTKKG--FTPL-HVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGAD--ANAVT--RQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMG----YTPLHVGCHYGNIKIVNFLLQHSAKVNAK----TKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVN-GNTALAIARRLGY 816          

HSP 5 Score: 120.553 bits (301), Expect = 7.426e-26
Identity = 91/319 (28.53%), Postives = 155/319 (48.59%), Query Frame = 1
Query: 2863 ATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI-GIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            A  +GHLE    +   GV V+     GL  LH A+  G V+++  LL+  A+V+A    GN +    +H+AS  G  + VK+L+  G+ +NA     +++  T LY+A  EN   V+++L+ +GA+  +   + G TPL +  Q+G  + +  L+       + +P      +LH+ A K   + +  LL+   N ++  ++    ++ T    +PL+ A  +G++ V  LL+   A +     F     I P+H A+ RG  +++  LL+ G  ID    DGLTPLH     G     + L+   A +    K G  P
Sbjct:   48 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTA----LHIASLAGQAEVVKVLVTNGANVNA----QSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATED-GFTPLAVALQQGHDQVVSLLLENDTKGKVRLP------ALHIAARKDDTKAAALLLQNDTNADIESKMV--VNRATESGFTPLHIAAHYGNINVATLLLNRAAAVD----FTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSP 345          

HSP 6 Score: 116.316 bits (290), Expect = 1.633e-24
Identity = 103/363 (28.37%), Postives = 180/363 (49.59%), Query Frame = 1
Query: 2731 NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSS-------LNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIID 3798
            NA+ L  AA+ G  E     ++ G D    +   +++G+  +HLA++ GH+E+V        +V AA   G T LH A+ AG  +++++L+  GA+VNA++ +G      P++MA+++ H + V+ LL+ G    A  S    D  T L +A  +  + V+  L+++     ++   L A  LHI  ++  TKA   L+    ++       +N    +G + LH+ A  G+  ++  LL      + T +           +I+PL+ A   G+  +VKLL+  GA I  A+T +   G+ P+HC A  G   V+  LL+    I    ++GL+PLH +      +C + L  L+ NV + D
Sbjct:   42 NASYLR-AARAGHLEKALDYIKNGVD----VNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNG----FTPLYMAAQENHLEVVRFLLDNG----ASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR---LPA--LHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTAR----------NDITPLHVASKRGNANMVKLLLDRGAKID-AKTRD---GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLL--LQHNVPVDD 370          

HSP 7 Score: 93.9745 bits (232), Expect = 9.260e-18
Identity = 126/583 (21.61%), Postives = 225/583 (38.59%), Query Frame = 1
Query: 1252 IDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            + +LL H + +++  +   + L +A       +   LL + ++PN       T L  + +K   ++ ELL+ +GA+I            V  +    IHVA           L+  GA+   T ++  E       T LH+A   +S     + +L++ G  +E+K     TP   + R  K +    LL +G   NA      + L LSA + + ++  FLL +    +     G T LH                                          A +YG       +L+++A PD         +TP+ +A   ++      L+  GA+  + ++ N  T LH+A +   + IA  L+  G++ +  +R G    +  +H+A Q G  +++ +LL    S N+ + L +   + PLHLAA  D  +  + L +Q                                    GA V  +  +      T LH+    G+ +IV  LL++ A   A+     ++G  P+H A + GH  I+ +      S +     G T L  A   G + +++ L
Sbjct:  358 VQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQA----------VTESGLTPIHVAAFMGHVNIVSQLMHHGASPN-TTNVRGE-------TALHMAA--RSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLH-----------------------------------------VAAKYGKLEVASLLLQKSASPDAA---GKSGLTPLHVAAHYDNQKVALLLLDQGAS-PHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQG----IASVHLAAQEGHVDMVSLLL----SRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQ------------------------------------GAHVDAQTKM----GYTPLHVGCHYGNIKIVNFLLQHSAKVNAKT----KNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 823          

HSP 8 Score: 56.9954 bits (136), Expect = 3.668e-12
Identity = 49/201 (24.38%), Postives = 96/201 (47.76%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            ++G++ LH A    ++++A  L+N +   ++F         +++ P+H+A + G  +++K+LL R           + P  C      E +  ++L +++ PI  +  N           +PLH+    DHL+C+++L+Q   V ++  +     TAL +A      +   VLL+  ANPN   ++  +PL  A K+   R
Sbjct:  241 ESGFTPLHIAAHYGNINVATLLLNRAAA-VDF------TARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAA-PILSKTKN---------GLSPLHMATQGDHLNCVQLLLQH-NVPVDDVTN-DYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIR 422          

HSP 9 Score: 38.5058 bits (88), Expect = 3.668e-12
Identity = 94/412 (22.82%), Postives = 157/412 (38.11%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNN----NGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENV--------------CFDLVLS---------NVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH  IV  L+ +GA+P     R + T LH +  S                 EVV +     L  +  Q+               A   DD Q   H   I+  L   K DI       G S N    +G   L +  ++      +++   LL H  +++ T  K  + L +A +   L + S LL + + P+      +T L  +    ++K+  LL++ GA+ +                   D+  S          V     AS+H+A      +    L+ + AN+ L+         ++ +T LHLA   + + +N    L+  G +++++T  G TP      Y  I+  N LL      NA      + L  +A + +  I+  LLQN    N+    G TAL
Sbjct:  451 MGHVNIVSQLMHHGASPNTTNVRGE-TALHMAARSGQA--------------EVVRY-----LVQDGAQVE--------------AKAKDD-QTPLH---ISARLG--KADIVQQLLQQGASPNAATTSGYTPLHLSAREGH----EDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLS--------NKSGLTPLHLAA--QEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTAL 808          

HSP 10 Score: 51.2174 bits (121), Expect = 4.504e-9
Identity = 41/193 (21.24%), Postives = 84/193 (43.52%), Query Frame = 2
Query:  227 SILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNI---------SDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            + LH A    H  +A+ L++          N  +  L+   P+HIAC+  R  ++++LL+   +    ++ +    + P+ ++      F    NI         S     +     LH+       + ++ L+Q+    +E+++    +T L ++  L + + V  LL+ GA+PN    S  +PL  +A+ G
Sbjct:  377 TALHVAAHCGHYKVAKVLLDKK-------ANPNAKALNGFTPLHIACKKNRIRVMELLLKHGAS----IQAVTESGLTPIHVA-----AFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDG-AQVEAKAK-DDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREG 551          

HSP 11 Score: 33.4982 bits (75), Expect = 4.504e-9
Identity = 74/333 (22.22%), Postives = 125/333 (37.54%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLL 1818
            GH+ +   LL +GA+  I TK+   TPLH +     ++   A++ L KSA      KS                    L  L  A   D+       +K+  LL +     ++          NG   L +  KK Q     ++   LL +  + N    +  + + LA Q   + +VS LL R ++ N+     +T L  + Q+    + E+L+N GA+++                   +HV   Y + +   FL+   A +          + +   T LH A   +    + IN LL+   +    T  G+T    A R   I   + L
Sbjct:  551 GHEDVAAFLLDHGASLSITTKK-GFTPLHVAAKYGKLE--VASLLLQKSASPDAAGKSG-------------------LTPLHVAAHYDN-------QKVALLLLDQGASPHAAA-------KNGYTPLHIAAKKNQM----DIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYT----------PLHVGCHYGNIKIVNFLLQHSAKV--------NAKTKNGYTPLHQAA--QQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 823          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. TrEMBL
Match: A0A267DXP0 (ANK_REP_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012391g1 PE=4 SV=1)

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 370/922 (40.13%), Postives = 556/922 (60.30%), Query Frame = 1
Query: 1111 KKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVN-AINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDS----TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEAT--DGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF 3855
            +K+  LLS    DIN V   + ++  N L +L+         +  +L+  LL++ +N++   S   S L  A Q   + +V+ L     +PN+      T+LM++++ R+  +   L+    ++   + F     N K  NC  + +A+     E  + L+D GANLF  +D +   + E +V+ LH A+++    +     LL+ G+++   TS G TP  +A  +       LLL RG   +AV      + LI +A +     M+ LL++  + N +D  G TALH     +    +D  ++       N+   K+D     H      L+  L+Y +   V R+L+  +DP+++F  N +T+TPIFL  E   +  +  LI++GA+LN  SS  +ET LH ALR K +A A+ LI AG+++  R+ +G GE    +HVA Q GL+  I +L  +G+++NSTM LK VERV PLHLAALNDL+ TVK L    +   ++N  RSD+F  LLT V+K NV  V+ ++ AGAD+  +CIVSRS++ATCLHIAAQVGS EIV LLLE GA+P ARM+TGDR GILPVHLA+E+GHL+++K F D GV V+A EDCGLTCLHYAAN G  DI+++LL+ GA V+ +A   DGNR  +LP+HMA EKG+ +  +LL+E GSP++A   R  R N+T LY+A +EN   V+  L+ +G++ +IQ+  +GA PLHI+CQRG+      L+   + ++N+    G++ +H+ +EKGH +++ WL+    N N   +I D  S + S +I PLNQACGFGHL +VKLL++ GAD+H  E FEG +GI  IHCAAIRG++HVIP L + G +++  DE G +PLHW+V E FYD    L+   A+  ++++ G++P   A T ++ S+ 
Sbjct:  322 EKLELLLSR-GADINRVFEYNSLTGVNALRLLIETRS-----INTDLVHYLLSNGVNVDSLASDGVSPLLCAAQKGSVVMVTKLCKYSPNPNVADRDGYTALMYAVKCRNSSLVRTLLELKPDLEIAINFYDARRN-KYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIG--QLLLDRGVDVNVCTSSGLTPLHYAASWGHDAFAKLLLSRGATVDAVGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVD-----HRRGVTALVLGLEYCSAKVVERLLEMGSDPNVIFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSS-RKETPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMHGA---DVNCQRSDTFTPLLTAVTKSNVCAVKCLVRAGADIHTRCIVSRSKDATCLHIAAQVGSLEIVDLLLERGANPLARMVTGDRAGILPVHLASETGHLDVIKRFLDIGVDVNAQEDCGLTCLHYAANGGKADIIKLLLERGARVDLKAAYDDGNRVDVLPLHMACEKGNAECARLLVEAGSPLDATLFRNRRGNITPLYLAVAENNPEVVSVLLAAGSDVNIQD-GIGAAPLHISCQRGYHDIFCQLLCHPSVNVNIATFNGVTPIHIVSEKGHFDMAMWLIARGVNVNPLCRIKDVHSGQMSEDIIPLNQACGFGHLQIVKLLLQNGADVHHGENFEGRRGIASIHCAAIRGRHHVIPLLRKFGANLNATDEQGWSPLHWAVHERFYDTVLLLLQNGADPRLLNQAGQRPIQMATTNDITSVL 1224          

HSP 2 Score: 141.739 bits (356), Expect = 4.673e-30
Identity = 184/762 (24.15%), Postives = 323/762 (42.39%), Query Frame = 1
Query: 1759 GDTPFLFAIRY----SKIEACNLLLFRGCD------KNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHN--------NVTMTPIFLAVEMNSISNMCHLIRHGANL--NYIS-SPNQE----TVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCI---VSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIA---NSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSID--EPDEDG----LTPLHWSVIEGFYDCTKFLI-------------------------------------GLKANVNIIDKIGKKP 3816
            G TP + A+      +  E   LLL RG D       N++  +N   L++     N +++ +LL N V+ +   + G++ L  +  +   + +      S N  +A  D          GY  L+YA++  N   +VR L +   PDL    N            TP+ +A+    +  +  L+  GANL  N  S  P+Q     + LH A+   +  I + L+  G ++++ +  G    + P+H A   G D   ++LL  G+++++   +       PL  AA  D  +T++ L    +   N N      + AL   ++  +V  +  +L  G  +    I   V   R  T L +  +  S ++V+ LLE G+DP   +   +   + P+ L  E G ++ ++L   +G  ++       T LH+A     V   E L++AGAD+   A+ GN      +H+A++ G    ++LL EYG+ +N+  +    + +T L++A   +    +K L+  GA+ + Q ++   TPL     +    A+  L+      ++   V  +   + LH+ A+ G  E+   LL    NP L   +T   +      I P++ A   GHL V+K  +  G D++  E      G+  +H AA  GK  +I  LLE G  +D     +DG    + PLH +  +G  +C + L+                                        ++VNI D IG  P
Sbjct:  304 GATPLIAAVATPGASAVTEKLELLLSRGADINRVFEYNSLTGVNALRLLIETRSINTDLVHYLLSNGVNVDSLASDGVSPLLCAAQKGSVVMVTKLCKYSPNPNVADRD----------GYTALMYAVKCRNS-SLVRTLLEL-KPDLEIAINFYDARRNKYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDRGVDVNVCTSSG----LTPLHYAASWGHDAFAKLLLSRGATVDA---VGEQFMATPLIYAARRDKHTTMRLLLEHGA---NPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNV-IFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSSRKETPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMHGADVNCQRSDT-FTPLLTAVTKSNVCAVKCLVRAGADIHTRCIVSRSKDATCLHIAAQVGSLEIVDLLLERGANP-LARMVTGDRA-----GILPVHLASETGHLDVIKRFLDIGVDVNAQEDC----GLTCLHYAANGGKADIIKLLLERGARVDLKAAYDDGNRVDVLPLHMACEKGNAECARLLVEAGSPLDATLFRNRRGNITPLYLAVAENNPEVVSVLLAAGSDVNIQDGIGAAP 1031          

HSP 3 Score: 136.732 bits (343), Expect = 1.561e-28
Identity = 201/898 (22.38%), Postives = 375/898 (41.76%), Query Frame = 1
Query: 1408 TSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLD-------EREVETNVTLL------------HLAILLKSNSLNYINFLLEMG-LNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHH------SFIQDFRIGIDYF--------------IHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVV------------RVL--KQAADPDLV--FIHNNVT--------MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLR-----SRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVER----VNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWG-------VSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQE---NNLGATPLHITCQRGFTKAIMYLIGIA---NSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVS----IDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAV 3831
            T L +++   H+K+T LL   G ++N        +S   +T   +IH+A    D +T + LI  GA+  L  ++ +       +++ + + T +            H+A+   S S+  +   L+ G   ++++T +  TP + A +   +    LLL  G    A ++   + L  +A    PE ++ +LQ+   ++  ++ G   LH+      S +Q+ ++ +D +              I       IA +    +S   +   L+  L  G +I+ V            R+L   ++ + DLV   + N V         ++P+  A +  S+  +  L ++  N N ++  +  T L  A++ +N ++ + L+    ++ +      +R  +     P+ +A+  G  EI+++LL  G++L + M     ++    V+ LH A + D     + L  +    +++N   S     L    S  +    + +L  GA V     V     AT L  AA+      ++LLLE+GA+P  +    D+ G   +H      H++ + +  + G       +S       G+T L       S  ++E LL+ G+D N    D N   + PI + +E G    ++LL++YG+ +N   SR      T L+ A    +    + LI++GA+ + +    N      +H+  Q G    I  L       NS++ +     ++ LHL A    +E    L+    + N   Q +D+F        +PL  A    ++  VK LV+ GADIH        K    +H AA  G   ++  LLE G +    +   D  G+ P+H +   G  D  K  + +  +VN  +  G     YA 
Sbjct:   64 TLLHYAVLCGHRKITALLCQCGFDVN----IKCDVSAFGVTGWRAIHIAAEKGDSDTLKLLISYGASCELMAEVAEAADSGNEQQQQQPDATAVATSGLAERWNAVHMAVF--SESVESVRACLQRGGAYVDTRTLRRQTPLMLACKSGCLAIVQLLLTAGASLRARDSQGNTPLHYAAQSPCPETLRQILQDGARADAVNSAGQLPLHNAAQSRSSGVQNVQLLLDTWPSGLEAVASLPDLNIGAGATPLIAAVATPGASAVTEKLELL--LSRGADINRVFEYNSLTGVNALRLLIETRSINTDLVHYLLSNGVNVDSLASDGVSPLLCAAQKGSVVMVTKLCKYSPNPN-VADRDGYTALMYAVKCRNSSLVRTLLELKPDLEIAINFYDARRNKYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDR---GVDVNVCTSSGLTPLHYAASWGHDAFAKLLLSRGATVDA---VGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQ----DKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNV-IFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSSRKE----TPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMHGADVNC--QRSDTF--------TPLLTAVTKSNVCAVKCLVRAGADIHTRCIVSRSKDATCLHIAAQVGSLEIVDLLLERGANPLARMVTGDRAGILPVHLASETGHLDVIKRFLDIGVDVNAQEDCGLTCLHYAA 927          

HSP 4 Score: 105.145 bits (261), Expect = 8.007e-19
Identity = 66/238 (27.73%), Postives = 120/238 (50.42%), Query Frame = 2
Query:   59 VKKYKTVNPEDVKSDLSSSDTIFQHIAKGDCKFVKAWLHGLLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAK 772
            V ++  +  +D+  + S  D  F ++   + K +   L GLL +     + DKAGW++LH A++  H  I   L+     ++N  C+ ++ G+   R IHIA E G +  LK+L+    + EL  EV  +E  +     +  +P          T  L + WN +H+ V  + ++ ++  +Q    ++++R+ + R+T L+LAC+   L  V +LL +GA+    D    +PL YAA+
Sbjct:    8 VHRFVKITLKDLSKESSQCDPAFGYVLNNNSKKLHDQLAGLLNKQQYLYVRDKAGWTLLHYAVLCGHRKITA-LLCQCGFDVNIKCDVSAFGVTGWRAIHIAAEKGDSDTLKLLISYGASCELMAEV--AEAADSGNEQQQQQP----DATAVATSGLAERWNAVHMAVFSESVESVRACLQRGGAYVDTRT-LRRQTPLMLACKSGCLAIVQLLLTAGASLRARDSQGNTPLHYAAQ 237          

HSP 5 Score: 63.5438 bits (153), Expect = 4.813e-6
Identity = 60/228 (26.32%), Postives = 107/228 (46.93%), Query Frame = 2
Query:  134 IAKGDCKFVKAWLHGL--LYESTGWQLLDKAGWSI--LHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCME-VIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAK---VFIESRSIISRK--TALILACELCRLETVNVLLESGANPNVCDISNK---SPLFYAAKRG 778
            I KG  + VK  L     L+ +      D+  +S+  LH A++++H  I Q L++  + ++N  C S+      L P+H A  +G  +  K+LL R    +   E  + + LI      K +      +   +  +     +  LH  +  +H+D L +L+   +   V + S+ +  R+  TAL+L  E C  + V  LLE G++PNV   +N+   +P+F  A+ G
Sbjct:  463 IGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDRGV-DVNV-CTSSG-----LTPLHYAASWGHDAFAKLLLSRGATVDAVGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNVIFDANEMTLTPIFLCAEFG 683          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. TrEMBL
Match: A0A267ELS2 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015302g1 PE=4 SV=1)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 370/922 (40.13%), Postives = 557/922 (60.41%), Query Frame = 1
Query: 1111 KKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVN-AINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDS----TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEAT--DGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF 3855
            +K++ LLS    DIN V   + ++  N L +L+         +  +L+  LL++ +N++   S   S L  A Q   + +V+ L     +PN+      T+LM++++ R+  +   L+    ++   + F     N K  NC  + +A+     E  + L+D GANLF  +D +   + E +V+ LH A+++    +     LL+ G+++   TS G TP  +A  +       LLL RG   +AV      + LI +A +     M+ LL++  + N +D  G TALH     +    +D  ++       N+   K+D     H      L+  L+Y +   V R+L+  +DP+++F  N +T+TPIFL  E   +  +  LI++GA+LN  SS  +ET LH ALR K +A A+ LI AG+++  R+ +G GE    +HVA Q GL+  I +L  +G+++NSTM LK VERV PLHLAALNDL+ TVK L    +   ++N  RSD+F  LLT V+K NV  V+ ++ AGAD+  +CIVSRS++ATCLHIAAQVGS EIV LLLE GA+P ARM+TGDR GILPVHLA+E+GHL+++K F D GV V+A EDCGLTCLHYAAN G  DI+++LL+ GA V+ +A   DGNR  +LP+HMA EKG+ +  +LL+E GSP++A   R  R N+T LY+A +EN   V+  L+ +G++ +IQ+  +GA PLHI+CQRG+      L+   + ++N+    G++ +H+ +EKGH +++ WL+    N N   +I D  S + S +I PLNQACGFGHL +VKLL++ GAD+H  E FEG +GI  IHCAAIRG++HVIP L + G +++  DE G +PLHW+V E FYD    L+   A+  ++++ G++P   A T ++ S+ 
Sbjct:  323 EKLDLLLSR-GADINRVFEYNSLTGVNALRLLVETRS-----INTDLVHYLLSNGVNVDSLASDGVSPLLCAAQKGSVVMVTKLCKYSPNPNVADRDGYTALMYAVKCRNSSLVRTLLELKPDLEIAINFYDARRN-KYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIG--QLLLDRGVDVNVCTSSGLTPLHYAASWGHDAFAKLLLSRGATVDAVGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVD-----HRRGVTALVLGLEYCSAKVVERLLEMGSDPNVIFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSS-RKETPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMLGA---DVNCQRSDTFTPLLTAVTKSNVCAVKCLVRAGADIHTRCIVSRSKDATCLHIAAQVGSLEIVDLLLERGANPLARMVTGDRAGILPVHLASETGHLDVIKRFLDIGVDVNAQEDCGLTCLHYAANGGKADIIKLLLERGARVDLKAAYDDGNRVDVLPLHMACEKGNAECARLLVEAGSPLDATLFRNRRGNITPLYLAVAENNPEVVSVLLAAGSDVNIQD-GIGAAPLHISCQRGYHDIFCQLLCHPSVNVNIATFNGVTPIHIVSEKGHFDMAMWLIARGVNVNPLCRIKDVHSGQMSEDIIPLNQACGFGHLQIVKLLLQNGADVHHGENFEGRRGIASIHCAAIRGRHHVIPLLRKFGANLNATDEQGWSPLHWAVHERFYDTVLLLLQNGADPRLLNQDGQRPIQMATTNDITSVL 1225          

HSP 2 Score: 142.124 bits (357), Expect = 3.877e-30
Identity = 184/762 (24.15%), Postives = 324/762 (42.52%), Query Frame = 1
Query: 1759 GDTPFLFAIRY----SKIEACNLLLFRGCD------KNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHN--------NVTMTPIFLAVEMNSISNMCHLIRHGANL--NYIS-SPNQE----TVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCI---VSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIA---NSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSID--EPDEDG----LTPLHWSVIEGFYDCTKFLI-------------------------------------GLKANVNIIDKIGKKP 3816
            G TP + A+      +  E  +LLL RG D       N++  +N   L++     N +++ +LL N V+ +   + G++ L  +  +   + +      S N  +A  D          GY  L+YA++  N   +VR L +   PDL    N            TP+ +A+    +  +  L+  GANL  N  S  P+Q     + LH A+   +  I + L+  G ++++ +  G    + P+H A   G D   ++LL  G+++++   +       PL  AA  D  +T++ L    +   N N      + AL   ++  +V  +  +L  G  +    I   V   R  T L +  +  S ++V+ LLE G+DP   +   +   + P+ L  E G ++ ++L   +G  ++       T LH+A     V   E L++AGAD+   A+ GN      +H+A++ G    ++LL EYG+ +N+  +    + +T L++A   +    +K L+  GA+ + Q ++   TPL     +    A+  L+      ++   V  +   + LH+ A+ G  E+   LL    NP L   +T   +      I P++ A   GHL V+K  +  G D++  E      G+  +H AA  GK  +I  LLE G  +D     +DG    + PLH +  +G  +C + L+                                        ++VNI D IG  P
Sbjct:  305 GATPLIAAVATPGASAVTEKLDLLLSRGADINRVFEYNSLTGVNALRLLVETRSINTDLVHYLLSNGVNVDSLASDGVSPLLCAAQKGSVVMVTKLCKYSPNPNVADRD----------GYTALMYAVKCRNS-SLVRTLLEL-KPDLEIAINFYDARRNKYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDRGVDVNVCTSSG----LTPLHYAASWGHDAFAKLLLSRGATVDA---VGEQFMATPLIYAARRDKHTTMRLLLEHGA---NPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNV-IFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSSRKETPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMLGADVNCQRSDT-FTPLLTAVTKSNVCAVKCLVRAGADIHTRCIVSRSKDATCLHIAAQVGSLEIVDLLLERGANP-LARMVTGDRA-----GILPVHLASETGHLDVIKRFLDIGVDVNAQEDC----GLTCLHYAANGGKADIIKLLLERGARVDLKAAYDDGNRVDVLPLHMACEKGNAECARLLVEAGSPLDATLFRNRRGNITPLYLAVAENNPEVVSVLLAAGSDVNIQDGIGAAP 1032          

HSP 3 Score: 127.872 bits (320), Expect = 8.061e-26
Identity = 202/906 (22.30%), Postives = 372/906 (41.06%), Query Frame = 1
Query: 1408 TSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLD-------EREVETNVTLL------------HLAI--------------------------------LLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLI-------YALQYGN--EIDVVRVL--KQAADPDLV--FIHNNVT--------MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLR-----SRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVER----VNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWG-------VSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQE---NNLGATPLHITCQRGFTKAIMYLIGIA---NSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVS----IDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAV 3831
            T L +++   H+K+T LL   G ++N        +S   +T   +IH+A    D +T + LI  GA+  L  ++ +       +++ + + T +            H+A+                                  KS  L  +  LL  G ++ ++ S+G+TP  +A +    E   L+L  G   +AVN+  +  L  +A  ++  +    LQ  +D+      GL A+  + + D  IG       +T +  A      S+ + K   L+          +Y +   ++ +R+L   ++ + DLV   + N V         ++P+  A +  S+  +  L ++  N N ++  +  T L  A++ +N ++ + L+    ++ +      +R  +     P+ +A+  G  EI+++LL  G++L + M     ++    V+ LH A + D     + L  +    +++N   S     L    S  +    + +L  GA V     V     AT L  AA+      ++LLLE+GA+P  +    D+ G   +H      H++ + +  + G       +S       G+T L       S  ++E LL+ G+D N    D N   + PI + +E G    ++LL++YG+ +N   SR      T L+ A    +    + LI++GA+ + +    N      +H+  Q G    I  L       NS++ +     ++ LHL A    +E    L+    + N   Q +D+F        +PL  A    ++  VK LV+ GADIH        K    +H AA  G   ++  LLE G +    +   D  G+ P+H +   G  D  K  + +  +VN  +  G     YA 
Sbjct:   65 TLLHYAVLCGHRKITALLCQCGFDVN----IKCDVSAFGVTGWRAIHIAAERGDSDTLKLLISYGASCELMAEVAEAADSGNEQQQQQPDATAVATSGLAERWNAVHMAVSSESVESVRVCLQRGGAYVDTRTLRRQTPLMLACKSGCLAIVQLLLTAGASLRARDSQGNTPLHYAAQSPCPETLRLILQDGARADAVNSAGQLPLHNAAQSRSSGVQN--LQLLLDTWPS---GLEAV--ASLPDLNIGA-----GATPLIAAVATPGASAVTEKLDLLLSRGADINRVFEYNSLTGVNALRLLVETRSINTDLVHYLLSNGVNVDSLASDGVSPLLCAAQKGSVVMVTKLCKYSPNPN-VADRDGYTALMYAVKCRNSSLVRTLLELKPDLEIAINFYDARRNKYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDR---GVDVNVCTSSGLTPLHYAASWGHDAFAKLLLSRGATVDA---VGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQ----DKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNV-IFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSSRKE----TPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMLGADVNC--QRSDTF--------TPLLTAVTKSNVCAVKCLVRAGADIHTRCIVSRSKDATCLHIAAQVGSLEIVDLLLERGANPLARMVTGDRAGILPVHLASETGHLDVIKRFLDIGVDVNAQEDCGLTCLHYAA 928          

HSP 4 Score: 106.301 bits (264), Expect = 3.578e-19
Identity = 66/238 (27.73%), Postives = 122/238 (51.26%), Query Frame = 2
Query:   59 VKKYKTVNPEDVKSDLSSSDTIFQHIAKGDCKFVKAWLHGLLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAK 772
            V ++  +  +D+  + S  D  F ++   + K ++  L GLL +     + DKAGW++LH A++  H  I   L+     ++N  C+ ++ G+   R IHIA E G +  LK+L+    + EL  EV  +E  +     +  +P          T  L + WN +H+ V  + ++ +++ +Q    ++++R+ + R+T L+LAC+   L  V +LL +GA+    D    +PL YAA+
Sbjct:    9 VHRFVKITLKDLSKESSQCDPAFGYVLNNNSKKLQDQLAGLLNKQQYLYVRDKAGWTLLHYAVLCGHRKITA-LLCQCGFDVNIKCDVSAFGVTGWRAIHIAAERGDSDTLKLLISYGASCELMAEV--AEAADSGNEQQQQQP----DATAVATSGLAERWNAVHMAVSSESVESVRVCLQRGGAYVDTRT-LRRQTPLMLACKSGCLAIVQLLLTAGASLRARDSQGNTPLHYAAQ 238          

HSP 5 Score: 63.5438 bits (153), Expect = 4.387e-6
Identity = 60/228 (26.32%), Postives = 107/228 (46.93%), Query Frame = 2
Query:  134 IAKGDCKFVKAWLHGL--LYESTGWQLLDKAGWSI--LHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCME-VIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAK---VFIESRSIISRK--TALILACELCRLETVNVLLESGANPNVCDISNK---SPLFYAAKRG 778
            I KG  + VK  L     L+ +      D+  +S+  LH A++++H  I Q L++  + ++N  C S+      L P+H A  +G  +  K+LL R    +   E  + + LI      K +      +   +  +     +  LH  +  +H+D L +L+   +   V + S+ +  R+  TAL+L  E C  + V  LLE G++PNV   +N+   +P+F  A+ G
Sbjct:  464 IGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDRGV-DVNV-CTSSG-----LTPLHYAASWGHDAFAKLLLSRGATVDAVGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNVIFDANEMTLTPIFLCAEFG 684          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. TrEMBL
Match: A0A267E600 (ANK_REP_REGION domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009521g1 PE=4 SV=1)

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 370/922 (40.13%), Postives = 556/922 (60.30%), Query Frame = 1
Query: 1111 KKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVN-AINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDS----TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEAT--DGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF 3855
            +K+  LLS    DIN V   + ++  N L +L+         +  +L+  LL++ +N++   S   S L  A Q   + +V+ L     +PN+      T+LM++++ R+  +   L+    ++   + F     N K  NC  + +A+     E  + L+D GANLF  +D +   + E +V+ LH A+++    +     LL+ G+++   TS G TP  +A  +       LLL RG   +AV      + LI +A +     M+ LL++  + N +D  G TALH     +    +D  ++       N+   K+D     H      L+  L+Y +   V R+L+  +DP+++F  N +T+TPIFL  E   +  +  LI++GA+LN  SS  +ET LH ALR K +A A+ LI AG+++  R+ +G GE    +HVA Q GL+  I +L  +G+++NSTM LK VERV PLHLAALNDL+ TVK L    +   ++N  RSD+F  LLT V+K NV  V+ ++ AGAD+  +CIVSRS++ATCLHIAAQVGS EIV LLLE GA+P ARM+TGDR GILPVHLA+E+GHL+++K F D GV V+A EDCGLTCLHYAAN G  DI+++LL+ GA V+ +A   DGNR  +LP+HMA EKG+ +  +LL+E GSP++A   R  R N+T LY+A +EN   V+  L+ +G++ +IQ+  +GA PLHI+CQRG+      L+   + ++N+    G++ +H+ +EKGH +++ WL+    N N   +I D  S + S +I PLNQACGFGHL +VKLL++ GAD+H  E FEG +GI  IHCAAIRG++HVIP L + G +++  DE G +PLHW+V E FYD    L+   A+  ++++ G++P   A T ++ S+ 
Sbjct:  321 EKLELLLSR-GADINRVFEYNSLTGVNALRLLIETRS-----INTDLVHYLLSNGVNVDSLASDGVSPLLCAAQKGSVVIVTKLCKYSPNPNVADRDGYTALMYAVKCRNSSLVRTLLELKPDLEIAINFYDARRN-KYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIG--QLLLDRGVDVNVCTSSGLTPLHYAASWGHDAFAKLLLSRGATVDAVGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVD-----HRRGVTALVLGLEYCSAKVVERLLEMGSDPNVIFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSS-RKETPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMLGA---DVNCQRSDTFTPLLTAVTKSNVCAVKCLVRAGADIHTRCIVSRSKDATCLHIAAQVGSLEIVDLLLERGANPLARMVTGDRAGILPVHLASETGHLDVIKRFLDIGVDVNAQEDCGLTCLHYAANGGKADIIKLLLERGARVDLKAAYDDGNRVDVLPLHMACEKGNAECARLLVEAGSPLDATLFRNRRGNITPLYLAVAENNPEVVSVLLAAGSDVNIQD-GIGAAPLHISCQRGYHDIFCQLLCHPSVNVNIATFNGVTPIHIVSEKGHFDMAMWLIARGVNVNPLCRIKDVHSGQMSEDIIPLNQACGFGHLQIVKLLLQNGADVHHGENFEGRRGIASIHCAAIRGRHHVIPLLRKFGANLNATDEQGWSPLHWAVHERFYDTVLLLLQNGADPRLLNQDGQRPIQMATTNDITSVL 1223          

HSP 2 Score: 140.969 bits (354), Expect = 9.310e-30
Identity = 184/762 (24.15%), Postives = 323/762 (42.39%), Query Frame = 1
Query: 1759 GDTPFLFAIRY----SKIEACNLLLFRGCD------KNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHN--------NVTMTPIFLAVEMNSISNMCHLIRHGANL--NYIS-SPNQE----TVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCI---VSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIA---NSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSID--EPDEDG----LTPLHWSVIEGFYDCTKFLI-------------------------------------GLKANVNIIDKIGKKP 3816
            G TP + A+      +  E   LLL RG D       N++  +N   L++     N +++ +LL N V+ +   + G++ L  +  +   + +      S N  +A  D          GY  L+YA++  N   +VR L +   PDL    N            TP+ +A+    +  +  L+  GANL  N  S  P+Q     + LH A+   +  I + L+  G ++++ +  G    + P+H A   G D   ++LL  G+++++   +       PL  AA  D  +T++ L    +   N N      + AL   ++  +V  +  +L  G  +    I   V   R  T L +  +  S ++V+ LLE G+DP   +   +   + P+ L  E G ++ ++L   +G  ++       T LH+A     V   E L++AGAD+   A+ GN      +H+A++ G    ++LL EYG+ +N+  +    + +T L++A   +    +K L+  GA+ + Q ++   TPL     +    A+  L+      ++   V  +   + LH+ A+ G  E+   LL    NP L   +T   +      I P++ A   GHL V+K  +  G D++  E      G+  +H AA  GK  +I  LLE G  +D     +DG    + PLH +  +G  +C + L+                                        ++VNI D IG  P
Sbjct:  303 GATPLIAAVATPGASAVTEKLELLLSRGADINRVFEYNSLTGVNALRLLIETRSINTDLVHYLLSNGVNVDSLASDGVSPLLCAAQKGSVVIVTKLCKYSPNPNVADRD----------GYTALMYAVKCRNS-SLVRTLLEL-KPDLEIAINFYDARRNKYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDRGVDVNVCTSSG----LTPLHYAASWGHDAFAKLLLSRGATVDA---VGEQFMATPLIYAARRDKHTTMRLLLEHGA---NPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNV-IFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSSRKETPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMLGADVNCQRSDT-FTPLLTAVTKSNVCAVKCLVRAGADIHTRCIVSRSKDATCLHIAAQVGSLEIVDLLLERGANP-LARMVTGDRA-----GILPVHLASETGHLDVIKRFLDIGVDVNAQEDC----GLTCLHYAANGGKADIIKLLLERGARVDLKAAYDDGNRVDVLPLHMACEKGNAECARLLVEAGSPLDATLFRNRRGNITPLYLAVAENNPEVVSVLLAAGSDVNIQDGIGAAP 1030          

HSP 3 Score: 137.887 bits (346), Expect = 7.502e-29
Identity = 204/899 (22.69%), Postives = 378/899 (42.05%), Query Frame = 1
Query: 1408 TSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLD-------EREVETNVTLL------------HLAILLKSNSLNYINFLLEMG-LNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHH------SFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVR----VLKQAADPDLVFIHNNVT-MTPIFLAVEMNSI-SNMCH-LIRHGANLNYIS-------------------------SPNQE-------TVLHVALRNKNIAIAKELIFAGSNIHLR-----SRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVER----VNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWG-------VSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQE---NNLGATPLHITCQRGFTKAIMYLIGIA---NSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVS----IDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAV 3831
            T L +++   H+K+T LL   G ++N        +S   +T   +IH+A    D +T + LI  GA+  L  ++ +       +++ + + T +            H+A+   S S+  +   L+ G   ++++T +  TP + A +   +    LLL  G    A ++   + L  +A    PE ++ +LQ+   ++  ++ G   LH+      S +Q+ ++ +D +   S    +A + D +         LI A+       V      +L + AD + VF +N++T +  + L +E  SI +++ H L+ +G N++ ++                         SPN         T L  A++ +N ++ + L+    ++ +      +R  +     P+ +A+  G  EI+++LL  G++L + M     ++    V+ LH A + D     + L  +    +++N   S     L    S  +    + +L  GA V     V     AT L  AA+      ++LLLE+GA+P  +    D+ G   +H      H++ + +  + G       +S       G+T L       S  ++E LL+ G+D N    D N   + PI + +E G    ++LL++YG+ +N   SR      T L+ A    +    + LI++GA+ + +    N      +H+  Q G    I  L       NS++ +     ++ LHL A    +E    L+    + N   Q +D+F        +PL  A    ++  VK LV+ GADIH        K    +H AA  G   ++  LLE G +    +   D  G+ P+H +   G  D  K  + +  +VN  +  G     YA 
Sbjct:   63 TLLHYAVLCGHRKITALLCQCGFDVN----IKCDVSAFGVTGWRAIHIAAERGDSDTLKLLISYGASCELMAEVAEAADSGNEQQQQQPDATAVATSGLAERWNAVHMAV--SSESVESVRVCLQRGGAYVDTRTLRRQTPLMLACKSGCLAIVQLLLTAGASLRARDSQGNTPLHYAAQSPCPETLRQILQDGARADAVNSAGQLPLHNAAQSRSSGVQNVQLLLDTW--PSGLEAVASLPDLNIGAGATP--LIAAVATPGASAVTEKLELLLSRGADINRVFEYNSLTGVNALRLLIETRSINTDLVHYLLSNGVNVDSLASDGVSPLLCAAQKGSVVIVTKLCKYSPNPNVADRDGYTALMYAVKCRNSSLVRTLLELKPDLEIAINFYDARRNKYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDR---GVDVNVCTSSGLTPLHYAASWGHDAFAKLLLSRGATVDA---VGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQ----DKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNV-IFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSSRKE----TPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMLGADVNC--QRSDTF--------TPLLTAVTKSNVCAVKCLVRAGADIHTRCIVSRSKDATCLHIAAQVGSLEIVDLLLERGANPLARMVTGDRAGILPVHLASETGHLDVIKRFLDIGVDVNAQEDCGLTCLHYAA 926          

HSP 4 Score: 106.301 bits (264), Expect = 3.698e-19
Identity = 66/238 (27.73%), Postives = 122/238 (51.26%), Query Frame = 2
Query:   59 VKKYKTVNPEDVKSDLSSSDTIFQHIAKGDCKFVKAWLHGLLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAK 772
            V ++  +  +D+  + S  D  F ++   + K ++  L GLL +     + DKAGW++LH A++  H  I   L+     ++N  C+ ++ G+   R IHIA E G +  LK+L+    + EL  EV  +E  +     +  +P          T  L + WN +H+ V  + ++ +++ +Q    ++++R+ + R+T L+LAC+   L  V +LL +GA+    D    +PL YAA+
Sbjct:    7 VHRFVKITLKDLSKESSQCDPAFGYVLNNNSKKLQDQLAGLLNKQQYLYVRDKAGWTLLHYAVLCGHRKITA-LLCQCGFDVNIKCDVSAFGVTGWRAIHIAAERGDSDTLKLLISYGASCELMAEV--AEAADSGNEQQQQQP----DATAVATSGLAERWNAVHMAVSSESVESVRVCLQRGGAYVDTRT-LRRQTPLMLACKSGCLAIVQLLLTAGASLRARDSQGNTPLHYAAQ 236          

HSP 5 Score: 63.5438 bits (153), Expect = 4.422e-6
Identity = 60/228 (26.32%), Postives = 107/228 (46.93%), Query Frame = 2
Query:  134 IAKGDCKFVKAWLHGL--LYESTGWQLLDKAGWSI--LHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCME-VIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAK---VFIESRSIISRK--TALILACELCRLETVNVLLESGANPNVCDISNK---SPLFYAAKRG 778
            I KG  + VK  L     L+ +      D+  +S+  LH A++++H  I Q L++  + ++N  C S+      L P+H A  +G  +  K+LL R    +   E  + + LI      K +      +   +  +     +  LH  +  +H+D L +L+   +   V + S+ +  R+  TAL+L  E C  + V  LLE G++PNV   +N+   +P+F  A+ G
Sbjct:  462 IGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDRGV-DVNV-CTSSG-----LTPLHYAASWGHDAFAKLLLSRGATVDAVGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNVIFDANEMTLTPIFLCAEFG 682          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. TrEMBL
Match: A0A1I8HIL9 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 456.062 bits (1172), Expect = 3.415e-142
Identity = 252/603 (41.79%), Postives = 369/603 (61.19%), Query Frame = 1
Query: 1642 EVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVN-AINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDS----TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEAT--DGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLL 3429
            + E +V+ LH A+++    +     LL+ G+++   TS G TP  +A  +       LLL RG   +AV      + LI +A +     M+ LL++  + N +D  G TALH     +    +D  ++       N+   K+D     H      L+  L+Y +   V R+L+  +DP+++F  N +T+TPIFL  E   +  +  LI++GA+LN  SS  +ET LH ALR K +A A+ LI AG+++  R+ +G GE    +HVA Q GL+  I +L  +G+++NSTM LK VERV PLHLAALNDL+ TVK L    +   ++N  RSD+F  LLT V+K NV  V                 +S++ATCLHIAAQVGS EIV LLLE GA+P ARM+TGDR GILPVHLA+E+GHL+++K F D GV V+A EDCGLTCLHYAAN G  DI+++LL+ GA V+ +A   DGNR  +LP+HMA EKG+ +  +LL+E GSP++A   R  R N+T LY+A +EN   V+  L+ +G++ +IQ+  +GA PLHI+CQRG+      L+   + ++N+    G++ +H+ +EKGH +++ WL+
Sbjct:   14 QTEFSVSCLHTAVVMDHAGIG--QLLLDRGVDVNVCTSSGLTPLHYAASWGHDAFAKLLLSRGATVDAVGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVD-----HRRGVTALVLGLEYCSAKVVERLLEMGSDPNVIFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSS-RKETPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMHGA---DVNCQRSDTFTPLLTAVTKSNVCAV-----------------KSKDATCLHIAAQVGSLEIVDLLLERGANPLARMVTGDRAGILPVHLASETGHLDVIKRFLDIGVDVNAQEDCGLTCLHYAANGGKADIIKLLLERGARVDLKAAYDDGNRVDVLPLHMACEKGNAECARLLVEAGSPLDATLFRNRRGNITPLYLAVAENNPEVVSVLLAAGSDVNIQD-GIGAAPLHISCQRGYHDIFCQLLCHPSVNVNIATFNGVTPIHIVSEKGHFDMAMWLI 587          

HSP 2 Score: 142.51 bits (358), Expect = 2.951e-31
Identity = 143/591 (24.20%), Postives = 257/591 (43.49%), Query Frame = 1
Query: 2092 LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIH---LRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVE-RVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAED---------------CGL-----TCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRD-NLTALYIATSENRENVMKYLIKSGANPDIQE-----NNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLL-EAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIG 3771
            L YA  +G++     +L + A  D V        TP+  A   +  + M  L+ HGAN N+       T LH  L   ++     L+  G  +    +  ++     V  + + ++    +++E LL  GS  N  +I  + E  + P+ L A       ++ L  +  A +N  S+R ++   L   +  + V   + ++ AGAD+  +  +    +   +H+AAQ+G    ++LL EYGA+  + M     + + P+HLA  +   E VK+    G  V+                   C +     TCLH AA  GS++I+++LL+ GA+  A    G+R+ +LP+H+ASE GH   +K  L+ G  +NA       D  LT L+ A +  + +++K L++ GA  D++      N +   PLH+ C++G  +    L+   +     PL+                                    +  +    NI+PL  A    +  VV +L+  G+D++  +      G  P+H +  RG + +   LL    V+++    +G+TP+H    +G +D   +LI 
Sbjct:   55 LHYAASWGHDAFAKLLLSRGATVDAV--GEQFMATPLIYAARRDKHTTMRLLLEHGANPNH-QDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPN--VIFDANEMTLTPIFLCAEFGCVDKLQLLI-KYGADLNRTSSRKET--PLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMHGADVNCQRSDTFTPLLTAVTKSNVCAVKSKDATCLHIAAQVGSLEIVDLLLERGANPLARMVTGDRAGILPVHLASETGHLDVIKRFLDIGVDVNA-----QEDCGLTCLHYAANGGKADIIKLLLERGARVDLKAAYDDGNRVDVLPLHMACEKGNAECARLLVEAGS-----PLDA-----------------------------------TLFRNRRGNITPLYLAVAENNPEVVSVLLAAGSDVNIQDGI----GAAPLHISCQRGYHDIFCQLLCHPSVNVNIATFNGVTPIHIVSEKGHFDMAMWLIA 588          

HSP 3 Score: 127.487 bits (319), Expect = 1.905e-26
Identity = 130/546 (23.81%), Postives = 240/546 (43.96%), Query Frame = 1
Query: 2284 PNQE----TVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCI---VSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNL-------------------GATPLHITCQRGFTKAIMYLIGIANSSLNVPLN---TGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFE-GHK-GIQPIHCAAIRGKYHVIPTLLEAGVSIDEP----DEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            P+Q     + LH A+   +  I + L+  G ++++ +  G    + P+H A   G D   ++LL  G+++++   +       PL  AA  D  +T++ L    +   N N      + AL   ++  +V  +  +L  G  +    I   V   R  T L +  +  S ++V+ LLE G+DP   +   +   + P+ L  E G ++ ++L   +G  ++       T LH+A     V   E L++AGAD+   A+ GN      +H+A++ G    ++LL EYG+ +N+  +    + +T L++A   +    +K L+  GA+ + Q ++                     AT LHI  Q G  + +  L+    + L   +     GI  +HL +E GH ++    L           I    + +    ++ L+ A   G   ++KLL++ GA +     ++ G++  + P+H A  +G       L+EAG  +D          +TPL+ +V E   +    L+   ++VNI D IG  P
Sbjct:   12 PDQTEFSVSCLHTAVVMDHAGIGQLLLDRGVDVNVCTSSG----LTPLHYAASWGHDAFAKLLLSRGATVDA---VGEQFMATPLIYAARRDKHTTMRLLLEHGA---NPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNV-IFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSSRKETPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMHGADVNCQRSDTFTPLLTAVTKSNVCAVKSKDATCLHIAAQVGSLEIVDLLLERGANPLARMVTGDRAGILPVHLASETGHLDVIKRFL----------DIGVDVNAQEDCGLTCLHYAANGGKADIIKLLLERGARVDLKAAYDDGNRVDVLPLHMACEKGNAECARLLVEAGSPLDATLFRNRRGNITPLYLAVAENNPEVVSVLLAAGSDVNIQDGIGAAP 536          

HSP 4 Score: 81.2629 bits (199), Expect = 8.674e-12
Identity = 111/533 (20.83%), Postives = 219/533 (41.09%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAI----NESGLILSAIKKNPEIMKFLLQNQVDSNQ----KDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKID-----------DNDSSHSLKSGYLIY-ALQYGNEIDVVRVLKQAADP-DLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQE----TVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGE--EVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEI 2889
            G++PN    Q  T+L + +   H    ++L+N G  ++ N+    V     +T   ++ + L Y   +  + L++ G++  +  D          +TL  + +  +   ++ +  L++ G ++   +S+ +TP  FA+R+ K+ A   L+  G D     +I    ++ G+ ++A       ++ L +   + N     K    +T LH + + D    +   +    ++   + D            N  +   K    ++ A Q G+   V  +L++ A+P   +   +   + P+ LA E   +  +   +  G ++N      QE    T LH A       I K L+  G+ + L++    G   +VLP+H+A + G  E   +L+  GS L++T+       + PL+LA                                    V++ N   V  +L AG+DV+    +     A  LHI+ Q G  +I   LL +   P   +     +G+ P+H+ +E GH ++
Sbjct:  108 GANPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVT---ALVLGLEYCSAKVVERLLEMGSDPNVIFD-------ANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSSRKETPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMHGADVNCQRSDTFTPLLTAVTKSNVCAVKSKDATCLHIAAQVGSLEIVDLLLERGANPLARMVTGDRAGILPVHLASETGHLDVIKRFLDIGVDVNA-----QEDCGLTCLHYAANGGKADIIKLLLERGARVDLKAAYDDGNRVDVLPLHMACEKGNAECARLLVEAGSPLDATLFRNRRGNITPLYLA------------------------------------VAENNPEVVSVLLAAGSDVN----IQDGIGAAPLHISCQRGYHDIFCQLLCH---PSVNVNIATFNGVTPIHIVSEKGHFDM 582          

HSP 5 Score: 62.3882 bits (150), Expect = 7.854e-6
Identity = 52/193 (26.94%), Postives = 93/193 (48.19%), Query Frame = 2
Query:  227 SILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCME-VIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAK---VFIESRSIISRK--TALILACELCRLETVNVLLESGANPNVCDISNK---SPLFYAAKRG 778
            S LH A++++H  I Q L++   +++N  C S+      L P+H A  +G  +  K+LL R    +   E  + + LI      K +      +   +  +     +  LH  +  +H+D L +L+   +   V + S+ +  R+  TAL+L  E C  + V  LLE G++PNV   +N+   +P+F  A+ G
Sbjct:   20 SCLHTAVVMDHAGIGQLLLDRG-VDVNV-CTSSG-----LTPLHYAASWGHDAFAKLLLSRGATVDAVGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNVIFDANEMTLTPIFLCAEFG 205          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. TrEMBL
Match: A0A1I8G7H1 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 3.691e-98
Identity = 214/585 (36.58%), Postives = 327/585 (55.90%), Query Frame = 1
Query: 1111 KKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVN-AINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDS----TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGIL 2850
            +K++ LLS    DIN V   + ++  N L +L+         +  +L+  LL++ +N++   S   S L  A Q   + +V+ L     +PN+      T+LM++++ R+  +   L+    ++   + F     N K  NC  + +A+     E  + L+D GANLF  +D +   + E +V+ LH A+++    +     LL+ G+++   TS G TP  +A  +       LLL RG   +AV      + LI +A +     M+ LL++  + N +D  G TALH     +    +D  ++       N+   K+D     H      L+  L+Y +   V R+L+  +DP+++F  N +T+TPIFL  E   +  +  LI++GA+LN  SS  +ET LH ALR K +A A+ LI AG+++  R+ +G GE    +HVA Q GL+  I +L  +G+++NSTM LK VERV PLHLAALNDL+ TVK L    +   ++N  RSD+F  LLT V+K NV  V+ ++ AGAD+  +CIVSRS++ATCLHIAAQVGS EIV LLLE GA+P ARM+TGDR GIL
Sbjct:  189 EKLDLLLSR-GADINRVFEYNSLTGVNALRLLVETRS-----INTDLVHYLLSNGVNVDSLASDGVSPLLCAAQKGSVVMVTKLCKYSPNPNVADRDGYTALMYAVKCRNSSLVRTLLELKPDLEIAINFYDARRN-KYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIG--QLLLDRGVDVNVCTSSGLTPLHYAASWGHDAFAKLLLSRGATVDAVGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVD-----HRRGVTALVLGLEYCSAKVVERLLEMGSDPNVIFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSS-RKETPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMLGA---DVNCQRSDTFTPLLTAVTKSNVCAVKCLVRAGADIHTRCIVSRSKDATCLHIAAQVGSLEIVDLLLERGANPLARMVTGDRAGIL 755          

HSP 2 Score: 122.094 bits (305), Expect = 2.388e-24
Identity = 171/721 (23.72%), Postives = 309/721 (42.86%), Query Frame = 1
Query: 1408 TSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEM---GLNIESK-----TSKGDTPFLFAIRY----SKIEACNLLLFRGCD------KNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHN--------NVTMTPIFLAVEMNSISNMCHLIRHGANL--NYIS-SPNQE----TVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCI---VSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIA---NSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNP 3447
            T L +++   H+K+T LL   G        FD+   N+K      +H A      ET + ++  GA      D ++          LH A   +S+ +  +  LL+    GL   +         G TP + A+      +  E  +LLL RG D       N++  +N   L++     N +++ +LL N V+ +   + G++ L  +  +   + +      S N  +A  D          GY  L+YA++  N   +VR L +   PDL    N            TP+ +A+    +  +  L+  GANL  N  S  P+Q     + LH A+   +  I + L+  G ++++ +  G    + P+H A   G D   ++LL  G+++++   +       PL  AA  D  +T++ L    +   N N      + AL   ++  +V  +  +L  G  +    I   V   R  T L +  +  S ++V+ LLE G+DP   +   +   + P+ L  E G ++ ++L   +G  ++       T LH+A     V   E L++AGAD+   A+ GN      +H+A++ G    ++LL EYG+ +N+  +    + +T L++A   +    +K L+  GA+ + Q ++   TPL     +    A+  L+      ++   V  +   + LH+ A+ G  E+   LL    NP
Sbjct:   65 TLLHYAVLCGHRKITALLCQCG--------FDV---NIKCDGNTPLHYAAQSPCPETLRLILQDGAR----ADAVNS----AGQLPLHNAAQSRSSGVQNLQLLLDTWPSGLEAVASLPDLNIGAGATPLIAAVATPGASAVTEKLDLLLSRGADINRVFEYNSLTGVNALRLLVETRSINTDLVHYLLSNGVNVDSLASDGVSPLLCAAQKGSVVMVTKLCKYSPNPNVADRD----------GYTALMYAVKCRNS-SLVRTLLEL-KPDLEIAINFYDARRNKYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDRGVDVNVCTSSG----LTPLHYAASWGHDAFAKLLLSRGATVDA---VGEQFMATPLIYAARRDKHTTMRLLLEHGA---NPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNV-IFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSSRKETPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMLGADVNCQRSDT-FTPLLTAVTKSNVCAVKCLVRAGADIHTRCIVSRSKDATCLHIAAQVGSLEIVDLLLERGANP 742          

HSP 3 Score: 105.531 bits (262), Expect = 3.547e-19
Identity = 168/716 (23.46%), Postives = 304/716 (42.46%), Query Frame = 1
Query: 1660 TLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLI-------YALQYGN--EIDVVRVL--KQAADPDLV--FIHNNVTM--------TPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLR-----SRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVER----VNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWG-------VSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQE---NNLGATPLHITCQRGFTKAIMYLIGIA---NSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAG 3678
            TLLH A+L     +  +  L + G ++  K   G+TP  +A +    E   L+L  G   +AVN+  +  L  +A  ++  +    LQ  +D+      GL A+  + + D  IG       +T +  A      S+ + K   L+          +Y +   ++ +R+L   ++ + DLV   + N V +        +P+  A +  S+  +  L ++  N N ++  +  T L  A++ +N ++ + L+    ++ +      +R  +     P+ +A+  G  EI+++LL  G++L + M     ++    V+ LH A + D     + L  +    +++N   S     L    S  +    + +L  GA V     V     AT L  AA+      ++LLLE+GA+P  +    D+ G   +H      H++ + +  + G       +S       G+T L       S  ++E LL+ G+D N    D N   + PI + +E G    ++LL++YG+ +N   SR      T L+ A    +    + LI++GA+ + +    N      +H+  Q G    I  L       NS++ +     ++ LHL A    +E    L+    + N   Q +D+F+        PL  A    ++  VK LV+ GADIH        K    +H AA  G   ++  LLE G
Sbjct:   65 TLLHYAVLCGHRKITAL--LCQCGFDVNIKCD-GNTPLHYAAQSPCPETLRLILQDGARADAVNSAGQLPLHNAAQSRSSGVQN--LQLLLDTWPS---GLEAV--ASLPDLNIGAG-----ATPLIAAVATPGASAVTEKLDLLLSRGADINRVFEYNSLTGVNALRLLVETRSINTDLVHYLLSNGVNVDSLASDGVSPLLCAAQKGSVVMVTKLCKYSPNPN-VADRDGYTALMYAVKCRNSSLVRTLLELKPDLEIAINFYDARRNKYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDR---GVDVNVCTSSGLTPLHYAASWGHDAFAKLLLSRGATVDA---VGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQ----DKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNV-IFDANEMTLTPIFLCAEFGCVDKLQLLIKYGADLNRTSSRKE----TPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMLGADVNC--QRSDTFT--------PLLTAVTKSNVCAVKCLVRAGADIHTRCIVSRSKDATCLHIAAQVGSLEIVDLLLERG 739          

HSP 4 Score: 95.9005 bits (237), Expect = 3.891e-16
Identity = 115/496 (23.19%), Postives = 210/496 (42.34%), Query Frame = 1
Query: 2443 EIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSR-----NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRD----GILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGS-----------------------------------PINAVFSRLN-RDNLTALYIATSENRENVMKYLIKSGANPDI--QENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVN 3789
            +++  LL  G +++S     + + V+PL  AA      +V  +T     S N N    D + AL+  V  RN   V+++L    D+        +R     N T L +A   G  EIV++LL+ GA+ FA M +   D     +  +H A    H  I +L  D GV V+     GLT LHYAA+ G     ++LL  GA V+A    G +    P+  A+ +    +++LLLE+G+                                    +N +  +++ R  +TAL +        V++ L++ G++P++    N +  TP+ +  + G    +  LI    + LN   +   + LH          +  L+R   +      I +   ++       ++ A   G  + ++LL ++GA+++   T +  + + P+H AA+      +  L+  G  ++    D  TPL  +V +      K L+   A+++
Sbjct:  228 DLVHYLLSNGVNVDSL----ASDGVSPLLCAAQK---GSVVMVTKLCKYSPNPNVADRDGYTALMYAVKCRNSSLVRTLLELKPDLEIAINFYDARRNKYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDRGVDVNVCTSSGLTPLHYAASWGHDAFAKLLLSRGATVDAV---GEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNVIFDANEMTLTPIFLCAEFGCVDKLQLLIKYG-ADLNRTSSRKETPLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQG------VHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMLGADVNCQRSDTFTPLLTAVTKSNVCAVKCLVRAGADIH 706          

HSP 5 Score: 83.5741 bits (205), Expect = 2.605e-12
Identity = 121/579 (20.90%), Postives = 229/579 (39.55%), Query Frame = 1
Query: 1573 ETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVD--------SNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKS---------------GYLI-------------------YALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIH---LRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVE-RVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAED---------------CGL----------------------TCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKML 3060
            E    L+ +GA+    ++ + E    T V  L L +  +S + + +++LL  G+N++S  S G +P L A +   +     L     + N  +    + L+ +   +N  +++ LL+ + D          +++ Y         I   ++ I   + D+     A +D      +  S               G L+                   YA  +G++     +L + A  D V        TP+  A   +  + M  L+ HGAN N+       T LH  L   ++     L+  G  +    +  ++     V  + + ++    +++E LL  GS  N  +I  + E  + P+ L A       ++ L  +  A +N  S+R ++   L   +  + V   + ++ AGAD+  +  +    +   +H+AAQ+G    ++LL EYGA+  + M     + + P+HLA  +   E VK+    G  V+                   C +                      TCLH AA  GS++I+++LL+ GA+  A    G+R+ +L
Sbjct:  189 EKLDLLLSRGAD----INRVFEYNSLTGVNALRLLVETRSINTDLVHYLLSNGVNVDSLASDGVSPLLCAAQKGSVVMVTKLCKYSPNPNVADRDGYTALMYAVKCRNSSLVRTLLELKPDLEIAINFYDARRNKYANCTPLQMAIGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDRGVDVNVCTSSGLTPLHYAASWGHDAFAKLLLSRGATVDAV--GEQFMATPLIYAARRDKHTTMRLLLEHGANPNH-QDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPN--VIFDANEMTLTPIFLCAEFGCVDKLQLLI-KYGADLNRTSSRKET--PLHFALRFKKVAAAERLIRAGADLETRASIGNGEHQQGVHVAAQLGLNSCIRLLAEYGANVNSTMTLKCVERVTPLHLAALNDLSETVKILVMLGADVNCQRSDTFTPLLTAVTKSNVCAVKCLVRAGADIHTRCIVSRSKDATCLHIAAQVGSLEIVDLLLERGANPLARMVTGDRAGIL 755          

HSP 6 Score: 76.6406 bits (187), Expect = 3.139e-10
Identity = 116/470 (24.68%), Postives = 179/470 (38.09%), Query Frame = 1
Query: 2737 TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDI--MEILL---KAGADVNAEATD-----GNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVF--SRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRG----FTK-----------------AIMYLIGIANSSL-----------NVPLN---------TGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADI-----------HWAETFEGHKGIQ--------------------PIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLI--GLKANVNIIDKIGKKPKDYAVTANLMSLF*LSMCFFERLF 3888
            T LH A   G  +I  LL + G D     +    DG  P+H A +S   E ++L    G    A    G   LH AA + S  +  +++LL    +G +  A   D     G    +  +         + + LLL  G+ IN VF  + L   N   L + T     +++ YL+ +G N D   ++ G +PL    Q+G     TK                 A+MY +   NSSL            + +N            + L +   KG  E+   LL      NL   +      +T +++S L+ A    H  + +LL+  G D+           H+A ++ GH                        P+  AA R K+  +  LLE G + +  D+ G T LHW +     D    L+  G K +VN+I +  K      VTA ++ L   S    ERL 
Sbjct:   65 TLLHYAVLCGHRKITALLCQCGFD-----VNIKCDGNTPLHYAAQSPCPETLRLILQDGARADAVNSAGQLPLHNAAQSRSSGVQNLQLLLDTWPSGLEAVASLPDLNIGAGATPLIAAVATPGASAVTEKLDLLLSRGADINRVFEYNSLTGVNALRLLVETRSINTDLVHYLLSNGVNVDSLASD-GVSPLLCAAQKGSVVMVTKLCKYSPNPNVADRDGYTALMYAVKCRNSSLVRTLLELKPDLEIAINFYDARRNKYANCTPLQMAIGKGQMEIVKMLL--DAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDRGVDVNVCTSSGLTPLHYAASW-GHDAFAKLLLSRGATVDAVGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQ--KVDHRRGVTALVLGLEYCSAKVVERLL 523          

HSP 7 Score: 63.1586 bits (152), Expect = 4.175e-6
Identity = 60/228 (26.32%), Postives = 107/228 (46.93%), Query Frame = 2
Query:  134 IAKGDCKFVKAWLHGL--LYESTGWQLLDKAGWSI--LHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCME-VIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAK---VFIESRSIISRK--TALILACELCRLETVNVLLESGANPNVCDISNK---SPLFYAAKRG 778
            I KG  + VK  L     L+ +      D+  +S+  LH A++++H  I Q L++   +++N  C S+      L P+H A  +G  +  K+LL R    +   E  + + LI      K +      +   +  +     +  LH  +  +H+D L +L+   +   V + S+ +  R+  TAL+L  E C  + V  LLE G++PNV   +N+   +P+F  A+ G
Sbjct:  330 IGKGQMEIVKMLLDAGANLFANMDSMGPDQTEFSVSCLHTAVVMDHAGIGQLLLDRG-VDVNV-CTSSG-----LTPLHYAASWGHDAFAKLLLSRGATVDAVGEQFMATPLIYAARRDKHTTMRLLLEHGANPNHQDKQGYTALHWCLTFNHVDSLDVLLNCGRKLDVNLISQKVDHRRGVTALVLGLEYCSAKVVERLLEMGSDPNVIFDANEMTLTPIFLCAEFG 550          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 212.231 bits (539), Expect = 3.599e-55
Identity = 192/717 (26.78%), Postives = 320/717 (44.63%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVR----VLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKI 3804
            LHLA   K   +  +  LL  G+++E+ T KG+T    A    + +    L+  G + NA +    S L ++A + + E++KFLL+N  + +     G T L  +  Q     +   I+  T                K    + AL      D  R    +L+   +PD++   +    TP+ +A    ++S    L+  GAN+N+    N  T LH+A R  N+ + + L+  G+ I  R++    +E+ P+H A +NG   +IEILL  G+ + +    K+   ++P+H+AA  D    V+ L                 +NA +  ++  ++                         T LH+AA  G   + ++LL+ GA   AR +    +G  P+H+A +  H+  + L      S+ A  + GLT LH AA  G ++I++ LL+ GA  NA     N     P+HMA+  GH +  + LL+  + ++A      +D+ T L+ A     + ++K L++  ANPD      G TPLHI  + G       L+   N+        G + LH+  + G  +++  LL    NPN  G+            ++PL+ A    +L VVKLLV  G   H         G  P+H AA + +  V  +LL+ G + +     G+TPLH +  EG  D    LI  + NVN+ +K+
Sbjct:   24 LHLAS--KEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGT----------------KGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL---SKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPK-NGITPLHIAARRGNVIMVRLLLDRGAQIDARTK----DELTPLHCAARNGHVRVIEILLDQGAPIQA----KTKNGLSPIHMAAQGDHMDCVRQLLQ---------------YNAEIDDITLDHL-------------------------TPLHVAAHCGHHRMAKVLLDKGAKANARAL----NGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNAS----NVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKA----KDDQTPLHCAARMGHKELVKLLLEHKANPD-SATTAGHTPLHIAAREGHAHTTRILLD-GNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGK----------NGLTPLHVAVHHNNLDVVKLLVSKGGSPHST----ARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKV 642          

HSP 2 Score: 178.718 bits (452), Expect = 7.673e-45
Identity = 205/823 (24.91%), Postives = 362/823 (43.99%), Query Frame = 1
Query: 1105 HIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAG-----SNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPIN-AVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLL 3555
            H+K +  LL  + +D+ +         N  LHI  +  ++       +++  L+ +  N+N  + K  S L++A Q N L +V  LL  G++ ++      T L  ++Q+ H+ +  LLINYG               V+L    ++H+A    D  T   L+    N     D+L     +T  T LH+A   +  +L+    LL  G N+      G TP   A R   +    LLL RG   +A      + L  +A   +  +++ LL        K   GL+ +H +   D    +   +      + A+IDD    H      L  A   G+      +L + A  +   ++     TP+ +A + N + +M  L++H A+L  ++  +  T LHVA    ++ I K L+  G     SN+ + +         P+H+A + G  E+ + LL   + +++    K+ +   PLH AA       VK L   ++   N +S  + + +  L + ++        +L+ G     K      +  T LH+A + G  ++ +LLLE GA+P A      ++G+ P+H+A    +L++VKL    G S  +    G T LH AA    +++   LL+ GA+ N+E+  G    + P+H+A+++G    V LL+     +N     R     LT L++   E    +   L+K GA+     + +G T LH+ C  G  K + +L+    + +N     G + LH  A++GH ++   LL+    PN          + T+   SPL  A   G+++V+ +L
Sbjct:   32 HVKMVLELL-HHGIDLETTTK----KGNTALHIAALAGQE-------KVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----------GKVRL---PALHIAARNDDTRTAAVLLQNDPN----PDVLS----KTGFTPLHIAAHYE--NLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQ-----YNAEIDDITLDHLTP---LHVAAHCGHHRMAKVLLDKGAKANARALNG---FTPLHIACKKNHMRSMDLLLKHSASLEAVTE-SGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVET---------PLHMAARAGHCEVAQFLLQNLAQVDA----KAKDDQTPLHCAARMGHKELVKLLLEHKA---NPDSA-TTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMT---KKGFTPLHVACKYGKVDVAELLLERGANPNA----AGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQG----ITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGAS-VYSASRMGYTALHVACHYGNIKMVKFLLQ-QQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPN----------EITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 3 Score: 171.4 bits (433), Expect = 1.486e-42
Identity = 152/570 (26.67%), Postives = 261/570 (45.79%), Query Frame = 1
Query: 2236 MCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFL---------------------THQQSASI---------NINSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSL 3852
            +  L+ +GAN+N   S    + L++A +  ++ + K L+  G+N  L +  G      P+ VA+Q G + ++ +L+ +G+        K   R+  LH+AA ND T T   L                      H ++ S+         N+N T  +    L     + NVI V+ +L  GA +      +R+++  T LH AA+ G   ++++LL+ GA   A+     ++G+ P+H+A +  H++ V+    +   +       LT LH AA+ G   + ++LL  GA  NA A +G      P+H+A +K H +S+ LLL++ + + AV        LT L++A      N++K L++ GA+P+     +  TPLH+  + G  +   +L+    + ++       + LH  A  GH EL   LL  K NP+            T+   +PL+ A   GH    ++L+    D +  +T    KG  P+H A   GK  V   LLE G + +   ++GLTPLH +V     D  K L+    + +   + G  P   A   N + +
Sbjct:   69 VAELVHYGANVN-AQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDG----FTPLAVALQQGHENVVALLINYGT--------KGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQID-----ARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKT----KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNG----FTPLHIACKKNHMRSMDLLLKHSASLEAV----TESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKV-ETPLHMAARAGHCEVAQFLLQNL-AQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPD----------SATTAGHTPLHIAAREGHAHTTRILL----DGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEV 592          

HSP 4 Score: 167.933 bits (424), Expect = 1.666e-41
Identity = 212/859 (24.68%), Postives = 371/859 (43.19%), Query Frame = 1
Query: 1177 VSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQN--QVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAG-ADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLL-EYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLN-------TGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
             +N NGL+ L +  K+       +++  LL H I++  T  K  + L +A       +V+ L+  G++ N    +  + L  + Q+ H ++ + L+  GAN +       + +    T  A   VAL    +     LI+ G               +  V L  L I  +++       LL+   N +  +  G TP   A  Y  +    LLL RG + N       + L ++A + N  +++ LL    Q+D+  KD   LT LH +                                 ++G+          + V+ +L     P      N   ++PI +A + + +  +  L+++ A ++ I+  +  T LHVA    +  +AK L+  G+  + R+  G      P+H+A +      +++LL   +SL +     +   + PLH+AA     + VK L  Q+ AS N ++ + ++    L + ++     V   L+   A V  K       + T LH AA++G  E+V+LLLE+ A+P +    G      P+H+A   GH    ++  D     +     G T LH A   G VD+ E+LL+ GA+ NA   +G    + P+H+A    +   VKLL+ + GSP +       R+  T L+IA  +N+  V   L++ GAN +  E+  G TPLH+  Q G    +  LI   +   NV L        T ++ LHL A++GH  ++  L++             S    +    + L+ AC +G++ +VK L++  A ++         G  P+H AA +G   ++  LL+ G   +E   +G +PL
Sbjct:   15 TANQNGLNGLHLASKEGHV----KMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQS-------LPTEDGFTPLA---VALQQGHENVVALLINYG--------------TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDE--LTPLHCA--------------------------------ARNGH----------VRVIEILLDQGAPIQAKTKNG--LSPIHMAAQGDHMDCVRQLLQYNAEIDDITL-DHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNG----FTPLHIACKKNHMRSMDLLLKHSASLEAV----TESGLTPLHVAAFMGHLNIVKSLL-QRGASPNASNVKVET---PLHMAARAGHCEVAQFLLQNLAQVDAKA----KDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGH----TPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNG----LTPLHVAVHHNNLDVVKLLVSKGGSPHSTA-----RNGYTPLHIAAKQNQLEVASSLLQCGANAN-SESLQGITPLHLAAQEGRPDMVALLI---SKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGA----------SVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRV----GYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPL 751          

HSP 5 Score: 116.316 bits (290), Expect = 1.236e-25
Identity = 95/332 (28.61%), Postives = 151/332 (45.48%), Query Frame = 1
Query: 2911 GVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF*LSMCFFERLFYKFSCD 3906
            G++++ A   GL  LH A+  G V ++  LL  G D+      GN +    +H+A+  G +K V  L+ YG+ +NA     ++   + LY+A  EN   V+K+L+++GAN  +   + G TPL +  Q+G    +  LI              + +LH+ A       +  LL+   NP       D  SK      +PL+ A  + +L+V +LL+  GA+++    F    GI P+H AA RG   ++  LL+ G  ID   +D LTPLH +   G     + L+   A +    K G  P   A   + M       C  + L Y    D
Sbjct:   10 GIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTA----LHIAALAGQEKVVAELVHYGANVNAQ----SQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTED-GFTPLAVALQQGHENVVALLINYGTKG-----KVRLPALHIAARNDDTRTAAVLLQNDPNP-------DVLSKT---GFTPLHIAAHYENLSVAQLLLNRGANVN----FTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMD------CVRQLLQYNAEID 307          

HSP 6 Score: 55.4546 bits (132), Expect = 3.710e-12
Identity = 57/218 (26.15%), Postives = 91/218 (41.74%), Query Frame = 2
Query:  179 LLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINF-PCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFN--ISDTYVLLD-----------AWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            LL       +L K G++ LH A    ++ +AQ L+N    N+NF P N        + P+HIA   G   ++++LL R    +      K EL           P+ C   N  +    +LLD             +P+H+    DH+DC++ L+Q  A++       +   T L +A          VLL+ GA  N   ++  +PL  A K+   R
Sbjct:  167 LLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRG-ANVNFTPKNG-------ITPLHIAARRGNVIMVRLLLDRGAQID---ARTKDELT----------PLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMR 360          

HSP 7 Score: 36.965 bits (84), Expect = 3.710e-12
Identity = 79/398 (19.85%), Postives = 146/398 (36.68%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHI----KKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTS---KGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQ 1989
            +GH  IV+ LL+ GA+P     + + TPLH +  + + +     +Q                   N  Q++    +             D    +C      K++  LL E+K + +S  T          H  L I  +           ILL       +   K  + L +A +   + +   LL RG++PN      +T L  ++   +  + +LL++ G + +          +        +H+A   +  E    L+  GAN           E    +T LHLA       +  +    +  +N+ +K        TP     +   +   ++L+ +G    + + +  + L ++    N +++KFLLQ Q   N K   G T LH +  Q
Sbjct:  389 MGHLNIVKSLLQRGASPNASNVKVE-TPLHMAARAGHCEVAQFLLQ-------------------NLAQVDAKAKD-------------DQTPLHCAARMGHKELVKLLLEHKANPDSATTAG--------HTPLHIAAREGH---AHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPH----------STARNGYTPLHIAAKQNQLEVASSLLQCGANA--------NSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQ 724          

HSP 8 Score: 55.8398 bits (133), Expect = 2.863e-8
Identity = 50/191 (26.18%), Postives = 79/191 (41.36%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLI-QEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 784
            + G++ LH A   N +++A  L+           N+ S  L  + P+H+A + GR  ++ +L+ +  N  L  +V                               L A  PLHLV    H+    ML+ Q A V+  SR      TAL +AC    ++ V  LL+  A+ N       +PL  AA++G T
Sbjct:  575 RNGYTPLHIAAKQNQLEVASSLLQCG-------ANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKV----------------------------RTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGY---TALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHT 727          

HSP 9 Score: 23.483 bits (49), Expect = 2.863e-8
Identity = 10/16 (62.50%), Postives = 12/16 (75.00%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANP 867
            GH  IV +LLK+GA P
Sbjct:  725 GHTDIVTLLLKHGALP 740          

HSP 10 Score: 46.595 bits (109), Expect = 8.386e-8
Identity = 45/195 (23.08%), Postives = 85/195 (43.59%), Query Frame = 2
Query:  239 DAIILNHVD---IAQHLINHSLMNI--NFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDA---------WNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            D I L+H+    +A H  +H +  +  +    + +  L+   P+HIAC+      + +LL+ + +    +E +    + P+ ++      F    NI  + +   A           PLH+     H +  + L+Q  A+V  +++     +T L  A  +   E V +LLE  ANP+    +  +PL  AA+ G
Sbjct:  307 DDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSAS----LEAVTESGLTPLHVAA-----FMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAK---DDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREG 489          

HSP 11 Score: 30.8018 bits (68), Expect = 8.386e-8
Identity = 18/45 (40.00%), Postives = 25/45 (55.56%), Query Frame = 1
Query:  799 CCYSF*IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNID 933
            C Y    G   + E+LL+ GANP    K + +TPLH +   NN+D
Sbjct:  519 CKY----GKVDVAELLLERGANPNAAGK-NGLTPLHVAVHHNNLD 558          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 210.69 bits (535), Expect = 1.009e-54
Identity = 190/717 (26.50%), Postives = 324/717 (45.19%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   +  +  LL  G+ +E+ T KG+T    A    + +    L+  G + NA +    + L ++A + + E++KFLL+N  + +       +A+  +    F +   Y   ++++I +     N  S    +G+                                  TP+ +A    +++    L+  GAN+N+    N  T LH+A R  N+ + + L+  G+ I  +++    +E+ P+H A +NG   IIEILL  G+ + +    K+   ++P+H+AA  D    V+ L                 +NA +  ++  ++                         T LH+AA  G   + ++LL+ GA P  R +    +G  P+H+A +  HL ++ L      S+ A  + GLT LH A+  G ++I++ILL+ GA  NA     N     P+HMAS  GH +  + LL+  +P++A      +D+ T+L+ A     + ++K L++  ANP+      G TPLHI  + G T+ +  L+ + N+        G + LH+ A+ G  +++  LL    NPN  G+            ++PL+ A    +L VV LLV  G   H A       G  P+H A+ + +  V  +LL+ G S +     G+TPLH +  EG  D    LI  +ANVN+ +K G  P
Sbjct:   47 LHLAS--KEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPL---YLSTNASHITL----KNVCSFITATGF----------------------------------TPLHIAAHYENLNVAQLLLNRGANVNFTPK-NGITPLHIASRRGNVIMVRLLLDRGATIDAKTK----DELTPLHCAARNGHVRIIEILLDQGAPIQA----KTKNGLSPIHMAAQGDHMDCVRQLLQ---------------YNAEIDDITLDHL-------------------------TPLHVAAHCGHHRMAKVLLDKGAKPNTRAL----NGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNAS----NVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKA----KDDQTSLHCAARMGHKELVKLLLEHKANPN-STTTAGHTPLHIAAREGHTQTVRILLDM-NAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGK----------NGLTPLHVAVHHNNLDVVNLLVSKGGSPHSA----ARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTP 643          

HSP 2 Score: 182.185 bits (461), Expect = 7.407e-46
Identity = 197/791 (24.91%), Postives = 359/791 (45.39%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYS-----KIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSH-SLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMA-GADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLL-EYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            G D N      +  L  + ++ H KM   L++ G          +VL         ++H+A +   ++    L++ GAN+          + +   T L++A   + N L  + FLLE G N    T    +    A  YS        A ++ L   C  + + A   + L ++A  +N  + + LL    + N     G+T LH +  +   I +   +     I     D+    H + ++G+          + ++ +L     P      N   ++PI +A + + +  +  L+++ A ++ I+  +  T LHVA    +  +AK L+  G+  + R+  G      P+H+A +     ++++LL   +SL +     +   + PLH+A+     + VK L  Q+ AS N ++ + ++    L + S+     V   L+   A V  K       + T LH AA++G  E+V+LLLE+ A+P +    G      P+H+A   GH + V++  D     +     G T LH AA  G VD+ E+LL+ GA+ NA   +G    + P+H+A    +   V LL+ + GSP +A      R+  T L+IA+ +N+  V   L++ GA+ +  E+  G TPLH+  Q G    +  LI    +++N+   +G++ LHL A++GH  ++  L++             S    T    +PL+ AC +G++ +VK L++  A+++     +   G  P+H AA +G   ++  LL+ G   +E   +G + L
Sbjct:   33 GIDINTANQNGLNGLHLASKEGHVKMVLELLHNG----------VVLETTTKKGNTALHIAALAGQEQVVTELVNYGANV--------NAQSQKGFTPLYMAA--QENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVC--SFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGH----------VRIIEILLDQGAPIQAKTKNG--LSPIHMAAQGDHMDCVRQLLQYNAEIDDITL-DHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNG----FTPLHIACKKNHLRVMDLLLKHSASLEAV----TESGLTPLHVASFMGHLNIVKILL-QKGASPNASNVKVET---PLHMASRAGHCEVAEFLLQNAAPVDAKA----KDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGH----TPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNG----LTPLHVAVHHNNLDVVNLLVSKGGSPHSAA-----RNGYTPLHIASKQNQVEVASSLLQYGASANA-ESLQGVTPLHLAAQEGRADMVSLLIS-KQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGA----------SVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNG----KTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSAL 743          

HSP 3 Score: 166.777 bits (421), Expect = 4.242e-41
Identity = 151/547 (27.61%), Postives = 251/547 (45.89%), Query Frame = 1
Query: 2296 TVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGS-------------------------SLNSTMI-LKSV------ERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            T LH+A       +  EL+  G+N++ +S+ G      P+++A Q    E+++ LL  G+                         S N++ I LK+V          PLH+AA  +  +  + L ++ +   N+N T  +    L     + NVI V+ +L  GA +  K         T LH AA+ G   I+++LL+ GA   A+     ++G+ P+H+A +  H++ V+    +   +       LT LH AA+ G   + ++LL  GA  N  A +G      P+H+A +K H + + LLL++ + + AV        LT L++A+     N++K L++ GA+P+     +  TPLH+  + G  +   +L+  A + ++       +SLH  A  GH EL   LL  K NPN T          T+   +PL+ A   GH   V++L+    D++  +T    KG  P+H AA  GK  V   LLE G + +   ++GLTPLH +V     D    L+    + +   + G  P   A   N
Sbjct:   78 TALHIAALAGQEQVVTELVNYGANVNAQSQKG----FTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGA---NVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKT----KDELTPLHCAARNGHVRIIEILLDQGAPIQAKT----KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNG----FTPLHIACKKNHLRVMDLLLKHSASLEAV----TESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKV-ETPLHMASRAGHCEVAEFLLQNA-APVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNST----------TTAGHTPLHIAAREGHTQTVRILL----DMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQN 585          

HSP 4 Score: 132.109 bits (331), Expect = 1.857e-30
Identity = 159/624 (25.48%), Postives = 263/624 (42.15%), Query Frame = 1
Query: 1255 DILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENV-----------------C------FDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQN--QVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVT---MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDG 3042
             +LL    N+N T     + L +A +   + +V  LL RG+  +      +T L  + +  H ++ E+L++ GA I                     C      ++  + ++ L +   +HVA         + L+DKGA                  T LH+A   K N L  ++ LL+   ++E+ T  G TP   A     +    +LL +G   NA N   E+ L +++   + E+ +FLLQN   VD+  KD+   T+LH +     R+G    +     + +    + +S+ +     L  A + G+    VR+L      D+      +T    TP+ +A +   +     L+  GAN N  +  N  T LHVA+ + N+ +   L+  G + H  +R G      P+H+A +    E+   LL +G+S N+    +S++ V PLHLAA       V  L  +Q+   N+N                   +G +S L                  T LH+ AQ G   I  +L++ GA  +A      R G  P+H+A   G++++VK       +V+     G T LH AA  G  DI+ +LLK GA  N   T+G
Sbjct:  195 QLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAK--------PNTRALNGFTPLHIAC--KKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQ--TSLHCA----ARMGHKELV----KLLLEHKANPNSTTTAGHTPLHIAAREGH-TQTVRILL-----DMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPN-AAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNG----YTPLHIASKQNQVEVASSLLQYGASANA----ESLQGVTPLHLAAQEGRADMVSLLISKQA---NVN-------------------LGNKSGL------------------TPLHLVAQEGHVGIADILVKQGASVYA----ATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNG 739          

HSP 5 Score: 94.7449 bits (234), Expect = 5.070e-19
Identity = 92/316 (29.11%), Postives = 145/316 (45.89%), Query Frame = 1
Query: 2962 AANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI-GIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF*LSMCFFERLFYKFSCD 3906
            AA +G++D     +K G D+N      N++ +  +H+AS++GH K V  LL  G     V     +   TAL+IA    +E V+  L+  GAN + Q    G TPL++  Q    + + +L+   AN S  +P     S++ L      N  SF L       ++T +   SF   T +  +PL+ A  + +L V +LL+  GA+++    F    GI P+H A+ RG   ++  LL+ G +ID   +D LTPLH +   G     + L+   A +    K G  P   A   + M       C  + L Y    D
Sbjct:   17 AARSGNLDKALDHIKNGIDINT----ANQNGLNGLHLASKEGHVKMVLELLHNG----VVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQK-GFTPLYMAAQENHLEVVKFLLENGANQS--IPTEVKPSAVSLA-----NSYSFPLYLSTNASHITLKNVCSFITATGF--TPLHIAAHYENLNVAQLLLNRGANVN----FTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMD------CVRQLLQYNAEID 304          

HSP 6 Score: 54.6842 bits (130), Expect = 8.320e-7
Identity = 54/209 (25.84%), Postives = 89/209 (42.58%), Query Frame = 2
Query:  206 LLDKAGWSILHDAIILNHVDIAQHLINHSLMNINF-PCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFN--ISDTYVLLD-----------AWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
             +   G++ LH A    ++++AQ L+N    N+NF P N        + P+HIA   G   ++++LL R    +      K EL           P+ C   N  +    +LLD             +P+H+    DH+DC++ L+Q  A++       +   T L +A          VLL+ GA PN   ++  +PL  A K+   R
Sbjct:  173 FITATGFTPLHIAAHYENLNVAQLLLNRG-ANVNFTPKNG-------ITPLHIASRRGNVIMVRLLLDRGATID---AKTKDELT----------PLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLR 357          

HSP 7 Score: 53.5286 bits (127), Expect = 1.872e-6
Identity = 48/189 (25.40%), Postives = 81/189 (42.86%), Query Frame = 2
Query:  221 GWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            G++ LH A   NH+ +   L+ HS        +  ++    L P+H+A   G  +I+K+LLQ+  +P                             N S+  V      PLH+     H +  + L+Q A   +++++    +T+L  A  +   E V +LLE  ANPN    +  +PL  AA+ G T+
Sbjct:  343 GFTPLHIACKKNHLRVMDLLLKHS-------ASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASP-----------------------------NASNVKV----ETPLHMASRAGHCEVAEFLLQNA-APVDAKAK-DDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQ 489          

HSP 8 Score: 51.6026 bits (122), Expect = 7.479e-6
Identity = 49/191 (25.65%), Postives = 78/191 (40.84%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLI-QEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 784
            + G++ LH A   N V++A      SL+      N+ S  L  + P+H+A + GR  ++ +L+ +  N               V L   S                     PLHLV    H+    +L+ Q A V+  +R      T L +AC    ++ V  LL+  AN N    +  +PL  AA++G T
Sbjct:  572 RNGYTPLHIASKQNQVEVAS-----SLLQYGASANAES--LQGVTPLHLAAQEGRADMVSLLISKQAN---------------VNLGNKS------------------GLTPLHLVAQEGHVGIADILVKQGASVYAATRM---GYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHT 719          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 202.986 bits (515), Expect = 6.576e-52
Identity = 173/728 (23.76%), Postives = 331/728 (45.47%), Query Frame = 1
Query: 1648 ETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDL-----VFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            +  +  LHLA   K   +  +  LL++G ++++ T KG+T    A    + +    L+  G + NA +    + L ++A + + E+++FLL++    +     G T L  +  Q          HD     ++ + +ND+   ++   L  A +  +      +L+   + D+      + H +   TP+ +A    +I+    L+  GA +++++  N  T LHVA +  N  + K L+  G+ I  +++ G    + P+H   ++G ++++E+LL  G+ + S    K+   ++PLH+A   D  + V+ L       + ++   +D                                       T LH+AA  G +++ +++++  A+P A+ +    +G  P+H+A +   +++++L    G S+ A  + GLT +H AA  G  +I++ L   GA  N     G  +    +HMA+  G    V+ LL+ G+ ++       +D+ TAL+IA+   +  +++ L++ GA       + G TPLH+  + G  +    L+    +SL+     G + LH+ A+ G  E +  LL+ +  P+  G+            ++PL+ A  + +  V  LL+  GA  H A       G  P+H AA + +  +  TLLE G   +     G++PLH +  EG  D    L+   ANVN+ +K G  P
Sbjct:   18 QNGLNALHLAS--KEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQG---------HDQV---VSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMAR-NDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDG----LTPLHCGARSGHEQVVEMLLDRGAPILS----KTKNGLSPLHMATQGDHLNCVQLLLQH---DVPVDDVTNDYL-------------------------------------TALHVAAHCGHYKVAKVIVDKKANPNAKAL----NGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETA----LHMAARAGQADVVRYLLQNGAKVDIK----AKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTS-GYTPLHLAVREGHQETASLLLE-HGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKT----------GLTPLHVAAHYDNQRVALLLLDHGASPHAA----AKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTP 654          

HSP 2 Score: 197.593 bits (501), Expect = 2.613e-50
Identity = 215/834 (25.78%), Postives = 387/834 (46.40%), Query Frame = 1
Query: 1372 GSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQN--------QVDSNQKDNYGLTALH----------HSFIQDFRIGIDYFI-HDSTNIFIAKIDDNDSSHSL------------KSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGL 3774
            G D NI     + +L  + ++ H ++   L+  GA+++         +  K  N A +H+A +    +  + L+  GAN+          + +   T L++A   + N L  + FLLE G +    T  G TP   A++    +  +LLL    + +    +    L ++A K + +    LLQN        +V +    + G T LH           + + +    +D+   +D T + +A    N +   L            K G   L    + G+E  VV +L     P L    N   ++P+ +A + + ++ +  L++H   ++ +++ +  T LHVA    +  +AK ++   +N + ++  G      P+H+A +    +++E+LL  G+SL +     +   + P+H+AA     + VK LTH   AS N  + R ++   +     + +V  V+ +L  GA V     +    + T LHIA+++G  EIVQLLL+ GA   A   +G      P+HLA   GH E   L  + G S+SAA   G T LH AA  G ++  ++LL+  A   A  T G ++ + P+H+A+   +++   LLL++G+  +A      ++  T L+IA  +N+  +   L++ GA  +      G +PLH+  Q G    +  L+   N+++N+    G++ LHL A++    ++  LL         G   D+ +K T Y  +PL+ AC +G++ +V  L++  A I+ ++T  G+    P+H AA +G  H+I  LL+   S +E   +G T L  +   G+      L GL
Sbjct:   10 GVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVD---------AATKKGNTA-LHIASLAGQTDVVRELVTNGANV--------NAQSQNGFTPLYMAA--QENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHE-QVVEMLLDRGAPILSKTKNG--LSPLHMATQGDHLNCVQLLLQHDVPVDDVTN-DYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNG----FTPLHIACKKNRVKVMELLLKHGASLQAV----TESGLTPIHVAAFMGHENIVKQLTHH-GASPNTTNVRGETALHMAARAGQADV--VRYLLQNGAKVD----IKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSG----YTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRA---APDTAG-KTGLTPLHVAAHYDNQRVALLLLDHGASPHAA----AKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQ-GISPLHLAAQEGSVDLVSLLL-TKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLN-------HGAEVDAHTK-TGY--TPLHVACHYGNMKMVSFLLENQAKIN-SKTKSGYT---PLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGL 772          

HSP 3 Score: 161.384 bits (407), Expect = 3.348e-39
Identity = 171/725 (23.59%), Postives = 305/725 (42.07%), Query Frame = 1
Query: 1720 LEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLN-------YISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAV---TANLMSLF 3855
            L+ G++I      G      A +   +E    LL  G   +A      + L ++++    ++++ L+ N  + N +   G T L+ +  ++    + + +    +  IA  D          G+  L  ALQ G++  V  +L+             V +  + +A   +   +   L+++  N +       Y  + +  T LH+A    NI +A  L+  G+ +   +R     ++ P+HVA + G   ++++LL  G+ +++    K+ + + PLH  A +     V+ L  +                                         G  I+S+++N  + LH+A Q      VQLLL++  D     +T D   +  +H+A   GH ++ K+  D   + +A    G T LH A     V +ME+LLK GA + A    G    + PIH+A+  GH+  VK L  +G+  N      N    TAL++A    + +V++YL+++GA  DI+  +   T LHI  + G  + +  L+    +  +    +G + LHL   +GH E +  LL          +   S S  T    +PL+ A  +G +   KLL++  A    A    G  G+ P+H AA      V   LL+ G S     ++G TPLH +  +   +    L+   A  N + + G  P   A    + +L+SL 
Sbjct:    7 LKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATED----------GFTPLAVALQQGHDQVVSLLLENDTK-------GKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMAR----NDITPLHVAAKRGNGNMVKLLLDRGAKIDA----KTKDGLTPLHCGARSGHEQVVEMLLDR-----------------------------------------GAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--DVPVDDVTNDY--LTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESG----LTPIHVAAFMGHENIVKQLTHHGASPNTT----NVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKD-DQTALHIASRLGKAEIVQLLLQ-KGAWASAATTSGYTPLHLAVREGHQETASLLL----------EHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRA----APDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLL 637          

HSP 4 Score: 157.147 bits (396), Expect = 5.644e-38
Identity = 191/760 (25.13%), Postives = 317/760 (41.71%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS--------------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNI-----------HLRSRLGQGEEV------------------LPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSL 3348
            + +++  L+ +  N+N  +    + L++A Q N L +V  LL  G+  +I      T L  ++Q+ H ++  LL+             +  A  ++     L+L N    +  S              +H+A  Y +      L+++GA     VD +       ++T LH+A   K  + N +  LL+ G  I++KT  G TP     R    +   +LL RG    +      S L ++    +   ++ LLQ+ V  +   N  LTALH +          +  H      I     N ++ +L     ++     N + V+ +L K  A    V       +TPI +A  M   + +  L  HGA+ N  ++   ET LH+A R     + + L+  G+ +           H+ SRLG+ E V                   P+H+AV+ G  E   +LL  G+SL++     + +   PLH+AA        K L  +++A      T       L       N    Q V +   D       +     T LHIAA+    EI   LLE+GA+  A  +T  R GI P+HLA + G +++V L      +V+     GLT LH AA    V + E+LL  GA+V+A    G      P+H+A   G+ K V  LLE  + IN+      +   T L+ A  +   +++  L++  A+ +    N G T L I  + G+   +  L G+ + +L
Sbjct:   65 QTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGA----AVDFM----ARNDITPLHVAA--KRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVA---------AHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAV---TESGLTPIHVAAFMGHENIVKQLTHHGASPN-TTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAA----TKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKT---GLTPLHVAAHYDN----QRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNA--VT--RQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTG----YTPLHVACHYGNMKMVSFLLENQAKINSK----TKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLN-GNTALSIARRLGYISVVDTLRGLTDENL 777          

HSP 5 Score: 53.1434 bits (126), Expect = 4.336e-8
Identity = 45/200 (22.50%), Postives = 92/200 (46.00%), Query Frame = 2
Query:  218 AGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            +G++ LH A    ++++A  L+N     ++F      +  +++ P+H+A + G  +++K+LL R           + P  C      E +  ++L + + PI  +  N           +PLH+    DHL+C+++L+Q      +  +     TAL +A      +   V+++  ANPN   ++  +PL  A K+   +
Sbjct:  188 SGFTPLHIAAHYGNINVATLLLNRGAA-VDF------MARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKN---------GLSPLHMATQGDHLNCVQLLLQHDVPVDDVTN--DYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVK 368          

HSP 6 Score: 25.409 bits (54), Expect = 4.336e-8
Identity = 14/46 (30.43%), Postives = 24/46 (52.17%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQ 954
            +GH+ IV+ L  +GA+P     R + T LH +  +   D +   +Q
Sbjct:  397 MGHENIVKQLTHHGASPNTTNVRGE-TALHMAARAGQADVVRYLLQ 441          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Cavefish
Match: ENSAMXT00000017800.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21012912:21225385:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000017800.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.83 bits (512), Expect = 1.374e-51
Identity = 179/714 (25.07%), Postives = 334/714 (46.78%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            LHLA   K   ++ +  LLE G +++S T KG+T    A    + E   +L+ +G D NA +    + L +++ + + +++++LL+N  + +     G T L  +  Q              N  ++ + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +++    L+  GA +++ +  N  T LHVA +  N  + + L+  GS I  ++R G    + P+H A ++G D  +E+LL  G+ +    + ++   ++PLH+AA  D    VK L  Q  A ++                                DV+   +       T LH+AA  G + + +LLL+  A+P AR +   ++G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  +    +HMA+  G  + V+ LL  G+ ++A      R++ T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G       L+  A +S ++    G + LH+ ++ G  +++  LL+ +  P+  G+            ++PL+ A  + +  V  LL+  GA  H         G  P+H AA + +  +  TLL+     +   + G+TPLH +  EG  D    L+   A VN+  K G
Sbjct:   69 LHLAA--KEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGH------------NQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNAD---VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDG----LTPLHCAARSGHDTAVELLLERGAPI----LARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVD--------------------------------DVTLDYL-------TALHVAAHCGHYRVTKLLLDKRANPNARALL--QNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETA----LHMAARAGQVEVVRCLLRNGAMVDA----RAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREGQLDVASVLLE-AGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGK----------NGLTPLHVAAHYDNQKVALLLLDKGASPHAT----AKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSG 691          

HSP 2 Score: 190.274 bits (482), Expect = 4.893e-48
Identity = 196/796 (24.62%), Postives = 370/796 (46.48%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS--TNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDV--------------------VRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGA-----NLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGV 3681
            + +L  + ++ H  + + L+  G++++         S  K  N A +H+A +    E  + L+ +GA++          + +   T L++A   + N L+ + +LLE G N  + T  G TP   A++    +  ++LL    + +    +    L ++A K + +    LLQN  +++ +   G T LH           + + +    +D+    +  T + +A    N       +  +   L  G++ID                     V +L +   P L    N   ++P+ +A + + +  + HL++H A      L+Y+      T LHVA    +  + K L+   +N + R+ L  G    P+H+A +    +++E+L+ +G+S+ +  I +S   + P+H+AA     + V  L  Q  AS ++++ R ++  AL        V  V+ +L  GA V  +       + T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G L++  +  + G S S A   G T LH A+  GS+D+ ++LL+  A  ++   +G    + P+H+A+   ++K   LLL+ G+  +A      ++  T L+IA  +N+  +   L++  A  +I     G TPLH+  Q G +     L+    + +NVP  +G+++LHL A++    ++  L++             S  ++T    +PL  AC +G+  +V  L+K  A ++ A+T  G+    P+H AA +G  H+I  LL+ G 
Sbjct:   66 LNALHLAAKEGHMDLVQELLERGSSVD---------SATKKGNTA-LHIASLAGQAEVVKILVKQGADINA--------QSQNGFTPLYMAS--QENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGN-------TNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNG--LSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYL------TALHVAAHCGHYRVTKLLLDKRANPNARALLQNG--FTPLHIACKKNRVKVMELLVKYGASIQA--ITESG--LTPIHVAAFMGHLNIV-LLLLQNGASPDVSNIRGET--ALHMAARAGQVEVVRCLLRNGAMVDARA----REDQTPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNG----LTPLHVAAHYDNQKVALLLLDKGASPHATA----KNGYTPLHIAAKKNQMEIATTLLQYEAETNIL-TKQGVTPLHLASQEGHSDMAALLLQ-KGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGA----------SMDQQTKLGYTPLIVACHYGNAKMVNFLLKSNASVN-AKTKNGYT---PLHQAAQQGNTHIINVLLQYGA 781          

HSP 3 Score: 136.732 bits (343), Expect = 1.104e-31
Identity = 195/804 (24.25%), Postives = 342/804 (42.54%), Query Frame = 1
Query: 1174 GVSNNNGLHILLMIVKKFQFPLRKELID-----------------------------ILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH-HSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYL-IYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITG-----------------------------DRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIA 3336
            G SN NGL+ L +  K+    L +EL++                             IL+    +IN  +    + L++A Q N L +V  LL  G + +       T L  ++Q+ H ++  +L+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++GA +  T         +  +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R     A  LLL RG    A      S L ++A   + E +K LLQ++   +      LTALH  +    +R+         T + + K  + ++   L++G+  ++     N + V+ +L K  A    +       +TPI +A  M  ++ +  L+++GA+ + +S+   ET LH+A R   + + + L+  G+ +  R+R    E+  P+H+A + G  EI+++LL   +  ++     +     PLH++A          L  +  AS ++ + +   F  L  + SK   + V  +L+   A  D +GK         T LH+AA   + ++  LLL+ GA P A    G                              + G+ P+HLA++ GH ++  L    G  V+     GLT LH AA    V + EIL+K GA ++ +   G      P+ +A   G+ K V  LL+  + +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+   +  L  +A
Sbjct:   59 GTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA-------RQNGITPLHVAS--KRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRV---------TKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGAS---IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPD-VSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAR----EDQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQLDVASVLL-EAGASHSLATKKG--FTPL-HVASKYGSLDVAKLLLQRRAPPDSAGK------NGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQQTKLG----YTPLIVACHYGNAKMVNFLLKSNASVNAK----TKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVN-GNTALAIARRLGYISVVDTLRVVA 813          

HSP 4 Score: 130.954 bits (328), Expect = 5.414e-30
Identity = 107/358 (29.89%), Postives = 183/358 (51.12%), Query Frame = 1
Query: 2722 RSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNII 3795
            +S + T    AA+ G+ + V   L+ G D    + T +++G+  +HLA + GH+++V+   + G SV +A   G T LH A+ AG  ++++IL+K GAD+NA++ +G      P++MAS++ H   V+ LLE G       S    D  T L IA  +    V+  L+++     ++   L A  LHI  ++  TK+   L+   + + +V   +G + LH+ A  G+  ++  LL      + T +            I+PL+ A   G+  +V+LL+  G+ I  A+T +   G+ P+HCAA  G    +  LLE G  I    ++GL+PLH +      +C K L+  KA V+ +
Sbjct:   29 KSDSNTSFLRAARAGNIDKVLEYLKGGVD----IGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNG----FTPLYMASQENHLDVVRYLLENG----GNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVR---LPA--LHIAARKDDTKSAALLLQ-NDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR---------QNGITPLHVASKRGNTNMVRLLLDRGSQID-AKTRD---GLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDV 355          

HSP 5 Score: 122.479 bits (306), Expect = 2.131e-27
Identity = 91/319 (28.53%), Postives = 159/319 (49.84%), Query Frame = 1
Query: 2863 ATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI-GIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            A  +G+++ V  +   GV +  +   GL  LH AA  G +D+++ LL+ G+ V++    GN +    +H+AS  G  + VK+L++ G+ INA     +++  T LY+A+ EN  +V++YL+++G N      + G TPL I  Q+G  + +  L+       + +P      +LH+ A K   + +  LL+   N ++          ++    +PL+ A  +G++ V  LL+  GA + +        GI P+H A+ RG  +++  LL+ G  ID    DGLTPLH +   G     + L+   A +    K G  P
Sbjct:   39 AARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTA----LHIASLAGQAEVVKILVKQGADINA----QSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATED-GFTPLAIALQQGHNQVVSILLENDTKGKVRLP------ALHIAARKDDTKSAALLLQNDHNADV----------QSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR---QNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSP 329          

HSP 6 Score: 110.153 bits (274), Expect = 1.286e-23
Identity = 110/415 (26.51%), Postives = 181/415 (43.61%), Query Frame = 1
Query: 2593 ININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADI-----------HWAETFEGH---------------------KGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEG 3741
            ++I ++  +  NAL     + ++  VQ +L  G+ V      +  +  T LHIA+  G  E+V++L++ GAD  A+     ++G  P+++A++  HL++V+   + G + S A + G T L  A   G   ++ ILL        E     + ++  +H+A+ K   KS  LLL+     NA     ++   T L+IA      NV   L+  GA  D      G TPLH+  +RG T  +  L+    S ++     G++ LH  A  GH+  +  LL  +  P L          +T   +SPL+ A    H+  VK L++  A +           H A    GH                      G  P+H A  + +  V+  L++ G SI    E GLTP+H +   G
Sbjct:   56 VDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDS----ATKKGNTALHIASLAGQAEVVKILVKQGADINAQ----SQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILL--------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDH--NADVQ--SKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLD-RGSQIDAKTRDGLTPLHCAARSGHD-TAVELLLERGAPILA---------RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVA-AHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMG 438          

HSP 7 Score: 51.6026 bits (122), Expect = 5.467e-11
Identity = 49/203 (24.14%), Postives = 90/203 (44.33%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQR----------NVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNK--SPLFYAAKRGETR 787
            K+G++ LH A    +V++A  L+N     ++F      I      P+H+A + G T+++++LL R           + P  C      +    ++L + + PI  +  N           +PLH+    DH++C+K L+Q  K  ++  + +   TAL +A          +LL+  ANPN   +     +PL  A K+   +
Sbjct:  224 KSGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARQNGI-----TPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGA-PILARTKN---------GLSPLHMAAQGDHVECVKHLLQH-KAPVDDVT-LDYLTALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVK 408          

HSP 8 Score: 36.965 bits (84), Expect = 5.467e-11
Identity = 84/394 (21.32%), Postives = 160/394 (40.61%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAP--EVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRK-------ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH  IV +LL+ GA+P +   R + T LH +  +  ++ +     L+++    +    +    L I   ++  T++   + ++L+     D    N +   ++    E ++D+ SV    G S++       +  KK   PL         ++  +LL  R   +       + L +A   +   +   LL +G+ P+       T L  + +K   ++   L+ Y A  N       +L+   +T    +H+A      +    L+ KGA + +          ++ +T LHLA   + + +     L++ G +++ +T  G TP + A  Y   +  N LL      NA      + L  +A + N  I+  LLQ     N     G TAL
Sbjct:  437 MGHLNIVLLLLQNGASPDVSNIRGE-TALHMAARAGQVEVVRC---LLRNGAMVDARAREDQTPLHIA-SRLGKTEI---VQLLLQHMAHPDAATTNGYT-PLHISAREGQLDVASVLLEAGASHS-------LATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETN-------ILTKQGVT---PLHLASQEGHSDMAALLLQKGAQVNVP--------TKSGLTALHLAA--QEDRVGVAEILVKNGASMDQQTKLGYTPLIVACHYGNAKMVNFLLKSNASVNAKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTAL 794          

HSP 9 Score: 55.4546 bits (132), Expect = 4.937e-7
Identity = 49/193 (25.39%), Postives = 87/193 (45.08%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQ---KFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 784
            K G S LH A   +HV+  +HL+ H       P +  +  L  L  +H+A   G   + K+LL +  NP     ++++      I  K ++    +   K+  S   +      P+H+     HL+ + +L+Q         S I  +TAL +A    ++E V  LL +GA  +     +++PL  A++ G+T
Sbjct:  324 KNGLSPLHMAAQGDHVECVKHLLQHKA-----PVDDVT--LDYLTALHVAAHCGHYRVTKLLLDKRANPN-ARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGAS--PDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKT 506          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 199.904 bits (507), Expect = 3.836e-51
Identity = 171/717 (23.85%), Postives = 332/717 (46.30%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   +  +  L++MG  +++ T KG+T    A    + +    L+  G + NA +    + L ++A + + +++++LL N    +     G T L  +  Q          HD     ++ + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +I+    L+  GA +++ +  N  T LHVA +  N  + K L+  G+ I  +++ G    + P+H   ++G ++++E+LL  G+ + S    K+   ++PLH+A   D  + V+ L H +   + ++   +D                                       T LH+AA  G +++ +++++  A+P A+ +    +G  P+H+A +   +++++L    G S+ A  + GLT +H AA  G  +I+  L+  GA  N     G  +    +HMA+  G  + VK L++ G+ ++A     ++D+ T L+I++   +  +++ L++ GA PD    + G TPLH+  + G  K +  ++    +SL +    G + LH+ A+ G  E++  LL+ +  P+ +G+            ++PL+ A  + +  V  LL+  GA  H A       G  P+H AA + +  +  TLLE G   +     G++PLH +  EG  D    L+   A +N+ +K G  P
Sbjct:   25 LHLAS--KEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQG---------HDQ---VVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNAD---VESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKAR-NDITPLHVASKRGNSNMVKLLLERGARIDAKTKDG----LTPLHCGARSGHEQVVEMLLDRGAPILS----KTKNGLSPLHMATQGDHLNCVQLLLHHE---VPVDDVTNDYL-------------------------------------TALHVAAHCGHYKVAKVIVDKKANPNAKAL----NGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETA----LHMAARAGQTEVVKYLVQNGAYVDAK----SKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTS-GYTPLHLAAREGH-KDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGK----------SGLTPLHVAAHYDNQKVALLLLDQGASPHAA----AKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTP 647          

HSP 2 Score: 154.836 bits (390), Expect = 2.485e-37
Identity = 201/770 (26.10%), Postives = 330/770 (42.86%), Query Frame = 1
Query: 1162 CTVDGVSN--NNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVSR--------------------------SRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAI 3315
             TVD  +   N  LHI  +  +        +++  L+ +  N+N  +    + L++A Q N L +V  LL  GS  +I      T L  ++Q+ H ++  LL+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++GA     VD     +   ++T LH+A   K  + N +  LLE G  I++KT  G TP     R    +   +LL RG    +      S L ++    +   ++ LL ++V  +   N  LTALH +          +  H      I     N ++ +L     ++     N I V+ +L K  A    V       +TPI +A  M   + +  L+ HGA+ N  ++   ET LH+A R     + K L+  G+ +  +S+    ++  P+H++ + G  EII+ LL  G+  +ST    +     PLHLAA          L   Q AS+ I + +   F  L  + +K   I V ++L+   A  D SGK  ++                           ++N  T LHIAA+    EI   LLEYGAD  A  IT  R GI P+HLA++ G++++V L      +++     GLT LH AA    V++ E+L+  GA V+ E   G      P+H+A   G+ K V  LL+  + +NA               A  +   +++  L++ GA P+    N G T L I  + G+   +
Sbjct:   45 ATVDAATKKGNTALHIASLAGQS-------DVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGA----AVDF----KARNDITPLHVAS--KRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAA---------HCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAV---TESGLTPIHVAAFMGHENIVTQLMNHGASPN-TTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSK----DDQTPLHISSRLGKPEIIQQLLQHGACPDST----TTSGYTPLHLAAREGHKDVASILL-DQGASLGITTKKG--FTPL-HVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNA--IT--RQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMG----YTPLHVACHYGNVKMVHFLLKNQAKVNA----------KTKVTAAQQGHTHIINLLLQHGAAPNELTVN-GNTALSIARRLGYISVV 753          

HSP 3 Score: 120.939 bits (302), Expect = 5.266e-27
Identity = 95/312 (30.45%), Postives = 162/312 (51.92%), Query Frame = 1
Query: 2833 DRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLI 3768
            +++G+  +HLA++ GH+E+V      G +V AA   G T LH A+ AG  D+++ L+  GA+VNA++ +G      P++MA+++ H   V+ LL+ GS      S    D  T L +A  +  + V+  L+++     ++   L A  LHI  ++  TKA   L+   + + +V   +G + LH+ A  G+  ++  LL         G   D    K   +I+PL+ A   G+  +VKLL++ GA I  A+T +   G+ P+HC A  G   V+  LL+ G  I    ++GL+PLH +      +C + L+
Sbjct:   18 NQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNG----FTPLYMAAQENHLDVVRYLLDNGS----SQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR---LPA--LHIAARKDDTKAAALLLQ-NDHNADVESKSGFTPLHIAAHYGNINVATLLLN-------RGAAVDF---KARNDITPLHVASKRGNSNMVKLLLERGARID-AKTKD---GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 301          

HSP 4 Score: 117.087 bits (292), Expect = 7.323e-26
Identity = 90/313 (28.75%), Postives = 150/313 (47.92%), Query Frame = 1
Query: 2881 LEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI-GIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LE    +   GV ++     GL  LH A+  G V+++  L+K GA V+A    GN +    +H+AS  G    VK L+  G+ +NA     +++  T LY+A  EN  +V++YL+ +G++  I   + G TPL +  Q+G  + +  L+       + +P      +LH+ A K   + +  LL+   N ++          ++    +PL+ A  +G++ V  LL+  GA +     F+    I P+H A+ RG  +++  LLE G  ID   +DGLTPLH     G     + L+   A +    K G  P
Sbjct:    1 LEKALDYLKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTA----LHIASLAGQSDVVKELVTNGANVNA----QSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATED-GFTPLAVALQQGHDQVVSLLLENDTKGKVRLP------ALHIAARKDDTKAAALLLQNDHNADV----------ESKSGFTPLHIAAHYGNINVATLLLNRGAAV----DFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSP 284          

HSP 5 Score: 56.225 bits (134), Expect = 4.554e-15
Identity = 47/198 (23.74%), Postives = 94/198 (47.47%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKR 775
            K+G++ LH A    ++++A  L+N     ++F         +++ P+H+A + G ++++K+LL+R           + P  C      E +  ++L + + PI  +  N           +PLH+    DHL+C+++L+  E  V   +   +   TAL +A      +   V+++  ANPN   ++  +PL  A K+
Sbjct:  180 KSGFTPLHIAAHYGNINVATLLLNRGAA-VDFKAR------NDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGA-PILSKTKN---------GLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYL---TALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKK 357          

HSP 6 Score: 46.2098 bits (108), Expect = 4.554e-15
Identity = 84/397 (21.16%), Postives = 159/397 (40.05%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQ-----LIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPL-------RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH+ IV  L+ +GA+P     R + T LH +  +   + +   +Q       KS  +      S  L   + +I        +  +L+   C D    + +   ++    E   D+ S+    G S       L +  KK   PL       + E+ ++LL  R   + +     + L +A   +   +   LL +G+ P+       T L  + +K   ++   L+ YGA+ N           +     + +H+A    + +    L+ + A    T++L +    ++ +T LHLA   + + +N    L+  G  ++ +T  G TP   A  Y  ++  + LL     KN    +N    + +A + +  I+  LLQ+    N+    G TAL
Sbjct:  390 MGHENIVTQLMNHGASPNTTNVRGE-TALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRL--GKPEI--------IQQLLQHGACPDSTTTSGYT-PLHLAAREGHKDVASILLDQGAS-------LGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNA----------ITRQGISPLHLASQEGNVDMVTLLMARDA----TINLCN----KSGLTPLHLAA--QEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLL-----KNQAK-VNAKTKVTAAQQGHTHIINLLLQHGAAPNELTVNGNTAL 741          

HSP 7 Score: 50.447 bits (119), Expect = 2.771e-12
Identity = 41/188 (21.81%), Postives = 84/188 (44.68%), Query Frame = 2
Query:  227 SILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSK--SSKPIFCQKFN--ISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            + LH A    H  +A+ +++          N  +  L+   P+HIAC+  R  ++++LL+   +    ++ +    + P+ ++     + I  Q  N   S     +     LH+       + +K L+Q    +++++S    +T L ++  L + E +  LL+ GA P+    S  +PL  AA+ G
Sbjct:  316 TALHVAAHCGHYKVAKVIVDKK-------ANPNAKALNGFTPLHIACKKNRIKVMELLLKHGAS----IQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNG-AYVDAKS-KDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREG 490          

HSP 8 Score: 42.3578 bits (98), Expect = 2.771e-12
Identity = 75/333 (22.52%), Postives = 121/333 (36.34%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLL 1818
            GH  +  +LL  GA+  I TK+   TPLH +     I+   A + L K AP     KS                    L  L  A   D+       +K+  LL +     ++          NG   L +  KK Q     E+   LL +  + N    +  S L LA Q   + +V+ L+ R +  N+     +T L  + Q+    + E+L+N+GA ++                   +HVA  Y + +   FL+   A +     +   ++  T++                IN LL+ G      T  G+T    A R   I   + L
Sbjct:  490 GHKDVASILLDQGASLGITTKK-GFTPLHVAAKYGKIE--VANLLLQKRAPPDASGKSG-------------------LTPLHVAAHYDN-------QKVALLLLDQGASPHAAA-------KNGYTPLHIAAKKNQM----EIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYT----------PLHVACHYGNVKMVHFLLKNQAKVNAKTKVTAAQQGHTHI----------------INLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.971 bits (489), Expect = 8.550e-51
Identity = 193/743 (25.98%), Postives = 341/743 (45.90%), Query Frame = 1
Query: 1621 VDLLDE---REVETNV------TLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQE-NNLGATPLHITCQRGFTK-AIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            VD++ E   RE E +       T LH+A L  +   + +  L+E G NI +++  G TP   A + + +E    LL  G +++       + L ++  + + +++  LL+    S+ K    L ALH                       A+ DD +++  L        LQ+ +  DV                +    TP+ +A    +++    L+  GA +++ ++ N  T LHVA +  N  + K L+  G+ I  ++R G    + P+H A ++G +++IE+LL      ++ ++ K+   ++PLH+A   +  + V+ L  +Q+    ++    D    L       +    + +L  G + + + +       T LHIA +    ++++LLL++GA     + T    G+ P+H+A+  GHL +V+L    G S +A    G T LH A+ AG +++++ LL++GA V  +A    R    P+H+AS  G  + V+LLL+ GS  NA  +       T LY A+ E   +V   L+++GA  DI      G TPLHI  + G  + A + L   A++   V    G++ LH+     H +++  LL    +P+ T         K  Y  +PL+ A     L V K+L++ GA+ +        +G+ P+H AA  G   ++  LL    SI    + GLT +H +  E   +  + L   KA+VN   K+   P
Sbjct:   57 VDVVTELLKREAEIDTATKVGNTALHIAAL--AGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLE----SDTKGKVRLPALH---------------------IAARKDDTNAAALL--------LQHEHNADVT---------------SKSGFTPLHIAAHYGNMNVATLLLNLGAAVDF-TARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDG----LTPLHCAARSGHEKVIEMLL----ERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAP---VDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARAL----NGFTPLHIACKKNRIKVMELLLKHGAS----IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKA----REDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTA----SGSTPLYFASREGHGDVASLLLENGA--DISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTA--------KNGY--TPLHIAAKKNQLEVGKVLLELGAETNMLT----QQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTP 705          

HSP 2 Score: 183.341 bits (464), Expect = 1.154e-47
Identity = 201/796 (25.25%), Postives = 346/796 (43.47%), Query Frame = 1
Query: 1408 TSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLT-------------------VDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGC--DKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL--KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLK--AGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            T+L  +       +  +L+ +GANIN                   +++A   +  E  +FL+D GAN  +                    V LL E + +  V L  L I  + +  N    LL+   N +  +  G TP   A  Y  +    LLL  G   D  A N I  + L ++A + N  ++K LL      + K   GLT LH +        I+  +     I +AK  +  S         ++    G  +  V++L  +QA   D+   +    +TP+ +A           L+  G   N   + N  T LH+A +   I + + L+  G++IH  +  G    + PIHVA   G   ++++LL  G+S N+T    +V    PLH+A                        +R+     + TL+     +GV++                  + T LHIA+++G  EIVQLLL+ G+DP A   +G      P++ A+  GH ++  L  + G  +S     G T LH A+  G +++  +LL+  A AD      +G    + P+H+A+   H+K   LLL+ G+  ++      ++  T L+IA  +N+  V K L++ GA  ++     G  PLH+  Q G    +  L+G  ++S+++    G++++HL A++    ++  L + K + N T          T    +PL+ A  +G++ +V  L++  A ++ A+T  G+    P+H AA +G  HV+  LL+   S +E   +G T L
Sbjct:   79 TALHIAALAGQTDIVRVLVEFGANINAQ----------SQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGI--TPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPI-LAKTKNGLSP--------LHMATQGEHLACVQLLLGRQAPVDDVTLDY----LTPLHVAAHCGHYRVAKLLLDRGGEPN-ARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESG----LTPIHVASFMGHLNVVQLLLQNGASSNAT----NVRGETPLHMA------------------------SRAGQLEVVKTLLQSGARVGVKA----------------REDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGST----PLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNG----LTPLHVATHYDHQKVALLLLDKGASPHSTA----KNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQ-GVAPLHLAAQEGHADMVALLLG-RHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTT----------TKLCYTPLHVASHYGNIKMVNFLLRNRALVN-AKTRNGYT---PLHQAAQQGHTHVVNALLQHEASPNELTANGNTAL 772          

HSP 3 Score: 151.754 bits (382), Expect = 1.436e-37
Identity = 146/539 (27.09%), Postives = 239/539 (44.34%), Query Frame = 1
Query: 2299 VLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSK--RNVIGVQSVLMAGADVSGKC-------------------IVSRSRNA--------TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYA 3828
             LH+A +  ++ +  EL+   + I   +++G       +H+A   G  +I+ +L+ FG+++N+    +S     PL++AA  +    VKFL    +   N +    D F  L   + +    V+G    L+  +D  GK                    ++    NA        T LHIAA  G+  +  LLL  GA   A   T  R+GI P+H+A + G+  +VKL  D G  +      GLT LH AA +G   ++E+LL+  A + A+  +G    + P+HMA++  H   V+LLL   +P++ V      D LT L++A       V K L+  G  P+ +  N G TPLHI C++   K +M L+          L  G +S+H T E G                                ++P++ A   GHL VV+LL++ GA  +        +G  P+H A+  G+  V+ TLL++G  +     +  TPLH +   G  +  + L+   ++ N     G  P  +A
Sbjct:   47 ALHLASKEGHVDVVTELLKREAEIDTATKVGN----TALHIAALAGQTDIVRVLVEFGANINA----QSQNGFTPLYMAAQENHLEIVKFLLDNGA---NQSVATEDGFTPLAVALQQGHEQVVG----LLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGA---AVDFTA-RNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNG----LSPLHMATQGEHLACVQLLLGRQAPVDDV----TLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALN-GFTPLHIACKKNRIK-VMELL----------LKHG-ASIHTTTESG--------------------------------LTPIHVASFMGHLNVVQLLLQNGASSNATNV----RGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFA 509          

HSP 4 Score: 137.887 bits (346), Expect = 3.230e-33
Identity = 195/788 (24.75%), Postives = 339/788 (43.02%), Query Frame = 1
Query: 1105 HIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLS---NVKLTNCAS---IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH-HSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVT--MTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVS----------------------------GKCIVSRSRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGF 3303
            H+  +  LL + + +I++   V     N  LHI  +  +        +++ +L+    NIN  +    + L++A Q N L +V  LL  G++ ++      T L  ++Q+ H+++  LL+             +  A  ++     L+L    N  +T+ +    +H+A  Y +      L++ GA +  T            +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R    +   +LL R     A      S L ++   ++   ++ LL  Q   +      LT LH  +    +R+             +       ++ +L     ++     N I V+ +L K  A      IH      +TPI +A  M  ++ +  L+++GA+ N  ++   ET LH+A R   + + K L+ +G+ + +++R    E+  P+H+A + G  EI+++LL  GS  N+     S     PL+ A+          L    +   +I+      F  L  + SK   + V ++L+   A AD                              G    S ++N  T LHIAA+    E+ ++LLE GA+    M+T  + G+ P+HLA + GH ++V L      S+S A   GLT +H AA    V++ EIL K  ADVN       +    P+H+AS  G+ K V  LL   + +NA      R+  T L+ A  +   +V+  L++  A+P+    N G T L I  + G+
Sbjct:   56 HVDVVTELL-KREAEIDTATKV----GNTALHIAALAGQT-------DIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTA--------RNGITPLHVAA--KRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAK----------LLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGAS-----IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSN-ATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAR----EDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGST----PLYFASREGHGDVASLLLENGA---DISPVTKKGFTPL-HIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAE--TNMLT--QQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTT----TKLCYTPLHVASHYGNIKMVNFLLRNRALVNAK----TRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTAN-GNTALAIARRLGY 780          

HSP 5 Score: 132.109 bits (331), Expect = 2.046e-31
Identity = 122/447 (27.29%), Postives = 202/447 (45.19%), Query Frame = 1
Query: 2587 ASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGA----------------DVNAEA--------TD-GNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSL 3852
              ++IN+   +  NAL     + +V  V  +L   A++     V      T LHIAA  G  +IV++L+E+GA+  A+     ++G  P+++A +  HLEIVK   D G + S A + G T L  A   G   ++ +LL++                  D NA A         D  ++S   P+H+A+  G+     LLL  G+ ++  F+   R+ +T L++A      N++K L+  GA  D +  + G TPLH   + G  K I  L+   ++ +      G+S LH+ A +G +     LL  +  P     +T  +       ++PL+ A   GH  V KLL+  G +           G  P+H A  + +  V+  LL+ G SI    E GLTP+H +   G  +  + L+   A+ N  +  G+ P   A  A  + +
Sbjct:   33 GGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGN----TALHIAALAGQTDIVRVLVEFGANINAQ----SQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVD--FTA--RNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRD-GLTPLHCAARSGHEKVIEMLLE-RDAPILAKTKNGLSPLHM-ATQGEHLACVQLLLGRQAP--VDDVTLDY-------LTPLHVAAHCGHYRVAKLLLDRGGE----PNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEV 451          

HSP 6 Score: 128.257 bits (321), Expect = 2.758e-30
Identity = 104/358 (29.05%), Postives = 176/358 (49.16%), Query Frame = 1
Query: 2722 RSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNII 3795
            +S  AT    AA+ G+ E +   L+ G D    + T +++G+  +HLA++ GH+++V         +  A   G T LH AA AG  DI+ +L++ GA++NA++ +G      P++MA+++ H + VK LL+ G    A  S    D  T L +A  +  E V+  L++S     ++        LHI  ++  T A   L+   +++ +V   +G + LH+ A  G+  ++  LL      + T +            I+PL+ A   G+  +VKLL+  GA I      +   G+ P+HCAA  G   VI  LLE    I    ++GL+PLH +       C + L+G +A V+ +
Sbjct:    8 QSDAATSFLRAARNGNLERLMDHLKGGMD----INTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNG----FTPLYMAAQENHLEIVKFLLDNG----ANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVR-----LPALHIAARKDDTNAAALLLQHEHNA-DVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTAR----------NGITPLHVAAKRGNNNMVKLLLDRGAKIDT----KTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDV 333          

HSP 7 Score: 100.908 bits (250), Expect = 1.044e-21
Identity = 127/549 (23.13%), Postives = 212/549 (38.62%), Query Frame = 1
Query: 1369 RGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNV---TLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGN-EIDVVRVLKQA-ADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            RG +PN       T L  + +K   K+ ELL+ +GA+I+      L            IHVA         Q L+  GA+              TNV   T LH+A   ++  L  +  LL+ G  +  K  +  TP   A R  K E   LLL RG D NA  A   + L  ++ + + ++   LL+N  D +     G T LH                                          A +YG  E+  + + K A ADP +        +TP+ +A   +       L+  GA+  + ++ N  T LH+A +   + + K L+  G+  ++ ++ G    V P+H+A Q G  +++ +LL   +S++    L +   +  +HLAA  D  +  + LT  ++   ++N+T    +                                     T LH+A+  G+ ++V  LL   A   A+     R+G  P+H A + GH  +V        S +     G T L  A   G + +++ L
Sbjct:  359 RGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLT----------PIHVASFMGHLNVVQLLLQNGAS-----------SNATNVRGETPLHMAS--RAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLH-----------------------------------------IASKYGRLEVATLLLEKYASADPKVA---GQNGLTPLHVATHYDHQKVALLLLDKGAS-PHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQG----VAPLHLAAQEGHADMVALLLGRHASIS----LATKGGLTAMHLAAQEDKVNVAEILTKHKA---DVNTTTKLCY-------------------------------------TPLHVASHYGNIKMVNFLLRNRALVNAKT----RNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          

HSP 8 Score: 62.003 bits (149), Expect = 7.917e-10
Identity = 122/557 (21.90%), Postives = 220/557 (39.50%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLI--KSAP----------------EVVYWKSSCVLEINRGQINCTKVNCF--------------LLVILKSAVCLDD-----------VQFNCHIKKINYLLSEYKVDINSVCTVDGVSNN----NGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKEL 2349
            GH+ ++E+LL+  A P +   ++ ++PLH +    ++    A +QL+  + AP                   +++ + +L    G+ N   +N F              + ++LK    +               F  H+  +  LL             +G S+N     G   L M  +  Q     E++  LL     +     ++++ L +A +L    +V  LL RGSDPN       T L F+ ++ H  +  LL+  GA+I          S V       +H+A  Y   E    L++K A+    V        +  +T LH+A       +  +  LL+ G +  S    G TP   A + +++E   +LL  G + N +     + L L+A + + +++  LL      +     GLTA+H +  +D ++ +         I      D +++  L    L  A  YGN   V  +L+  A   LV        TP+  A +      +  L++H A+ N +++ N  T L +A R   I++   L
Sbjct:  282 GHEKVIEMLLERDA-PILAKTKNGLSPLHMATQGEHL----ACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ------------NGASSNATNVRGETPLHMASRAGQL----EVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADI----------SPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKV------AGQNGLTPLHVATHYDHQKVALL--LLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQED-KVNV-------AEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRA---LVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTA-NGNTALAIARRLGYISVVDTL 787          

HSP 9 Score: 59.6918 bits (143), Expect = 4.255e-9
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  335 LHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            L+   P+HIAC+  R  ++++LL+   +     E   + +     +   +      +   S     +    PLH+      L+ +K L+Q  A+V +++R     +T L +A  L + E V +LL+ G++PN    S  +PL++A++ G
Sbjct:  368 LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKARE---DQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREG 513          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.504 bits (480), Expect = 1.611e-49
Identity = 193/744 (25.94%), Postives = 341/744 (45.83%), Query Frame = 1
Query: 1621 VDLLDE---REVETNV------TLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVR--VLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQE-NNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            VD++ E   RE E +       T LH+A L  +   + +  L+E G NI +++  G TP   A + + +E    LL  G +++       + L ++  + + +++  LL+    S+ K    L ALH                       A+ DD +++  L        LQ+ +  DV    +L Q  +            TP+ +A    +++    L+  GA +++ +  N  T LHVA +  N  + K L+  G+ I  ++R G    + P+H A ++G +++IE+LL      ++ ++ K+   ++PLH+A   +  + V+ L  +Q+    ++    D    L       +    + +L  G + + + +       T LHIA +    ++++LLL++GA     + T    G+ P+H+A+  GHL +V+L    G S +A    G T LH A+ AG +++++ LL++GA V  +A    R    P+H+AS  G  + V+LLL+ GS  NA  +       T LY A+ E   +V   L+++GA  DI      G TPLHI  + G  +    L+    +S +     G++ LH+     H +++  LL    +P+ T         K  Y  +PL+ A     L V K+L++ GA+ +        +G+ P+H AA  G   ++  LL    SI    + GLT +H +  E   +  + L   KA+VN   K+   P
Sbjct:   56 VDVVTELLKREAEIDTATKVGNTALHIAAL--AGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLE----SDTKGKVRLPALH---------------------IAARKDDTNAAALL--------LQHEHNADVTSKMMLNQTTESGF---------TPLHIAAHYGNMNVATLLLNLGAAVDFTAR-NGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDG----LTPLHCAARSGHEKVIEMLL----ERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAP---VDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARAL----NGFTPLHIACKKNRIKVMELLLKHGAS----IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKA----REDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTA----SGSTPLYFASREGHGDVASLLLENGA--DISPVTKKGFTPLHIASKYGRLEVATLLLE-KYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTA--------KNGY--TPLHIAAKKNQLEVGKVLLELGAETNMLT----QQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTP 710          

HSP 2 Score: 181.03 bits (458), Expect = 9.528e-47
Identity = 191/767 (24.90%), Postives = 360/767 (46.94%), Query Frame = 1
Query: 1519 VKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDS--------NQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSL------------KSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
             K+ N A +H+A +    +  + L++ GAN+          + +   T L++A   + N L  + FLL+ G N    T  G TP   A++    +   LLL    + +    +    L ++A K +      LLQ++ ++        NQ    G T LH           + + +    +D+   +  T + +A    N++   L            + G   L  A + G+E  V+ +L +   P L    N   ++P+ +A +   ++ +  L+   A ++ ++  +  T LHVA    +  +AK L+  G   + R+  G      P+H+A +    +++E+LL  G+S+++T    +   + P+H+A+     + V+ L  Q  AS N  + R ++   + +   +  V  V+++L +GA V     V    + T LHIA+++G  EIVQLLL+ G+DP A   +G      P++ A+  GH ++  L  + G  +S     G T LH A+  G +++  +LL+  A  + +  +G    + P+H+A+   H+K   LLL+ G+  ++      ++  T L+IA  +N+  V K L++ GA  ++     G  PLH+  Q G    +  L+G  ++S+++    G++++HL A++    ++  L + K + N T          T    +PL+ A  +G++ +V  L++  A ++ A+T  G+    P+H AA +G  HV+  LL+   S +E   +G T L
Sbjct:   73 TKVGNTA-LHIAALAGQTDIVRVLVEFGANI--------NAQSQNGFTPLYMAA--QENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL----ESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHE-KVIEMLLERDAPILAKTKNG--LSPLHMATQGEHLACVQLLLGRQAPVDDVTL-DYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNG----FTPLHIACKKNRIKVMELLLKHGASIHTT----TESGLTPIHVASFMGHLNVVQLLL-QNGASSNATNVRGETPLHMASRAGQLEV--VKTLLQSGARVG----VKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGST----PLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNG----LTPLHVATHYDHQKVALLLLDKGASPHSTA----KNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQ-GVAPLHLAAQEGHADMVALLLG-RHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTT----------TKLCYTPLHVASHYGNIKMVNFLLRNRALVN-AKTRNGYT---PLHQAAQQGHTHVVNALLQHEASPNELTANGNTAL 777          

HSP 3 Score: 157.918 bits (398), Expect = 1.825e-39
Identity = 159/603 (26.37%), Postives = 273/603 (45.27%), Query Frame = 1
Query: 2299 VLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFL------------------------THQQSASININS-TRSDSFNALLTLVSKRNVIGVQSVLMA---GADVSGKCIVSRSRNA--TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLT--------------GQIT------DSFSK---KTSYNISPLNQACGFGHLTVVKLLVKFGADIH----------WAETFEGH-------------------KGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTK---FLIGLKANVNIIDKIGKKPKDYAVTANLMSL 3852
             LH+A +  ++ +  EL+   + I   +++G       +H+A   G  +I+ +L+ FG+++N+    +S     PL++AA  +    VKFL                         H+Q   + + S T+       L + ++++     ++L+     ADV+ K +++++  +  T LHIAA  G+  +  LLL  GA   A   T  R+GI P+H+A + G+  +VKL  D G  +      GLT LH AA +G   ++E+LL+  A + A+  +G    + P+HMA++  H   V+LLL   +P++ V      D LT L++A       V K L+  G  P+ +  N G TPLHI C++   K +M L+    +S++    +G++ +H+ +  GH  +   LL+   + N T              GQ+        S ++   K   + +PL+ A   G   +V+LL++ G+D +          +  + EGH                   KG  P+H A+  G+  V   LLE   S D   ++GLTPLH +     YD  K    L+   A+ +   K G  P   A   N + +
Sbjct:   46 ALHLASKEGHVDVVTELLKREAEIDTATKVGN----TALHIAALAGQTDIVRVLVEFGANINA----QSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGA---AVDFTA-RNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNG----LSPLHMATQGEHLACVQLLLGRQAPVDDV----TLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALN-GFTPLHIACKKNRIK-VMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVAT---HYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEV 623          

HSP 4 Score: 150.214 bits (378), Expect = 4.681e-37
Identity = 174/669 (26.01%), Postives = 284/669 (42.45%), Query Frame = 1
Query: 1456 LLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVR-VLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLE--YGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSL-NVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPN 3450
            LL+N GA +      D    N        +HVA    +    + L+D+GA +        + +    +T LH A   +S     I  LLE    I +KT  G +P   A +   +    LLL R    + V     + L ++A   +  + K LL    + N +   G T LH                    I   K                      N I V+  +LK  A    +       +TPI +A  M  ++ +  L+++GA+ N  ++   ET LH+A R   + + K L+ +G+ + +++R    E+  P+H+A + G  EI+++LL  GS  N+     S     PL+ A+            H   AS+                           +L  GAD+S    V++ +  T LHIA++ G  E+  LLLE    ADP        ++G+ P+H+AT   H ++  L  D G S  +    G T LH AA    +++ ++LL+ GA+ N     G    + P+H+A+++GH   V LLL      +A  S   +  LTA+++A  E++ NV + L K  A+ +     L  TPLH+    G  K + +L  + N +L N     G + LH  A++GH  +   LL+ + +PN
Sbjct:  230 LLLNLGAAV------DFTARN----GITPLHVAAKRGNNNMVKLLLDRGAKI--------DTKTRDGLTPLHCAA--RSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLH--------------------IACKK----------------------NRIKVMELLLKHGAS---IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSN-ATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAR----EDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGST----PLYFASREG---------HGDVASL---------------------------LLENGADIS---PVTK-KGFTPLHIASKYGRLEVATLLLEKYASADPKG------KNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQG----VAPLHLAAQEGHADMVALLLGR----HASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTT-TKLCYTPLHVASHYGNIKMVNFL--LRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPN 767          

HSP 5 Score: 129.028 bits (323), Expect = 2.039e-30
Identity = 105/370 (28.38%), Postives = 179/370 (48.38%), Query Frame = 1
Query: 2707 KCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSS-------LNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNII 3795
            + ++ +S  AT    AA+ G+ E +   L+ G D    + T +++G+  +HLA++ GH+++V         +  A   G T LH AA AG  DI+ +L++ GA++NA++ +G      P++MA+++ H + VK LL+ G    A  S    D  T L +A  +  E V+  L++S     ++        LHI  ++  T A   L+   +++       LN    +G + LH+ A  G+  ++  LL      + T +            I+PL+ A   G+  +VKLL+  GA I      +   G+ P+HCAA  G   VI  LLE    I    ++GL+PLH +       C + L+G +A V+ +
Sbjct:    2 ETLLDKSDAATSFLRAARNGNLERLMDHLKGGMD----INTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNG----FTPLYMAAQENHLEIVKFLLDNG----ANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVR-----LPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTAR----------NGITPLHVAAKRGNNNMVKLLLDRGAKIDT----KTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDV 340          

HSP 6 Score: 128.642 bits (322), Expect = 2.952e-30
Identity = 121/450 (26.89%), Postives = 197/450 (43.78%), Query Frame = 1
Query: 2587 ASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGA----------------DVNAEA-----------------TDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTA 3837
              ++IN+   +  NAL     + +V  V  +L   A++     V      T LHIAA  G  +IV++L+E+GA+  A+     ++G  P+++A +  HLEIVK   D G + S A + G T L  A   G   ++ +LL++                  D NA A                      S   P+H+A+  G+     LLL  G+ ++  F+   R+ +T L++A      N++K L+  GA  D +  + G TPLH   + G  K I  L+   ++ +      G+S LH+ A +G +     LL  +  P     +T  +       ++PL+ A   GH  V KLL+  G +           G  P+H A  + +  V+  LL+ G SI    E GLTP+H +   G  +  + L+   A+ N  +  G+ P   A  A
Sbjct:   32 GGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGN----TALHIAALAGQTDIVRVLVEFGANINAQ----SQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVD--FTA--RNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRD-GLTPLHCAARSGHEKVIEMLLE-RDAPILAKTKNGLSPLHM-ATQGEHLACVQLLLGRQAP--VDDVTLDY-------LTPLHVAAHCGHYRVAKLLLDRGGE----PNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRA 453          

HSP 7 Score: 98.9821 bits (245), Expect = 3.822e-21
Identity = 127/549 (23.13%), Postives = 211/549 (38.43%), Query Frame = 1
Query: 1369 RGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNV---TLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGN-EIDVVRVLKQA-ADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            RG +PN       T L  + +K   K+ ELL+ +GA+I+      L            IHVA         Q L+  GA+              TNV   T LH+A   ++  L  +  LL+ G  +  K  +  TP   A R  K E   LLL RG D NA  A   + L  ++ + + ++   LL+N  D +     G T LH                                          A +YG  E+  + + K A ADP          +TP+ +A   +       L+  GA+  + ++ N  T LH+A +   + + K L+  G+  ++ ++ G    V P+H+A Q G  +++ +LL   +S++    L +   +  +HLAA  D  +  + LT  ++   ++N+T    +                                     T LH+A+  G+ ++V  LL   A   A+     R+G  P+H A + GH  +V        S +     G T L  A   G + +++ L
Sbjct:  366 RGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLT----------PIHVASFMGHLNVVQLLLQNGAS-----------SNATNVRGETPLHMAS--RAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLH-----------------------------------------IASKYGRLEVATLLLEKYASADPK-----GKNGLTPLHVATHYDHQKVALLLLDKGAS-PHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQG----VAPLHLAAQEGHADMVALLLGRHASIS----LATKGGLTAMHLAAQEDKVNVAEILTKHKA---DVNTTTKLCY-------------------------------------TPLHVASHYGNIKMVNFLLRNRALVNAKT----RNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          

HSP 8 Score: 62.3882 bits (150), Expect = 6.693e-10
Identity = 121/557 (21.72%), Postives = 221/557 (39.68%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLI--KSAP----------------EVVYWKSSCVLEINRGQINCTKVNCF--------------LLVILKSAVCLDD-----------VQFNCHIKKINYLLSEYKVDINSVCTVDGVSNN----NGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKEL 2349
            GH+ ++E+LL+  A P +   ++ ++PLH +    ++    A +QL+  + AP                   +++ + +L    G+ N   +N F              + ++LK    +               F  H+  +  LL             +G S+N     G   L M  +  Q     E++  LL     +     ++++ L +A +L    +V  LL RGSDPN       T L F+ ++ H  +  LL+  GA+I          S V       +H+A  Y   E    L++K A+         + + +  +T LH+A       +  +  LL+ G +  S    G TP   A + +++E   +LL  G + N +     + L L+A + + +++  LL      +     GLTA+H +  +D ++ +         I      D +++  L    L  A  YGN   V  +L+  A   LV        TP+  A +      +  L++H A+ N +++ N  T L +A R   I++   L
Sbjct:  289 GHEKVIEMLLERDA-PILAKTKNGLSPLHMATQGEHL----ACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ------------NGASSNATNVRGETPLHMASRAGQL----EVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADI----------SPVTKKGFTPLHIASKYGRLEVATLLLEKYASA--------DPKGKNGLTPLHVATHYDHQKVALL--LLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQED-KVNV-------AEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRA---LVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTA-NGNTALAIARRLGYISVVDTL 792          

HSP 9 Score: 59.6918 bits (143), Expect = 4.113e-9
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  335 LHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            L+   P+HIAC+  R  ++++LL+   +     E   + +     +   +      +   S     +    PLH+      L+ +K L+Q  A+V +++R     +T L +A  L + E V +LL+ G++PN    S  +PL++A++ G
Sbjct:  375 LNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKARE---DQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREG 520          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.622 bits (418), Expect = 1.665e-41
Identity = 146/540 (27.04%), Postives = 264/540 (48.89%), Query Frame = 1
Query: 2101 ALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            A + G+E  VV +L +   P L    N   ++P+ +A + + +  +  L+++ A ++ I+  +  T LHVA    +   AK L+  G+N ++R+  G      P+H+A +     ++E+LL +G+S+ +     +   + P+H++A     + V  L  Q  AS N  + R ++   +     +  V  V+S+L  GA V  K         T LHIAA++G  EIVQLLL++ A P A       +G  P+H+A   GH ++  +  + G S++     G T LH A+  G +++  +LL+  A  +A   +G    + P+H+AS   ++K   LLL+ G+  +A      ++  T L+IA  +++  +   L++ GA  +      G  PLH+  Q G       L+    + +N    +G+S LHL A++    ++  L++   + N T          T    +PL  AC +G++ +V  L++ GAD++     +   G  P+H AA +G  H++  LL+ G   ++   +G T L
Sbjct:   13 AARSGHE-QVVEILLEQGAPILAKTKNG--LSPLHMATQGDHVECVQVLMQYRAPVDDITL-DYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNG----FTPLHIACKKNRIRVMELLLKYGASIEAV----TESGLTPMHVSAFMGNLNIVLILL-QGGASPNATNVRGETALHMAARAGQTEV--VRSLLRNGAQVDAKA----REEQTPLHIAARLGKLEIVQLLLQHMASPDA----ATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNG----LTPLHVASHYDNQKVALLLLDQGASPHAT----AKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQ-GVAPLHLGAQEGHADVASLLLA-RYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNAT----------TKLGYTPLIVACHYGNIKMVNFLLQHGADVN----SKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTAL 505          

HSP 2 Score: 163.696 bits (413), Expect = 7.484e-41
Identity = 125/469 (26.65%), Postives = 216/469 (46.06%), Query Frame = 1
Query: 2410 PIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            P+H A ++G ++++EILL  G+ +    + K+   ++PLH+A   D    V+ L   ++   +I      + + L                                  T LH+AA  G +   ++LL+ GA+P  R +    +G  P+H+A +   + +++L   +G S+ A  + GLT +H +A  G+++I+ ILL+ GA  NA    G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA    +  +++ L++  A+PD   +N G TPLH+  + G       L+    +SL V    G + LH+ ++ G  E++  LL+   +P+  G+            ++PL+ A  + +  V  LL+  GA  H         G  P+H AA + +  +  TLLE G   +     G+ PLH    EG  D    L+   A+VN   K G  P
Sbjct:    9 PLHCAARSGHEQVVEILLEQGAPI----LAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDI------TLDYL----------------------------------TALHVAAHCGHYRTAKVLLDKGANPNVRAL----NGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETA----LHMAARAGQTEVVRSLLRNGAQVDAK----AREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSN-GYTPLHVAAREGHEDVTAILLE-HGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGK----------NGLTPLHVASHYDNQKVALLLLDQGASPHAT----AKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSP 405          

HSP 3 Score: 128.257 bits (321), Expect = 5.574e-30
Identity = 150/587 (25.55%), Postives = 250/587 (42.59%), Query Frame = 1
Query: 1648 ETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGK------CIVSRSRNA---------------------TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANP-DIQENNLGATPLHITCQRGFTKAI 3315
            +  +T LH A   +S     +  LLE G  I +KT  G +P   A +   +E   +L+      + +     + L ++A   +    K LL    + N +   G T LH +  ++ RI +   +                            L+YG  I+ V                   +TP+ ++  M +++ +  L++ GA+ N  ++   ET LH+A R     + + L+  G+ +  ++R    EE  P+H+A + G  EI+++LL   +S ++     +     PLH+AA          L  +  AS+ + + +   F  L  + SK   + V S+L+   A  D +GK       + S   N                      T LHIAA+    EI   LLEYGA+  A  IT  R G+ P+HL  + GH ++  L       V+ A   GL+ LH AA    V++ EIL+K GA VNA    G      P+ +A   G+ K V  LL++G+ +N+      ++  T L+ A  +   +++  L+K GA P D+  N  G T L I  + G+   +
Sbjct:    4 QDGLTPLHCAA--RSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKN-RIRVMELL----------------------------LKYGASIEAV---------------TESGLTPMHVSAFMGNLNIVLILLQGGASPN-ATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAR----EEQTPLHIAARLGKLEIVQLLLQHMASPDAA----TSNGYTPLHVAAREGHEDVTAILL-EHGASLAVTTKKG--FTPL-HVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNA--IT--RQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLG----YTPLIVACHYGNIKMVNFLLQHGADVNSK----TKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVN--GNTALAIARRLGYISVV 517          

HSP 4 Score: 120.553 bits (301), Expect = 1.226e-27
Identity = 97/329 (29.48%), Postives = 162/329 (49.24%), Query Frame = 1
Query: 2836 RDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI--GIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            +DG+ P+H A  SGH ++V++  + G  + A    GL+ LH A     V+ +++L++  A V+    D     +  +H+A+  GH ++ K+LL+ G+  N     LN    T L+IA  +NR  VM+ L+K GA+ +    + G TP+H++   G    ++ L+  G + ++ NV    G ++LH+ A  G  E+   LLR        G   D+ +++     +PL+ A   G L +V+LL++  A    A +     G  P+H AA  G   V   LLE G S+    + G TPLH +   G  +    L+   A+ +   K G  P
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVD----DITLDYLTALHVAAHCGHYRTAKVLLDKGA--NPNVRALN--GFTPLHIACKKNRIRVMELLLKYGASIEAVTES-GLTPMHVSAFMGNLNIVLILLQGGASPNATNV---RGETALHMAARAGQTEVVRSLLR-------NGAQVDAKAREEQ---TPLHIAARLGKLEIVQLLLQHMASPDAATS----NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTP 306          

HSP 5 Score: 119.013 bits (297), Expect = 3.394e-27
Identity = 154/602 (25.58%), Postives = 257/602 (42.69%), Query Frame = 1
Query: 1393 RNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLF-LTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLI---LSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIA 3186
            R   +T L  + +  H+++ E+L+  GA I         L+  K    + +H+A      E  Q L+   A +  +T+D L         T LH+A             LL+ G N   +   G TP   A + ++I    LLL  G    ++ A+ ESGL    +SA   N  I+  LLQ     N  +  G TALH                       A+    +   SL        L+ G ++D     +Q               TP+ +A  +  +  +  L++H A+ +  +S N  T LHVA R  +  +   L+  G+++ + ++ G      P+HVA + G  E+  +LL   +S ++         + PLH+A+  D    V  L   Q AS   ++T  + +  L     K  +    ++L  GA+ +    ++R +    LH+ AQ G  ++  LLL   AD    +    + G+ P+HLA +   + + ++    G  V+A    G T L  A + G++ ++  LL+ GADVN++  +G      P+H A+++GH   V LLL+ G+  N V    N    TAL IA
Sbjct:    3 RQDGLTPLHCAARSGHEQVVEILLEQGAPI---------LAKTK-NGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYL---------TALHVAA--HCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGA---SIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALH---------------------MAARAGQTEVVRSL--------LRNGAQVDAKAREEQ---------------TPLHIAARLGKLEIVQLLLQHMASPDAATS-NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKG----FTPLHVASKYGKMEVASLLLQRFASPDAA----GKNGLTPLHVASHYD-NQKVALLLLDQGAS--PHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNA---ITR-QGVAPLHLGAQEGHADVASLLLARYAD----VNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNG----YTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGN----TALAIA 508          

HSP 6 Score: 106.686 bits (265), Expect = 2.208e-23
Identity = 134/535 (25.05%), Postives = 239/535 (44.67%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQN--QVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMA-GADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            ++ L  + Q  H +  ++L+ Y A ++          ++ L    ++HVA       T + L+DKGAN    V  L+        T LH+A   K N +  +  LL+ G +IE+ T  G TP   +     +    +LL  G   NA N   E+ L ++A     E+++ LL+N  QVD+  ++    T LH +     R+G    +     + +  +   D++ S     L  A + G+E     +L+  A    + +      TP+ +A +   +     L++  A+ +  +  N  T LHVA    N  +A  L+  G++ H  ++ G      P+H+A +    EI   LL +G+  N+     + + V PLHL A  +  + V  L   + A +N ++T+S    + L L ++ + + V  +L+  GA V+    +      T L +A   G+ ++V  LL++GAD  ++     ++G  P+H A + GH  IV L    G   +     G T L  A   G + +++ L
Sbjct:   40 LSPLHMATQGDHVECVQVLMQYRAPVD----------DITLDYLTALHVAAHCGHYRTAKVLLDKGANP--NVRALN------GFTPLHIAC--KKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQ--TPLHIAA----RLGKLEIV----QLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGAS---LAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPD-AAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNG----YTPLHIAAKKDQLEIATTLLEYGAETNAI----TRQGVAPLHLGA-QEGHADVASLLLARYADVN-HATKSGL--SPLHLAAQEDKVNVAEILVKHGAHVNATTKL----GYTPLIVACHYGNIKMVNFLLQHGADVNSKT----KNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 7 Score: 101.679 bits (252), Expect = 6.724e-22
Identity = 127/547 (23.22%), Postives = 219/547 (40.04%), Query Frame = 1
Query: 1183 NNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNV---TLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNA-TCLHIAAQVGSFEIVQLLLEYGADP 2811
              NGL  L M  +        E + +L+ +R  +++      + L +A           LL +G++PN+      T L  + +K   ++ ELL+ YGA+I            V  +    +HV+    +      L+  GA+              TNV   T LH+A   ++     +  LL  G  +++K  +  TP   A R  K+E   LLL      +A  +   + L ++A + + ++   LL++          G T LH                                          A +YG       +L++ A PD         +TP+ +A   ++      L+  GA+  + ++ N  T LH+A +   + IA  L+  G+  +  +R G    V P+H+  Q G  ++  +LL   + +N      +   ++PLHLAA  D  +  + L    +   ++N+T    +  L+      N+  V  +L  GADV+     S+++N  T LH AAQ G   IV LLL+ GA P
Sbjct:   36 TKNGLSPLHMATQGDHV----ECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEA----------VTESGLTPMHVSAFMGNLNIVLILLQGGAS-----------PNATNVRGETALHMAA--RAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLH-----------------------------------------VASKYGKMEVASLLLQRFASPDAA---GKNGLTPLHVASHYDNQKVALLLLDQGAS-PHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQG----VAPLHLGAQEGHADVASLLLARYADVNHA----TKSGLSPLHLAAQEDKVNVAEILVKHGA---HVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVN-----SKTKNGYTPLHQAAQQGHTHIVNLLLKCGARP 494          

HSP 8 Score: 66.2402 bits (160), Expect = 5.517e-11
Identity = 119/554 (21.48%), Postives = 225/554 (40.61%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVV--------------YWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINY--LLSEYKVDINSVCTVDGVSNNN------GLHILLMIVKKFQFP-----------------LRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSH---SLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKEL 2349
            GH+ +VE+LL+ GA P +   ++ ++PLH +   ++++ +   +Q      ++               +++++ VL       N   +N F             +   C   +I    LL +Y   I +V T  G++  +       L+I+L++++    P                  + E++  LL +   ++    + ++ L +A +L  L +V  LL   + P+   +   T L  + ++ H+ +T +L+ +GA++        V +    T    +HVA  Y   E    L+ +    F + D   +      +T LH+A    +  +  +  LL+ G +  +    G TP   A +  ++E    LL  G + NA+     + L L A + + ++   LL    D N     GL+ LH +  +D              + +A+I     +H   + K GY  LI A  YGN   V  +L+  AD   V        TP+  A +      +  L++ GA  N ++  N  T L +A R   I++   L
Sbjct:   17 GHEQVVEILLEQGA-PILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGF-----------TPLHIACKKNRIRVMELLLKYGASIEAV-TESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLA-------VTTKKGFT---PLHVASKYGKMEVASLLLQR----FASPDAAGK----NGLTPLHVASHYDNQKVALL--LLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQED-------------KVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGAD---VNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTV-NGNTALAIARRLGYISVVDTL 520          

HSP 9 Score: 52.7582 bits (125), Expect = 5.715e-7
Identity = 52/219 (23.74%), Postives = 86/219 (39.27%), Query Frame = 1
Query: 3154 NRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGK 3810
             +D LT L+ A     E V++ L++ GA P + +   G +PLH+  Q    + +  L+       ++ L+  +++LH+ A  GH   +  LL    NP                N+  LN                               G  P+H A  + +  V+  LL+ G SI+   E GLTP+H S   G  +    L+   A+ N  +  G+
Sbjct:    3 RQDGLTPLHCAARSGHEQVVEILLEQGA-PILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDY-LTALHVAAHCGHYRTAKVLLDKGANP----------------NVRALN-------------------------------GFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGE 172          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.147 bits (396), Expect = 5.093e-39
Identity = 217/888 (24.44%), Postives = 358/888 (40.32%), Query Frame = 1
Query: 1252 IDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGL----ILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCH-LIRHGANLNYISS---------------PNQ--ETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLT-STVKFLTHQQ---SASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRD-GILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNT--GISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKG--IQPIHCAAIRGKYHVIPTLLE--AGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            +  LL H  ++N  +   ++ L +A     +     ++   S  N+      T+L  +    H +M   L+  GANIN    FD         +  +IH A      E  + L+  GA+    V   D++      + LH A    S  +  +  LL++G++I+   S G+T    A    +    N L+   C  N VN  NE G       +A       ++ L+ N  D N +   G + LH + +          I +   I     D N   H         A +YG+E+ +  ++   AD     IH    M P+ LA  ++  S+ C  L+  G   + +SS               P++   T LH A    N+     L+  G++++ + R     E   +H A  N   + +  L+  G+ LN     +   R  PLH AA  D   STV F  +      + I+++ST S++   L  L+ K    G+Q                  +  T +H AA  G    ++LLLE    P A    G     I P+HLA   GH   +++     V +   E  G T L  AA  G  D + +L++ GA V  +     R+ +   H A+  GH + ++LL+E      AV +  + +  T + +A      +    L+  GA+ + ++N  G T LH     G  + +  L+     S++V L    G + LH+ A  GH  +   L++          +TD    +  Y  +PL+ AC  GH   V+LL++        + F+  +G    P+HCA +         L++      I+ PD  G  PLH +      +C + L+   A VN+ D  GK P
Sbjct:   88 VQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINA---FDK-------KDRRAIHWAAYMGHTEVVKVLVAHGAD----VRCKDKK----GYSPLHAAS--SSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELI--DCGAN-VNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLH--------IAARYGHELLINTLITNGADTAKRGIHG---MFPLHLAA-LSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRF----ERTALHYAAANCNVQCVVTLVASGARLNE----QDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQD----------------KQGYTPVHYAAAYGHRVCLELLLE---QPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTAL---HSAATNGHVECLRLLVENADSNEAVDAS-DANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNK-GCTALHRGAATGHEECVDLLL---QRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTD----RNGY--TPLHWACYNGHDGCVELLLEL-------DVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSP 892          

HSP 2 Score: 128.642 bits (322), Expect = 3.221e-30
Identity = 186/771 (24.12%), Postives = 307/771 (39.82%), Query Frame = 1
Query: 1660 TLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQ--ETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEI-IEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESG-------------HLEIVKLF-----FDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENREN----------------------------VMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTG--ISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLE---AGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            T LH A  L    +  I  L+  G  + SK +K  TP   A       A   LL    D NA +   ++ L ++A  +  +  + ++     SN  D  G TALHH+        +++ +    NI         ++   K    I+   Y    +VV+VL    AD   V   +    +P+  A     I  +  L+  G +   I  PN    T LHVA  N    +  ELI  G+N++  +  G      P+H A  +    + +E+L+  G+ +N    ++S +  +PLH+ A++      +F             TRS                  Q+++  G ++  +    R  N T LHIAA+ G   ++  L+  GAD   R I     G+ P+HLA  SG                IV  F        G  +   ++ G TCLH AA+ G+V+ + +LL  GAD+N +    +R +   +H A+   + + V  L+  G+ +N    R      T L+ A + + +                              +++L++  A+P IQ+   G TP+H     G  +  + L+     +      +G  IS LHL A  GH+     L+R          + D    +     +PL  A   GH   V++L++ GA +      EG      +H AA  G    +  L+E   +  ++D  D +  TP+  +V  G  DC   L+   A++N  D  G
Sbjct:   41 TPLHAAAYLGEAEI--IELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANI---------NAFDKKDRRAIHWAAYMGHTEVVKVLVAHGAD---VRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVD---IDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERG----FTPLHFAAASTHGALCLELLVNNGADVN----VQSKDGKSPLHMTAVHG-----RF-------------TRS------------------QTLIQNGGEIDCE---DRDGN-TPLHIAARYGHELLINTLITNGADTAKRGI----HGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKK----DRFERTALHYAAANCNVQCVVTLVASGARLNEQDER----RCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQ-GYTPVHYAAAYGH-RVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIR---------SLVD-LDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLK---EGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKG 719          

HSP 3 Score: 128.257 bits (321), Expect = 5.193e-30
Identity = 144/578 (24.91%), Postives = 244/578 (42.21%), Query Frame = 1
Query: 2344 ELIFAGSNIHLRSRLGQGEEV--------LPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSV--LMAGADVSGKC-------------------IVSRSRN--------ATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKK-SVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQ---ITDSFSKK------------TSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSV------------------IEGFYD----------CTKFLIGLKANVNIIDKIGKKPKDYAVT 3834
            + IF G    +RS + + EEV         P+H A   G  EIIE+L++ G+ +NS    K  + + PLH A  +   + V+ L      S ++N+   +    L    + R V   +++  +++ ++VS +                    +V++  N           +H AA +G  E+V++L+ +GAD   +    D+ G  P+H A+ SG + +VKL  D GV +      G T LH A   G   ++  L+  GA+VN      N     P+H A+   H    ++LL+  G+ +N      ++D  + L++     R    + LI++G   D ++ + G TPLHI  + G    I  LI     +    ++ G+  LHL A  G ++    LL         GQ   I  SFS +              +  + L+ A   G++  + LL+  GAD++  + FE       +H AA       + TL+ +G  ++E DE   TPLH++                   ++ + D          C + L+   A+  I DK G  P  YA  
Sbjct:   12 QAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNS----KDNKWLTPLHRACASRSEAAVQTLLKH---SADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCK----DKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVN----QANERGFTPLHFAAASTHGALCLELLVNNGADVNV----QSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRD-GNTPLHIAARYGHELLINTLITNGADTAKRGIH-GMFPLHLAALSGFSDCCRKLLS-------AGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFE----RTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAA 557          

HSP 4 Score: 114.775 bits (286), Expect = 6.560e-26
Identity = 239/1048 (22.81%), Postives = 411/1048 (39.22%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQ-ITPLHASCISNNIDNLAATIQLIKSAPEV----VYWKSSCVLEINRGQINCTKVNCFLLVILKSA--------VCLDDVQFNCHIKKINYLLSEY-------KVDINSVCTVDGVSNNNGLHILLM-------IVKKFQFPLRKE-------LIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMT-ELLINYGANINENVCFDLVLSNVKLTNCAS-IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAIN------------------ESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMC--HLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKS-GAN----PDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQ-PIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTP-LHWSVIEGFYDCTKFLIG 3771
            +G   I+E+L+  GA  R+ +K ++ +TPLH +C S +    AA   L+K + +V      W++   +      + C +    ++ +L S+          L    FN H + +N+L+++        K D  ++     + +   + +L+          KK   PL          ++ +LL   ++I++ NS   + L +A       +V+ L+  G++ N    +  T L F+    H  +  ELL+N GA++N           V+  +  S +H+  ++      Q LI  G  +       D  + + N T LH+A       L  IN L+  G +   +   G  P   A      + C  LL  G   + V++ +                   + L  +A   N E +  LL    D N+KD +  TALH++        +   +        A++++ D        Y   A   G+ +                ++N +++          S + +C  HL+R  A+           V + A     + +   L   G+    +S    G  + P+H+A  +G    +E+L+     L+    ++      PL LAAL   T  V+ L  Q  AS+ +     D   AL +  +  +V  ++ +L+  AD +     S +   T + +A   G  +   LLL  GA   A+    D  G   +H    +GH E V L     V VS  E  G   LH AA  G + I+  L++A     A     +R+   P+H A   GH   V+LLLE       VF +   +  + L+ A   + E+  + LI + GA     PD +    G  PLH        + +  L+   N+ +NV    G S L +  E G       L        +    TD   +  + N + L+ AC   H T   L++    D++          +Q P+H AA  G   V+  LL  G SI   D +G TP L  +  +   +C   ++G
Sbjct:   49 LGEAEIIELLVLSGA--RVNSKDNKWLTPLHRACASRS---EAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEA---IIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVN-----------VQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEI-------DCEDRDGN-TPLHIAARYGHELL--INTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASG-----ARLNEQDERRCTPLHYAAAADGDGSTVSFS-------------VYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGA---FQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLD----VREGNGYTPLGLAALRGHTDCVRVLI-QHGASVLLKEG-PDRRTALHSAATNGHVECLR-LLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAK----DNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELD-----VFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAK----GRMPLHAAAFTDHVECLQLLLS-HNALVNVTDMAGKSPLMMACENGQATAVEVL--------VNSTKTDLKLQDANRNTA-LHLACSRSHETCALLILDKLDDLNLINATNA--ALQTPLHLAARSGMATVVQVLLNKGASILAVDHNGYTPALSCAPNKSVAECLSLILG 1014          

HSP 5 Score: 99.7525 bits (247), Expect = 2.565e-21
Identity = 89/290 (30.69%), Postives = 139/290 (47.93%), Query Frame = 1
Query: 2974 GSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDN--LTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTA 3837
            G  D +  L+    +VNA     +  K  P+H A+  G  + ++LL+  G+ +N+      +DN  LT L+ A +   E  ++ L+K  A+ + ++ N   TPLH+       K    +I + +SS NV    G ++LH  A  GH+E+  +L+    N N       +F KK    I   + A   GH  VVK+LV  GAD+   +     KG  P+H A+  G+  V+  LL+ GV ID+P+  G T LH +   G       LI   ANVN  ++ G  P  +A  +
Sbjct:   17 GDPDEVRSLIYKKEEVNAV----DDEKRTPLHAAAYLGEAEIIELLVLSGARVNS------KDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNW-QTPLHVAAANRAVKCAEAIIPMLSSS-NVSDRAGRTALHHAAFNGHSEMVNFLVAKGANIN-------AFDKKDRRAI---HWAAYMGHTEVVKVLVAHGADVRCKDK----KGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAAS 280          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.599 bits (379), Expect = 5.200e-37
Identity = 125/458 (27.29%), Postives = 223/458 (48.69%), Query Frame = 1
Query: 2347 LIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPL 3720
            L+  G+N ++R+  G      P+H+A +     ++E+LL +G+S+ +     +   + P+H++A     + V  L  Q  AS N  + R ++   +     +  V  V+S+L  GA V  K         T LHIAA++G  EIVQLLL++ A P A       +G  P+H+A   GH ++  +  + G S++     G T LH A+  G +++  +LL+  A  +A   +G    + P+H+AS   ++K   LLL+ G+  +A      ++  T L+IA  +++  +   L++ GA  +      G  PLH+  Q G       L+    + +N    +G+S LHL A++    ++  L++   + N T          T    +PL  AC +G++ +V  L++ GAD++     +   G  P+H AA +G  H++  LL+ G   ++   +G T L
Sbjct:    1 LLDKGANPNVRALNG----FTPLHIACKKNRIRVMELLLKYGASIEAV----TESGLTPMHVSAFMGNLNIVLILL-QGGASPNATNVRGETALHMAARAGQTEV--VRSLLRNGAQVDAKA----REEQTPLHIAARLGKLEIVQLLLQHMASPDA----ATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNG----LTPLHVASHYDNQKVALLLLDQGASPHAT----AKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQ-GVAPLHLGAQEGHADVASLLLA-RYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNAT----------TKLGYTPLIVACHYGNIKMVNFLLQHGADVN----SKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTAL 415          

HSP 2 Score: 145.591 bits (366), Expect = 1.815e-35
Identity = 120/440 (27.27%), Postives = 218/440 (49.55%), Query Frame = 1
Query: 2137 VLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAA-LNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMA-GADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPN 3450
            +L + A+P++  ++     TP+ +A + N I  M  L+++GA++  ++     T +HV+    N+ I   L+  G++ +  +  G+      +H+A + G  E++  LL  G+ +++    K+ E   PLH+AA L  L      L H  S     ++  S+ +  L  + ++     V ++L+  GA ++    V+  +  T LH+A++ G  E+  LLL+  A P A      ++G+ P+H+A+   + ++  L  D G S  A    G T LH AA    ++I   LL+ GA+ NA      R  + P+H+ +++GH     LLL   + +N       +  L+ L++A  E++ NV + L+K GA+ +     LG TPL + C  G  K + +L+    + +N     G + LH  A++GH  +   LL+C   PN
Sbjct:    1 LLDKGANPNVRALNG---FTPLHIACKKNRIRVMELLLKYGASIEAVTESGL-TPMHVSAFMGNLNIVLILLQGGASPNATNVRGE----TALHMAARAGQTEVVRSLLRNGAQVDA----KAREEQTPLHIAARLGKLEIVQLLLQHMASP----DAATSNGYTPL-HVAAREGHEDVTAILLEHGASLA----VTTKKGFTPLHVASKYGKMEVASLLLQRFASPDA----AGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAI----TRQGVAPLHLGAQEGHADVASLLLARYADVN----HATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNAT-TKLGYTPLIVACHYGNIKMVNFLLQ-HGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPN 405          

HSP 3 Score: 140.198 bits (352), Expect = 8.293e-34
Identity = 100/343 (29.15%), Postives = 167/343 (48.69%), Query Frame = 1
Query: 2788 LLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LL+ GA+P  R +    +G  P+H+A +   + +++L   +G S+ A  + GLT +H +A  G+++I+ ILL+ GA  NA    G  +    +HMA+  G  + V+ LL  G+ ++A      R+  T L+IA    +  +++ L++  A+PD   +N G TPLH+  + G       L+    +SL V    G + LH+ ++ G  E++  LL+   +P+  G+            ++PL+ A  + +  V  LL+  GA  H         G  P+H AA + +  +  TLLE G   +     G+ PLH    EG  D    L+   A+VN   K G  P
Sbjct:    1 LLDKGANPNVRAL----NGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETA----LHMAARAGQTEVVRSLLRNGAQVDAK----AREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSN-GYTPLHVAAREGHEDVTAILLE-HGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGK----------NGLTPLHVASHYDNQKVALLLLDQGASPHAT----AKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSP 315          

HSP 4 Score: 129.028 bits (323), Expect = 2.363e-30
Identity = 103/360 (28.61%), Postives = 178/360 (49.44%), Query Frame = 1
Query: 2737 TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            T LHIA +     +++LLL+YGA   A  +T    G+ P+H++   G+L IV +    G S +A    G T LH AA AG  +++  LL+ GA V+A+A    R +  P+H+A+  G  + V+LLL++ +  +A  S    +  T L++A  E  E+V   L++ GA+  +     G TPLH+  + G  + +  L+    +S +     G++ LH+ +   + +++  LL    +P+ T         K  Y  +PL+ A     L +   L+++GA+ +        +G+ P+H  A  G   V   LL     ++   + GL+PLH +  E   +  + L+   A+VN   K+G  P
Sbjct:   17 TPLHIACKKNRIRVMELLLKYGASIEA--VT--ESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKA----REEQTPLHIAARLGKLEIVQLLLQHMASPDAATS----NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKK-GFTPLHVASKYGKME-VASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATA--------KNGY--TPLHIAAKKDQLEIATTLLEYGAETNAIT----RQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTP 348          

HSP 5 Score: 128.257 bits (321), Expect = 4.680e-30
Identity = 112/395 (28.35%), Postives = 189/395 (47.85%), Query Frame = 1
Query: 2635 LTLVSKRNVIGVQSVLMA-GADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            L +  K+N I V  +L+  GA +     V+ S   T +H++A +G+  IV +LL+ GA P A  + G+      +H+A  +G  E+V+     G  V A      T LH AA  G ++I+++LL+  A  +A  ++G      P+H+A+ +GH+    +LLE+G    A  +   +   T L++A+   +  V   L++  A+PD    N G TPLH+       K  + L+    +S +     G + LH+ A+K   E++  LL         G  T++ +++    ++PL+     GH  V  LL+   AD++ A       G+ P+H AA   K +V   L++ G  ++   + G TPL  +   G      FL+   A+VN   K G  P
Sbjct:   19 LHIACKKNRIRVMELLLKYGASIEA---VTES-GLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGE----TALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNG----YTPLHVAAREGHEDVTAILLEHG----ASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKN-GLTPLHVASHYDNQKVALLLLD-QGASPHATAKNGYTPLHIAAKKDQLEIATTLLE-------YGAETNAITRQ---GVAPLHLGAQEGHADVASLLLARYADVNHATK----SGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTP 381          

HSP 6 Score: 112.464 bits (280), Expect = 3.118e-25
Identity = 130/493 (26.37%), Postives = 216/493 (43.81%), Query Frame = 1
Query: 1717 LLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLI---LSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIA 3186
            LL+ G N   +   G TP   A + ++I    LLL  G    ++ A+ ESGL    +SA   N  I+  LLQ     N  +  G TALH                       A+    +   SL        L+ G ++D     +Q               TP+ +A  +  +  +  L++H A+ +  +S N  T LHVA R  +  +   L+  G+++ + ++ G      P+HVA + G  E+  +LL   +S ++         + PLH+A+  D    V  L   Q AS   ++T  + +  L     K  +    ++L  GA+ +    ++R +    LH+ AQ G  ++  LLL   AD    +    + G+ P+HLA +   + + ++    G  V+A    G T L  A + G++ ++  LL+ GADVN++  +G      P+H A+++GH   V LLL+ G+  N V    N    TAL IA
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGA---SIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALH---------------------MAARAGQTEVVRSL--------LRNGAQVDAKAREEQ---------------TPLHIAARLGKLEIVQLLLQHMASPDAATS-NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKG----FTPLHVASKYGKMEVASLLLQRFASPDAA----GKNGLTPLHVASHYD-NQKVALLLLDQGAS--PHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNA---ITR-QGVAPLHLGAQEGHADVASLLLARYAD----VNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNG----YTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGN----TALAIA 418          

HSP 7 Score: 98.2117 bits (243), Expect = 8.214e-21
Identity = 115/485 (23.71%), Postives = 197/485 (40.62%), Query Frame = 1
Query: 1369 RGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNV---TLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNA-TCLHIAAQVGSFEIVQLLLEYGADP 2811
            +G++PN+      T L  + +K   ++ ELL+ YGA+I            V  +    +HV+    +      L+  GA+              TNV   T LH+A   ++     +  LL  G  +++K  +  TP   A R  K+E   LLL      +A  +   + L ++A + + ++   LL++          G T LH                                          A +YG       +L++ A PD         +TP+ +A   ++      L+  GA+  + ++ N  T LH+A +   + IA  L+  G+  +  +R G    V P+H+  Q G  ++  +LL   + +N      +   ++PLHLAA  D  +  + L    +   ++N+T    +  L+      N+  V  +L  GADV+     S+++N  T LH AAQ G   IV LLL+ GA P
Sbjct:    4 KGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEA----------VTESGLTPMHVSAFMGNLNIVLILLQGGAS-----------PNATNVRGETALHMAA--RAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLH-----------------------------------------VASKYGKMEVASLLLQRFASPDAA---GKNGLTPLHVASHYDNQKVALLLLDQGAS-PHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQG----VAPLHLGAQEGHADVASLLLARYADVNHA----TKSGLSPLHLAAQEDKVNVAEILVKHGA---HVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVN-----SKTKNGYTPLHQAAQQGHTHIVNLLLKCGARP 404          

HSP 8 Score: 95.9005 bits (237), Expect = 4.131e-20
Identity = 123/474 (25.95%), Postives = 214/474 (45.15%), Query Frame = 1
Query: 1588 LIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQN--QVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMA-GADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEIL 3000
            L+DKGAN    V  L+        T LH+A   K N +  +  LL+ G +IE+ T  G TP   +     +    +LL  G   NA N   E+ L ++A     E+++ LL+N  QVD+  ++    T LH +     R+G    +     + +  +   D++ S     L  A + G+E     +L+  A    + +      TP+ +A +   +     L++  A+ +  +  N  T LHVA    N  +A  L+  G++ H  ++ G      P+H+A +    EI   LL +G+  N+     + + V PLHL A  +  + V  L   + A +N ++T+S    + L L ++ + + V  +L+  GA V+     +     T L +A   G+ ++V  LL++GAD  ++     ++G  P+H A + GH  IV L    G   +     G T L  A   G + +++ L
Sbjct:    1 LLDKGANP--NVRALN------GFTPLHIAC--KKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQ--TPLHIAA----RLGKLEIV----QLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGAS---LAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPD-AAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNG----YTPLHIAAKKDQLEIATTLLEYGAETNAI----TRQGVAPLHLGA-QEGHADVASLLLARYADVN-HATKSGL--SPLHLAAQEDKVNVAEILVKHGAHVN----ATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKT----KNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 9 Score: 46.595 bits (109), Expect = 1.125e-10
Identity = 34/149 (22.82%), Postives = 69/149 (46.31%), Query Frame = 2
Query:  335 LHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            L+   P+HIAC+  R  ++++LL+   + E   E   + +     +   +  +   +   S     +     LH+       + ++ L++  A+V  ++R     +T L +A  L +LE V +LL+  A+P+    +  +PL  AA+ G
Sbjct:   13 LNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKARE---EQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREG 158          

HSP 10 Score: 38.5058 bits (88), Expect = 1.125e-10
Identity = 93/429 (21.68%), Postives = 160/429 (37.30%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKN-PEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFR-IGID-----YFIHDSTNIFIAKIDDNDSSHSLKS 2085
            GH+ +  +LL++GA+  + TK+   TPLH +     ++  +  +Q   S P+                          L  L  A   D+       +K+  LL +     ++       +  NG   L +  KK Q     E+   LL +    N    +  + L L  Q     + S LL R +D N      ++ L  + Q+    + E+L+ +GA++N         +  KL     I VA  Y + +   FL+  GA++          + +   T LH A   +    + +N LL+ G      T  G+T    A R   I   + L      K        S  + +   +N PE M  +L+   D  +    G   + +   +D R +G D     +F+  ST   +   +    S SL+S
Sbjct:  158 GHEDVTAILLEHGASLAVTTKK-GFTPLHVASKYGKMEVASLLLQRFAS-PDAAGKNG--------------------LTPLHVASHYDN-------QKVALLLLDQGASPHA-------TAKNGYTPLHIAAKKDQL----EIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVN---------ATTKLGYTPLI-VACHYGNIKMVNFLLQHGADV--------NSKTKNGYTPLHQAA--QQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL------KVVTEETITSTTVSNPSSRNVPETMTEVLEVSDDEGEDTMTG-DGMEYLRAEDLRELGDDSLPSSHFLEGSTGYSMGFGNWATRSGSLRS 519          

HSP 11 Score: 59.6918 bits (143), Expect = 4.723e-9
Identity = 88/375 (23.47%), Postives = 157/375 (41.87%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSH---SLKSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKEL 2349
            + E++  LL +   ++    + ++ L +A +L  L +V  LL   + P+   +   T L  + ++ H+ +T +L+ +GA++        V +    T    +HVA  Y   E    L+ +    F + D   +      +T LH+A    +  +  +  LL+ G +  +    G TP   A +  ++E    LL  G + NA+     + L L A + + ++   LL    D N     GL+ LH +  +D              + +A+I     +H   + K GY  LI A  YGN   V  +L+  AD   V        TP+  A +      +  L++ GA  N ++  N  T L +A R   I++   L
Sbjct:   93 QTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASL-------AVTTKKGFT---PLHVASKYGKMEVASLLLQR----FASPDAAGK----NGLTPLHVASHYDNQKVALL--LLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQED-------------KVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGAD---VNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTV-NGNTALAIARRLGYISVVDTL 430          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 60.8474 bits (146), Expect = 1.029e-9
Identity = 55/214 (25.70%), Postives = 102/214 (47.66%), Query Frame = 1
Query: 3067 HMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDG 3708
            H A ++G   +VK ++ +G  +       + +++T L+ A+  NR +V+ +L+  GA+ + +   L ATPLH   + G+   + +L+    +   +  + G + LHL+    +  L  ++L    +  L     D   +      S L  A     LTV +LL KFGA I  A+T    +G  P+H   ++G+ HV+  L++ G    +  + G
Sbjct:   78 HTACQRGDLATVKEMI-HGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLK-HGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLL----DIDCRDPKGRTSLLWAAYQGDSLTVAELL-KFGASIKIADT----EGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTG 280          

HSP 2 Score: 59.3066 bits (142), Expect = 3.816e-9
Identity = 61/206 (29.61%), Postives = 95/206 (46.12%), Query Frame = 1
Query: 2527 HLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMA-GADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAE-DC----GLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGS 3126
            H A      +TVK + H +   +N +   ++    L    S  N + V   L++ GADV+ +   + + +AT LH AA+ G   IV  LL++GADP       D  G   +HL+  S ++ +V       VS    + DC    G T L +AA  G    +  LLK GA +    T+G      P+H  + KG    +K L++ G+
Sbjct:   78 HTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGL-HWASINNRLSVVDFLVSQGADVNAR---AGALHATPLHWAARYGYVYIVDFLLKHGADP----TMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEG----FTPLHWGTVKGQPHVLKYLIQDGA 271          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 59.6918 bits (143), Expect = 2.556e-9
Identity = 59/207 (28.50%), Postives = 99/207 (47.83%), Query Frame = 1
Query: 3073 ASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDE 3693
            A++ G  K VK ++E G+ ++    R+  D L+ L+ A   NR +V K+L+  GANP+      GAT LH   + G    I+ L+    +   +    G++ +H +    +  L  ++L    N N    I      K + N +PL  A   G    V+LL+KFG+ + W +    ++G   +HCA + G   VI  L+ +G +  E
Sbjct:   57 AAKDGDLKVVKDVVESGA-VDINNDRI--DELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYG-NIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDI----DSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTD----NRGFNALHCALVGGDQRVICDLILSGANFYE 251          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 50.0618 bits (118), Expect = 6.893e-7
Identity = 58/269 (21.56%), Postives = 103/269 (38.29%), Query Frame = 1
Query: 3061 PIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQE--NNLGATPLHITCQRGFTKAIMYLIGIA-NSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLI-GLKANVNIIDKIGKKPKDYAVTANLMSLF 3855
            P+H A  +     V+ LL +  P  ++  + ++D    L+ + S     +  +L+    N ++ +  ++ G TP HI C  G  + +  L        LN   N G++ LHL   K   E+S +L+              S   K  +N  PL++A   G L +++LL   G                                      +++  D+ G TPL  ++ EG  D    L+    A  +++D  G K +D A+   +   F
Sbjct:    5 PLHQACMENEFFKVQELL-HSKP--SLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGA----------SVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKS------------------------------------AVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFF 224          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 50.0618 bits (118), Expect = 2.513e-6
Identity = 53/204 (25.98%), Postives = 91/204 (44.61%), Query Frame = 1
Query: 2410 PIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTST-VKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVG-SFEIVQLLLEYGADPFARMITGDRDGI---LPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLK 3006
            P+ +A+ N   +++  LL  G + N++ I K      P+   + N ++ST V+F     +   N      D+   LL + SK+N    ++   +   +        S     LHI A++G   +++QLL+ YGADP       + DG     P+  A  SGH E++         +   +D G + L YA     VD++  LL+
Sbjct:  462 PLVLAITNNHIDVVRDLLTIGGA-NASPIEK------PILDYSKNVISSTKVQFDPLNVACKFN----NHDAAKLLLEIRSKQNADNAKN--KSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADP------NEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQ 646          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 49.6766 bits (117), Expect = 3.103e-6
Identity = 36/106 (33.96%), Postives = 55/106 (51.89%), Query Frame = 1
Query: 2707 KCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWG--VSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGAD 3018
            K I   S   T L IA   G +++V+ ++E G      +   D  G   +H A   GH+EIV+L  + G  V++ + E  G T L  A+  G +D+++ LLK GAD
Sbjct:  322 KGIYRDSGGRTRLQIACDKGKYDVVKKMIEEGG---YDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGAD 424          

HSP 2 Score: 48.521 bits (114), Expect = 7.607e-6
Identity = 34/104 (32.69%), Postives = 58/104 (55.77%), Query Frame = 1
Query: 2824 ITGDRDGILPVHLATESGHLEIVK-LFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATD--GNRSKMLPIHMASEKGHKKSVKLLLEYGS 3126
            I  D  G   + +A + G  ++VK +  + G  ++  ++ G T LH AA  G ++I+E+L++ GADVN ++ +  G+     P+  AS  GH   VK LL+ G+
Sbjct:  324 IYRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGD----TPLIDASANGHLDVVKYLLKNGA 423          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 76.6406 bits (187), Expect = 9.452e-16
Identity = 54/171 (31.58%), Postives = 88/171 (51.46%), Query Frame = 1
Query: 2827 TGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLH---YAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGS-PINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI 3327
            T D DG  P+H AT + H++IV++  D G  V       +  +     AA   +++   +LL+AGADVN     G  +    +H A+ +GH K V+LLL  G   +N V    +RDN T+L++A       ++K L+  GAN   ++N+ G T  H+  + G  + +  L+
Sbjct:   24 TLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTA----LHHATRRGHSKMVELLLRDGQMDVNVV----DRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDND-GFTAFHLAAREGEEEVLQTLL 185          

HSP 2 Score: 62.7734 bits (151), Expect = 4.944e-11
Identity = 56/179 (31.28%), Postives = 87/179 (48.60%), Query Frame = 1
Query: 2596 NINSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVS--GKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFF-DWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYG 3123
            N+N+  +D F+ L    +  +V  VQ +L AGADV   G   + R     C   AA+  + E  ++LL  GAD       G       +H AT  GH ++V+L   D  + V+  +    T LH AA  GS  I++ LL  GA++ A+  DG        H+A+ +G ++ ++ LL  G
Sbjct:   21 NLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIIC---AAKFNAIESCRVLLRAGADVNITNCYGQ----TALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDG----FTAFHLAAREGEEEVLQTLLRTG 188          

HSP 3 Score: 60.077 bits (144), Expect = 4.655e-10
Identity = 47/164 (28.66%), Postives = 79/164 (48.17%), Query Frame = 1
Query: 2941 GLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLR 3432
            G + LHYA     VDI+++LL AGADV+   +  +  ++ PI  A++    +S ++LL  G+ +N      N    TAL+ AT      +++ L++ G       +    T LH+    G    I  L+    +++    N G ++ HL A +G  E+   LLR
Sbjct:   29 GFSPLHYATTTNHVDIVQMLLDAGADVDVRGSP-SIQRIPPIICAAKFNAIESCRVLLRAGADVNIT----NCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLL-FCGANITAKDNDGFTAFHLAAREGEEEVLQTLLR 186          

HSP 4 Score: 56.225 bits (134), Expect = 9.126e-9
Identity = 47/166 (28.31%), Postives = 78/166 (46.99%), Query Frame = 1
Query: 2518 NPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM-AGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAG 3012
            +PLH A   +    V+ L     A +++  + S      +   +K N I    VL+ AGADV+    ++     T LH A + G  ++V+LLL  G      +   DRD    +H+A   G   I+K     G +++A ++ G T  H AA  G  ++++ LL+ G
Sbjct:   31 SPLHYATTTNHVDIVQMLL-DAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVN----ITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVV---DRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRTG 188          

HSP 5 Score: 51.6026 bits (122), Expect = 3.656e-7
Identity = 47/174 (27.01%), Postives = 79/174 (45.40%), Query Frame = 1
Query: 2962 AANAGSVDIMEILLKAG-ADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFS 3480
            A   G  D +  LL+    ++N    DG      P+H A+   H   V++LL+ G+ ++ V    +   +  +  A   N     + L+++GA+ +I  N  G T LH   +RG +K +  L+      +NV      +SLH+ A  G N +   LL   C  N+T +  D F+
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADG----FSPLHYATTTNHVDIVQMLLDAGADVD-VRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNIT-NCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLL--FCGANITAKDNDGFT 167          

HSP 6 Score: 49.2914 bits (116), Expect = 1.806e-6
Identity = 25/85 (29.41%), Postives = 47/85 (55.29%), Query Frame = 2
Query:  536 DAWNPLHLVVIHDHLDCLKMLIQE-AKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            D ++PLH     +H+D ++ML+   A V +     I R   +I A +   +E+  VLL +GA+ N+ +   ++ L +A +RG ++
Sbjct:   28 DGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSK 112          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 77.0258 bits (188), Expect = 2.239e-14
Identity = 112/438 (25.57%), Postives = 180/438 (41.10%), Query Frame = 1
Query: 2671 QSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLL-----LEYGADPFARMITG-DRDGILPVHLATESGHLEIVKLFFDWGVSVSA---------------AEDC-----GLTCLHYAANAGSVDIMEILLKAGADV----------NAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTG----------ISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVK-LLVKFGA-DIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            + ++ AGAD+            T LH A   G+  + +LL     L  G    ++M+T  DR+    +HLA E GH ++ KL  + G +V+A               A +C      ++ L Y +   S  I   +L    DV           A     ++ K  P+ +A+EK H  +V+ LL++G+ I A    +N  N  +++ A +   E  M+ L        ++      T     C  G       LI +   S  + L+ G          I+ +H  A+ G       LL  K +P +        + +   + +PL+ A   GH  VVK LL + GA D   A  +       P+ CAA RG   V   LL+    +D  D+   TPLH +  EG  +  K L+  KAN+ + D  G+   D A+ ++
Sbjct:   21 KCLVEAGADLRS----LDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAA--KDINDRN--SVFRAAA---EGCMETL-----EAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALL--KRDPAI-------INDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLW------TPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESS 427          

HSP 2 Score: 69.3218 bits (168), Expect = 6.064e-12
Identity = 115/452 (25.44%), Postives = 185/452 (40.93%), Query Frame = 1
Query: 2287 NQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEIL-----LMFGSSLNSTMIL-KSVERVNPLHLAALNDLTSTVKFLTHQQSASIN-INSTRSDSFNALLTLVSKRNVIGV-------------------QSVLMAGADVS---------GKCIVSRSRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGIL-------------------PVH----------LATESGHLEIV-----KLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAG-ADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLL 3429
             Q T LHVA  +  I +AK L+ AG+++    R    E++ P+H A   G   + ++L     L  G S  S M+  +  E    LHLA         K L  ++ A++N +  +++ +F+   T+V  R  I V                   + +L+   DV            CI  R ++  T L IAA+    + V+ LL++GAD  A+ I  DR+ +                    PV           L   S  L +V     +L  D G  + +  D  +T +HYAA  G V  +  LLK   A +N E    N     P+H+A+  GH   VK LL  G  I+A  + L     T L  A +     V   L+   A  D   +    TPLH+  + G  + +  L+    +++ +  + G + L +  E  H E++  ++
Sbjct:    3 TQMTPLHVACSHGCIPVAKCLVEAGADL----RSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAK-LCLEKGANVNAVKESKNKTFHK--TIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDIN-DRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASN----TPLHLAALHGHAAVVKELLYRGGAIDARNATL----WTPLDCAAARGMVEVANILLDEDAPVD-PTDKAKTTPLHLASREGHVEMVKLLLS-RKANITLTDSAGRNCLDIAIESSHKEVAVAII 436          

HSP 3 Score: 55.8398 bits (133), Expect = 8.008e-8
Identity = 68/269 (25.28%), Postives = 115/269 (42.75%), Query Frame = 1
Query: 2194 TPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALR------NKNIAIAKELIFAGSNIHLRSRLGQGEE-VLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATC---LHIAAQVGSFEIVQLLLEYGA--DPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYA 2964
            TP+ +A E N +  +  L++HGA++      ++ +V   A           +   K +     ++ L   +G   + +L + ++ Q        +LL  G+ ++S    K+ E + P+H AA      TV  L  +  A IN     S++   L  L     V  V+ +L  G  +        +RNAT    L  AA  G  E+  +LL+  A  DP       D+    P+HLA+  GH+E+VKL      +++  +  G  CL  A
Sbjct:  182 TPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQ--------LLLDNGACIDS----KNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAV--VKELLYRGGAID-------ARNATLWTPLDCAAARGMVEVANILLDEDAPVDPT------DKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIA 423          

HSP 4 Score: 53.1434 bits (126), Expect = 5.567e-7
Identity = 74/325 (22.77%), Postives = 136/325 (41.85%), Query Frame = 1
Query: 1678 ILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGC----DKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSG--YLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNAL 2634
            +++K + L Y++F          K+ K     L       I  C ++ FR C    DK+      ++ L+++A K + + ++ LLQ+  D   KD     ++  +  +     ++  +     ++   I D+   + L  G   LI  L+  +++    +L   A  D     N+  +TPI  A +   +  +C L++    +         T LH+A  + + A+ KEL++ G  I  R+         P+  A   G+ E+  ILL   + ++ T   K+     PLHLA+       VK L  +++   NI  T S   N L
Sbjct:  130 VMIKVSKLKYLSF---------CKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKD-----KDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWT--ICDDVCLNGLVGGSNKLILVLRISSQL----LLDNGACID---SKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARN----ATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKT----TPLHLASREGHVEMVKLLLSRKA---NITLTDSAGRNCL 420          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Nematostella
Match: EDO37520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFL9])

HSP 1 Score: 78.1814 bits (191), Expect = 2.318e-14
Identity = 111/432 (25.69%), Postives = 170/432 (39.35%), Query Frame = 1
Query: 2647 SKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPF-----------ARMITGDRD------GILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYG------------SP--INAVFSRLNRDNL-----TALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSY------NISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLL-EAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKK 3813
            S   VIG    L+A    +  C+   SR  T   IAA  G   I+ +L + GA+ F            R     +D      G   +H A + GH+E VK   +  +S  A    G T +  AA  G V +ME+L K GA  +            P+  A+  GH  +V+ L + G            SP  +     +L  D       TAL+IA++  + +++ Y+++S        + LG  PLH        KA++Y                I SL    E G + LS    RC     L+    D +     Y        + L+ A   G + ++  L+++GA       F+   G Q +H AA   +  V+  L+ E  V ++  D  G TP H++V        K L  L AN++  D  G K
Sbjct:  814 SNTGVIG----LLANHFSTVDCLDRNSR--TPAFIAASTGQKNILAILFQKGANLFHVTNSLSKKHQQRAKNPVKDCKRLMCGYSLLHAAAQGGHVETVKFLLNHKLSKDAESGAGNTPMQIAAQYGRVSVMEVLHKHGAPCDPR----------PLRSAAAGGHLPAVRFLHQAGVSDECVPCKYSISPSYMKQRVGKLVDDEYLWRCETALHIASAMEQPDIVSYILRSNDTALTCYDYLGMRPLH--------KAVVY--------------NSIKSLKAFLEYGVSPLS----RCAPAEVLSTYPEDKYKNIADYFEPCICRYNALHLAARHGRVNMIATLLEYGAK---TGVFDAC-GSQAVHVAACYDQVGVLSLLVAEYKVDVNSRDLIGKTPFHYAVKCKAAGALKRLFKLGANIHAEDDEGNK 1199          

HSP 2 Score: 50.447 bits (119), Expect = 5.793e-6
Identity = 38/123 (30.89%), Postives = 60/123 (48.78%), Query Frame = 1
Query: 2692 ADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITG--DRDGILPVHLATESGHLEIVKLFF-DWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRS 3051
            AD    CI         LH+AA+ G   ++  LLEYGA       TG  D  G   VH+A     + ++ L   ++ V V++ +  G T  HYA    +   ++ L K GA+++AE  +GN++
Sbjct: 1088 ADYFEPCIC----RYNALHLAARHGRVNMIATLLEYGAK------TGVFDACGSQAVHVAACYDQVGVLSLLVAEYKVDVNSRDLIGKTPFHYAVKCKAAGALKRLFKLGANIHAEDDEGNKA 1200          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Nematostella
Match: EDO46099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR35])

HSP 1 Score: 68.1662 bits (165), Expect = 2.822e-13
Identity = 51/157 (32.48%), Postives = 82/157 (52.23%), Query Frame = 1
Query: 2743 LHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDC---GLTCLHYAANAGSVDI-MEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENR 3201
            LH AA+ G+ + ++LLL+ GA    ++    R G  P+H A  +GH E V++   +G   +A        +T LHYAA  G +D  + +L++ G D+ A   DG R     IH+AS+ G  K +  LL+ G  I    S+     LTA+++A  + +
Sbjct:    1 LHYAARYGNEKCIELLLKSGA----KLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRL----IHVASDNGRVKVLVTLLDAGVDIE---SKTYERRLTAVHVAARQGQ 146          

HSP 2 Score: 61.6178 bits (148), Expect = 6.448e-11
Identity = 51/157 (32.48%), Postives = 76/157 (48.41%), Query Frame = 1
Query: 3277 LHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHL-TVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPD-EDGLTPLHWSVIEG 3741
            LH   + G  K I  L+  + + LNVP   G   +H  A  GH E    LLR        G   ++ + KT  N++PL+ A   GHL   V++L++ G D+          G + IH A+  G+  V+ TLL+AGV I+    E  LT +H +  +G
Sbjct:    1 LHYAARYGNEKCIELLLK-SGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLR-------YGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVY----RDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQG 145          

HSP 3 Score: 61.2326 bits (147), Expect = 8.201e-11
Identity = 45/152 (29.61%), Postives = 77/152 (50.66%), Query Frame = 1
Query: 2953 LHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTAL-YIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGH 3405
            LHYAA  G+   +E+LLK+GA +N     G R    PIH A+  GH + V++LL YGS  NA   +  R N+T L Y A   + +  ++ L++ G + +    + G   +H+    G  K ++ L+       +      ++++H+ A +G 
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWR----PIHEAAMNGHTECVRMLLRYGSHANAKTGKTIR-NMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRD-GWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQ 146          

HSP 4 Score: 55.4546 bits (132), Expect = 8.021e-9
Identity = 45/163 (27.61%), Postives = 76/163 (46.63%), Query Frame = 1
Query: 2302 LHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAA-LNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQL 2787
            LH A R  N    + L+ +G+ +++  R G      PIH A  NG  E + +LL +GS  N+    K++  + PLH AA +  L   V+ L  +    I++ +   D +  +        V  + ++L AG D+  K   +  R  T +H+AA+ G   +  L
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGW----RPIHEAAMNGHTECVRMLLRYGSHANAKT-GKTIRNMTPLHYAARMGHLDCAVRMLMER---GIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESK---TYERRLTAVHVAARQGQVTMTTL 152          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Nematostella
Match: EDO34161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ63])

HSP 1 Score: 62.7734 bits (151), Expect = 7.720e-12
Identity = 34/89 (38.20%), Postives = 56/89 (62.92%), Query Frame = 1
Query: 2884 EIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGS-PINAVFS 3147
            E+VK     G   +A ++ G T LH A   G ++++++L++ GADVNA + DG R    P+H A+E GH + ++LLL YG+ P+ A ++
Sbjct:    1 EVVKQCILQGADPTAKDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIR----PLHDAAEGGHVEVLRLLLTYGADPMLATYA 85          

HSP 2 Score: 59.3066 bits (142), Expect = 1.038e-10
Identity = 34/91 (37.36%), Postives = 49/91 (53.85%), Query Frame = 1
Query: 2773 EIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGN 3045
            E+V+  +  GADP A+    D  G  P+H A   G LE+VK+   +G  V+A  + G+  LH AA  G V+++ +LL  GAD       GN
Sbjct:    1 EVVKQCILQGADPTAK----DNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGADPMLATYAGN 87          

HSP 3 Score: 53.5286 bits (127), Expect = 1.018e-8
Identity = 33/94 (35.11%), Postives = 49/94 (52.13%), Query Frame = 1
Query: 2668 VQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLT 2949
            V+  ++ GAD + K     +   T LH A   G  E+V++L++YGAD  A       DGI P+H A E GH+E+++L   +G     A   G T
Sbjct:    3 VKQCILQGADPTAK----DNAGWTPLHEACARGKLEVVKVLVQYGADVNAH----SNDGIRPLHDAAEGGHVEVLRLLLTYGADPMLATYAGNT 88          

HSP 4 Score: 47.3654 bits (111), Expect = 1.578e-6
Identity = 33/96 (34.38%), Postives = 48/96 (50.00%), Query Frame = 1
Query: 3208 VMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSY 3495
            V+K  I  GA+P   ++N G TPLH  C RG  + +  L+    + +N   N GI  LH  AE GH E+   LL    +P L      +++  T+Y
Sbjct:    2 VVKQCILQGADP-TAKDNAGWTPLHEACARGKLEVVKVLVQYG-ADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGADPMLA-----TYAGNTAY 90          

HSP 5 Score: 46.9802 bits (110), Expect = 2.696e-6
Identity = 25/59 (42.37%), Postives = 37/59 (62.71%), Query Frame = 1
Query: 3502 SPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAG 3678
            +PL++AC  G L VVK+LV++GAD++       + GI+P+H AA  G   V+  LL  G
Sbjct:   22 TPLHEACARGKLEVVKVLVQYGADVN----AHSNDGIRPLHDAAEGGHVEVLRLLLTYG 76          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 213.386 bits (542), Expect = 2.467e-55
Identity = 197/721 (27.32%), Postives = 321/721 (44.52%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVR----VLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            LHLA   K   +  +  LL  G+ +E+ T KG+T    A    + +    L+  G + NA +    S L ++A + + E++KFLL+N  + +     G T L  +  Q     +   I+  T                K    + AL      D  R    +L+   +PD++   +    TP+ +A    ++S    L+  GAN+N+    N  T LH+A R  N+ + + L+  G+ I  +++    +E+ P+H A +NG   IIEILL  G+ + +    K+   ++P+H+AA  D    V+ L                 +NA +  ++  ++                         T LH+AA  G   + ++LL+ GA   AR +    +G  P+H+A +  H+  + L      S+ A  + GLT LH AA  G ++I++ LL+ GA  NA     N     P+HMAS  GH +  + LL+  + ++A      +D+ T L+ A     + ++K L+   ANPD      G TPLHI  + G    I  L+      + +    G + LH+ ++ G  +++  LL    NPN  G+            ++PL+ A    +L VVKLLV  G   H         G  P+H AA + +  V   LL+ G S +     G+TPLH +  EG  D    LI  +ANVN+ +K G  P
Sbjct:   47 LHLAS--KEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGT----------------KGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL---SKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPK-NGITPLHIASRRGNVMMVRLLLDRGAQIDAQTK----DELTPLHCAARNGHVRIIEILLEHGAPIQA----KTKNGLSPIHMAAQGDHMDCVRQLLQ---------------YNAEIDDITLDHL-------------------------TPLHVAAHCGHHRMAKVLLDKGAKANARAL----NGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNAS----NVKVETPLHMASRAGHCEVAQFLLQNAAQVDA----RAKDDQTPLHCAARMGHKELVKLLLDHKANPD-SATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKM-TKKGFTPLHVASKYGKVDVAELLLERGANPNAAGK----------NGLTPLHVAVHHNNLDVVKLLVSKGGSAHST----ARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTP 669          

HSP 2 Score: 192.2 bits (487), Expect = 8.817e-49
Identity = 199/777 (25.61%), Postives = 354/777 (45.56%), Query Frame = 1
Query: 1240 RKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAG-----SNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLL 3555
            +++++  L+ +  N+N  + K  S L++A Q N L +V  LL  G++ ++      T L  ++Q+ H+ +  LLINYG               V+L    ++H+A    D  T   L+    N     D+L     +T  T LH+A   ++ S+     LL  G N+      G TP   A R   +    LLL RG   +A      + L  +A   +  I++ LL++      K   GL+ +H +   D    +   +      + A+IDD    H      L  A   G+      +L + A  +   ++     TP+ +A + N + +M  L++H A+L  ++  +  T LHVA    ++ I K L+  G     SN+ + +         P+H+A + G  E+ + LL   + +++    ++ +   PLH AA       VK L   ++   N +S  +     L     + ++  ++ +L AGA    + +    +  T LH+A++ G  ++ +LLLE GA+P A      ++G+ P+H+A    +L++VKL    G S  +    G T LH AA    +++  +LL+ GA  N E+  G    + P+H+AS++G    V +L+   + +N      N++ LT L++   E    +   L+K GA+     + +G TPLH+ C  G  K + +L+    + +N     G + LH  A++GH ++   LL+    PN          + TS   SPL  A   G+++V+ +L
Sbjct:   88 QEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK-----------GKVRL---PALHIAARNDDTRTAAVLLQNDPN----PDVLS----KTGFTPLHIAAHYENMSV--AQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQ-----YNAEIDDITLDHLTP---LHVAAHCGHHRMAKVLLDKGAKANARALNG---FTPLHIACKKNHMRSMDLLLKHSASLEAVTE-SGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVET---------PLHMASRAGHCEVAQFLLQNAAQVDA----RAKDDQTPLHCAARMGHKELVKLLLDHKA---NPDSATTAGHTPLHIAAREGHIHTIRILLDAGA----QQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNA----AGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQG----ITPLHLASQEGRPDMVAMLISKQANVNLG----NKNGLTPLHLVAQEGHVGIADTLVKQGAS-VYAASRMGYTPLHVACHYGNIKMVKFLLQ-QQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPN----------EITSNGTSPLGIAKRLGYISVIDVL 784          

HSP 3 Score: 176.022 bits (445), Expect = 6.760e-44
Identity = 155/569 (27.24%), Postives = 260/569 (45.69%), Query Frame = 1
Query: 2236 MCHLIRHGANLNYIS----SPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFL---------------------THQQSASI---------NINSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            +  L+ +GAN+N  S    SP     L++A +  ++ + K L+  G+N  L +  G      P+ VA+Q G + ++ +L+ +G+        K   R+  LH+AA ND T T   L                      H ++ S+         N+N T  +    L     + NV+ V+ +L  GA +  +         T LH AA+ G   I+++LLE+GA   A+     ++G+ P+H+A +  H++ V+    +   +       LT LH AA+ G   + ++LL  GA  NA A +G      P+H+A +K H +S+ LLL++ + + AV        LT L++A      N++K L++ GA+P+     +  TPLH+  + G  +   +L+  A + ++       + LH  A  GH EL   LL  K NP+            T+   +PL+ A   GH+  +++L+  GA     +     KG  P+H A+  GK  V   LLE G + +   ++GLTPLH +V     D  K L+    + +   + G  P   A   N
Sbjct:   92 VAELVNYGANVNAQSHKGFSP-----LYMAAQENHLEVVKFLLENGANQSLPTEDG----FTPLAVALQQGHENVVALLINYGT--------KGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQT----KDELTPLHCAARNGHVRIIEILLEHGAPIQAKT----KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNG----FTPLHIACKKNHMRSMDLLLKHSASLEAV----TESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKV-ETPLHMASRAGHCEVAQFLLQNA-AQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPD----------SATTAGHTPLHIAAREGHIHTIRILLDAGAQ----QVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQN 611          

HSP 4 Score: 117.857 bits (294), Expect = 4.295e-26
Identity = 97/322 (30.12%), Postives = 157/322 (48.76%), Query Frame = 1
Query: 2830 GDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNII 3795
             +++G+  +HLA++ GH+++V      G+ + A    G T LH AA AG   ++  L+  GA+VNA++  G      P++MA+++ H + VK LLE G    A  S    D  T L +A  +  ENV+  LI  G    ++   L A  LHI  +   T+    L+   + + +V   TG + LH+ A   +  ++  LL    N N T +            I+PL+ A   G++ +V+LL+  GA I      E    + P+HCAA  G   +I  LLE G  I    ++GL+P+H +      DC + L+   A ++ I
Sbjct:   39 ANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKG----FSPLYMAAQENHLEVVKFLLENG----ANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVR---LPA--LHIAARNDDTRTAAVLLQ-NDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPK----------NGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDE----LTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDI 332          

HSP 5 Score: 115.546 bits (288), Expect = 2.694e-25
Identity = 96/348 (27.59%), Postives = 160/348 (45.98%), Query Frame = 1
Query: 2863 ATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF*LSMCFFERLFYKFSCD 3906
            A  SG+L+        G++++ A   GL  LH A+  G V ++  LL +G ++ A    GN +    +H+A+  G +K V  L+ YG+ +NA     +    + LY+A  EN   V+K+L+++GAN  +   + G TPL +  Q+G    +  LI              + +LH+ A       +  LL+   NP++          KT +  +PL+ A  + +++V +LL+  GA+++    F    GI P+H A+ RG   ++  LL+ G  ID   +D LTPLH +   G     + L+   A +    K G  P   A   + M       C  + L Y    D
Sbjct:   17 AARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTA----LHIAALAGQEKVVAELVNYGANVNAQ----SHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTED-GFTPLAVALQQGHENVVALLINYGTKG-----KVRLPALHIAARNDDTRTAAVLLQNDPNPDVL--------SKTGF--TPLHIAAHYENMSVAQLLLNRGANVN----FTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMD------CVRQLLQYNAEID 330          

HSP 6 Score: 108.997 bits (271), Expect = 2.154e-23
Identity = 101/370 (27.30%), Postives = 175/370 (47.30%), Query Frame = 1
Query: 2743 LHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLI--GLKANVNIIDKIGKKPKDYAVTANLM 3846
            LH+A++ G  ++V  LL  G +    +    + G   +H+A  +G  ++V    ++G +V+A    G + L+ AA    +++++ LL+ GA+ +    DG      P+ +A ++GH+  V LL+ YG+          +  L AL+IA   +       L+++  NPD+  +  G TPLHI            L+    +++N     GI+ LH+ + +G+  +   LL      +   QI      +T   ++PL+ A   GH+ ++++L++ GA I  A+T     G+ PIH AA       +  LL+    ID+   D LTPLH +   G +   K L+  G KAN   ++  G  P   A   N M
Sbjct:   47 LHLASKEGHVKMVLELLHSGIE----LEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDG----FTPLAVALQQGHENVVALLINYGTK--------GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVL-SKTGFTPLHIAAHYENMSVAQLLLN-RGANVNFTPKNGITPLHIASRRGNVMMVRLLL------DRGAQI----DAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQ-AKT---KNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALN--GFTPLHIACKKNHM 382          

HSP 7 Score: 53.9138 bits (128), Expect = 4.713e-13
Identity = 54/218 (24.77%), Postives = 91/218 (41.74%), Query Frame = 2
Query:  179 LLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINF-PCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPV-------------ILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            LL       +L K G++ LH A    ++ +AQ L+N    N+NF P N        + P+HIA   G   ++++LL R       ++    + + P+             IL +   PI  +  N           +P+H+    DH+DC++ L+Q  A++       +   T L +A          VLL+ GA  N   ++  +PL  A K+   R
Sbjct:  190 LLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRG-ANVNFTPKNG-------ITPLHIASRRGNVMMVRLLLDRGAQ----IDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKN---------GLSPIHMAAQGDHMDCVRQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMR 383          

HSP 8 Score: 41.5874 bits (96), Expect = 4.713e-13
Identity = 82/391 (20.97%), Postives = 153/391 (39.13%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQ 1989
            +GH  IV+ LL+ GA+P     + + TPLH   +++   +      L+++A +V            R + + T ++C   +  K  V                LL ++K + +S  T    + +  LHI     ++         I ILL       +   K  + L +A +   + +   LL RG++PN      +T L  ++   +  + +LL++ G + +          +        +H+A   +  E    L+  GA+           E    +T LHLA   +    + +  L+    N+      G TP     +   +   + L+ +G    A + +  + L ++    N +++KFLLQ Q   N K   G T LH +  Q
Sbjct:  412 MGHLNIVKNLLQRGASPNASNVKVE-TPLH---MASRAGHCEVAQFLLQNAAQVDA----------RAKDDQTPLHCAARMGHKELV---------------KLLLDHKANPDSATT----AGHTPLHI---AAREGHI----HTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAH----------STARNGYTPLHIAAKQNQIEVASVLLQNGAS--------PNCESLQGITPLHLAS--QEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQ 742          

HSP 9 Score: 48.521 bits (114), Expect = 1.606e-8
Identity = 47/186 (25.27%), Postives = 76/186 (40.86%), Query Frame = 2
Query:  221 GWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            G++ LH A   NH+     L+ HS        +  ++    L P+H+A   G  +I+K LLQR  +P                             N S+  V      PLH+     H +  + L+Q A   +++R+    +T L  A  +   E V +LL+  ANP+    +  +PL  AA+ G
Sbjct:  369 GFTPLHIACKKNHMRSMDLLLKHS-------ASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASP-----------------------------NASNVKV----ETPLHMASRAGHCEVAQFLLQNA-AQVDARA-KDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREG 512          

HSP 10 Score: 31.5722 bits (70), Expect = 1.606e-8
Identity = 76/388 (19.59%), Postives = 142/388 (36.60%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNN----NGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLF---------RGCDKNAVNAI---NESGLILSA---IKKNPEIMKFLLQN 1926
            G   + E+LL+ GANP    K + +TPLH +   NN+D     ++L+ S                 G  + T  N +                      ++    + ++++ SV   +G S N     G+  L +  ++     R +++ +L++ + N+N                                 +G    +T L    Q+ H  + + L+  GA++          S +  T    +HVA  Y + +  +FL+ + A++          +     T LH A   +    + +  LL+ G      TS G +P   A R   I   ++L           R      V+ I   +E  +ILS    +++  E++ F+LQN
Sbjct:  545 GKVDVAELLLERGANPNAAGK-NGLTPLHVAVHHNNLD----VVKLLVS---------------KGGSAHSTARNGY--------------------TPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEG----RPDMVAMLISKQANVN---------------------------------LGNKNGLTPLHLVAQEGHVGIADTLVKQGASV-------YAASRMGYT---PLHVACHYGNIKMVKFLLQQQAHV--------NAKTRMGYTPLHQAA--QQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVLKLVTEESVSTHRMSFPETVDEILDVSEDEVILSLLFFLQEEAELLDFVLQN 835          

HSP 11 Score: 55.8398 bits (133), Expect = 4.105e-7
Identity = 43/187 (22.99%), Postives = 81/187 (43.32%), Query Frame = 2
Query:  218 AGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            AG + LH A    H+   + L++     +      T  G     P+H+A ++G+  + ++LL+R  NP    +                                 +   PLH+ V H++LD +K+L+  +K      +  +  T L +A +  ++E  +VLL++GA+PN   +   +PL  A++ G
Sbjct:  500 AGHTPLHIAAREGHIHTIRILLDAGAQQVKM----TKKGF---TPLHVASKYGKVDVAELLLERGANPNAAGK---------------------------------NGLTPLHVAVHHNNLDVVKLLV--SKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEG 644          

HSP 12 Score: 51.9878 bits (123), Expect = 4.983e-6
Identity = 59/223 (26.46%), Postives = 94/223 (42.15%), Query Frame = 2
Query:  131 HIAKGDCKFVKAWLHGLLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPV-ILSKSSKPIFCQKFNISDTYVLLDAWN---PLHLVVIHDHLDCLKMLI-QEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 784
            H+A    K   A L  LL          K G + LH A+  N++D+ + L++          ++ S   +   P+HIA +  +  +  +LLQ   +P  C  +   + I P+ + S+  +P            V L   N   PLHLV    H+     L+ Q A V+  SR      T L +AC    ++ V  LL+  A+ N       +PL  AA++G T
Sbjct:  539 HVASKYGKVDVAEL--LLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKG-------GSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPN-CESL---QGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGY---TPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHT 745          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 207.608 bits (527), Expect = 1.740e-53
Identity = 179/714 (25.07%), Postives = 332/714 (46.50%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            LHLA   K   ++ +  LL+ G  ++S T KG+T    +    + E    L+ RG D NA +    + L ++A + + +++++LL+N  + +     G T L  +  Q              N  ++ + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +++    L+  GA +++ +  N  T LHVA +  N  + + L+  GS I  ++R G    + P+H A ++G +  +E+LL  G+ L    + ++   ++PLH+AA  D    VK L  Q  A ++                                DV+   +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  S    +HMA+  G  + V+ LL  G+ ++A      R++ T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G  +    L+  A +S ++    G + LH+ ++ G  +++  LL+ +  P+  G+            ++PL+ A  + +  V  LL+  GA  H         G  P+H AA + +  +   LL+ G   +   + G+TPLH +  EG  D    L+   A +N+  K G
Sbjct:   84 LHLAA--KEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGH------------NQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNAD---VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR-NGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDG----LTPLHCAARSGHEASVEVLLEKGAPL----LARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVD--------------------------------DVTLDYL-------TALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETS----LHMAARAGQAEVVRCLLRNGAMVDA----RAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREGQLETASVLLE-AGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGK----------NGLTPLHVAAHYDNQKVALLLLDKGASPHTT----AKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSG 703          

HSP 2 Score: 197.978 bits (502), Expect = 1.614e-50
Identity = 192/784 (24.49%), Postives = 370/784 (47.19%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSL------------KSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGV 3681
            + +L  + ++ H  + + L++ GA ++         S+ K  N A +H++ +    E  + L+ +GA++          + +   T L++A   + N L+ + +LLE G N  + T  G TP   A++    +  ++LL    + +    +    L ++A K + +    LLQN  +++ +   G T LH           + + +    +D+   +  T + +A    N +   L            + G   L  A + G+E  V  +L++ A P L    N   ++P+ +A + + +  + HL++H A ++ ++  +  T LHVA    +  + K L+   +N + R+  G      P+H+A +    +++E+L+ +G+S+ +     +   + P+H+AA     + V  L  Q  AS ++++ R ++   +     +  V  V+ +L  GA V  +       + T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G LE   +  + G S S A   G T LH  +  GS+D+ ++LL+  A  ++   +G    + P+H+A+   ++K   LLL+ G+  +       ++  T L+IA  +N+ ++   L++ GA  +      G TPLH+  Q G       L+    + +NVP  +G+++LHL A++    ++  L+R   N             +T    +PL  AC +G+  +V  L++ GA ++ A+T  G+    P+H AA +G  H+I  LL+ G 
Sbjct:   81 LNALHLAAKEGHMDLVQELLDRGAPVD---------SSTKKGNTA-LHISSLAGQAEVVKTLVKRGADI--------NAQSQNGFTPLYMAA--QENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGA-PLLARTKNG--LSPLHMAAQGDHVECVKHLLQHKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNG----FTPLHIACKKNRVKVMELLVKYGASIQAV----TESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVSNIRGETSLHMAARAGQAEV--VRCLLRNGAMVDARA----REDQTPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNG----LTPLHVAAHYDNQKVALLLLDKGASPHTTA----KNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQ-GVTPLHLASQEGHADMAALLMS-KGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGAN----------LDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVN-AKTKNGYT---PLHQAAQQGNTHIINVLLQHGA 793          

HSP 3 Score: 144.436 bits (363), Expect = 3.864e-34
Identity = 182/737 (24.69%), Postives = 327/737 (44.37%), Query Frame = 1
Query: 1246 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH-HSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVS--------------------------RSRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGF 3303
            E++  L+    +IN  +    + L++A Q N L +V  LL  G + +       T L  ++Q+ H ++  +L+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++GA +  T            +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R     +  +LL +G    A      S L ++A   + E +K LLQ++   +      LTALH  +    +R+         T + + K   N ++ +L     ++     N + V+ +L K  A    V       +TPI +A  M  ++ +  L+++GA+ + +S+   ET LH+A R     + + L+  G+ +  R+R    E+  P+H+A + G  EI+++LL   +  ++     +     PLH++A      T   L  +  AS ++ + +   F  L  +VSK   + V  +L+   A  D +GK  ++                           ++N  T LHIAA+    +I  +LL+YGA+  A      + G+ P+HLA++ GH ++  L    G  ++     GLT LH AA    V + EIL++ GA+++ +   G      P+ +A   G+ K V  LL+ G+ +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+
Sbjct:  127 EVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA--------RNGITPLHVAS--KRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRV---------TKLLLDK-RANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAV---TESGLTPIHVAAFMGHLNIVLLLLQNGASPD-VSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAR----EDQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQLETASVLL-EAGASHSLATKKG--FTPL-HVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALT----KQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLG----YTPLIVACHYGNAKMVSFLLQNGASVNAK----TKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVN-GNTALGIARRLGY 814          

HSP 4 Score: 126.716 bits (317), Expect = 1.072e-28
Identity = 100/348 (28.74%), Postives = 177/348 (50.86%), Query Frame = 1
Query: 2752 AAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNII 3795
            AA+ G+ + V   L+ G D    + T +++G+  +HLA + GH+++V+   D G  V ++   G T LH ++ AG  ++++ L+K GAD+NA++ +G      P++MA+++ H   V+ LLE G       S    D  T L IA  +    V+  L+++     ++   L A  LHI  ++  TK+   L+   + + +V   +G + LH+ A  G+  ++  LL      + T +            I+PL+ A   G+  +V+LL+  G+ I  A+T +   G+ P+HCAA  G    +  LLE G  +    ++GL+PLH +      +C K L+  KA V+ +
Sbjct:   54 AARAGNIDKVLEYLKGGVD----ISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNG----FTPLYMAAQENHLDVVRYLLENG----GNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVR---LPA--LHIAARKDDTKSAALLLQ-NDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR----------NGITPLHVASKRGNTNMVRLLLDRGSQID-AKTRD---GLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDV 369          

HSP 5 Score: 125.561 bits (314), Expect = 2.238e-28
Identity = 93/319 (29.15%), Postives = 156/319 (48.90%), Query Frame = 1
Query: 2863 ATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI-GIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            A  +G+++ V  +   GV +S     GL  LH AA  G +D+++ LL  GA V++    GN +    +H++S  G  + VK L++ G+ INA     +++  T LY+A  EN  +V++YL+++G N      + G TPL I  Q+G  + +  L+       + +P      +LH+ A K   + +  LL+   N ++          ++    +PL+ A  +G++ V  LL+  GA +     F    GI P+H A+ RG  +++  LL+ G  ID    DGLTPLH +   G     + L+   A +    K G  P
Sbjct:   54 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTA----LHISSLAGQAEVVKTLVKRGADINA----QSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATED-GFTPLAIALQQGHNQVVSILLENDTKGKVRLP------ALHIAARKDDTKSAALLLQNDHNADV----------QSKSGFTPLHIAAHYGNVNVATLLLNRGAAV----DFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSP 343          

HSP 6 Score: 116.316 bits (290), Expect = 1.484e-25
Identity = 114/431 (26.45%), Postives = 186/431 (43.16%), Query Frame = 1
Query: 2587 ASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADI------------------HWAET-----------FEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNI 3792
              ++I++   +  NAL     + ++  VQ +L  GA V      S  +  T LHI++  G  E+V+ L++ GAD  A+     ++G  P+++A +  HL++V+   + G + S A + G T L  A   G   ++ ILL        E     + ++  +H+A+ K   KS  LLL+     NA     ++   T L+IA      NV   L+  GA  D    N G TPLH+  +RG T  +  L+    S ++     G++ LH  A  GH E S  +L  K  P L          +T   +SPL+ A    H+  VK L++  A +                  H+  T                G  P+H A  + +  V+  L++ G SI    E GLTP+H +   G  +    L+   A+ ++
Sbjct:   69 GGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDS----STKKGNTALHISSLAGQAEVVKTLVKRGADINAQ----SQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILL--------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDH--NADVQ--SKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-GITPLHVASKRGNTNMVRLLLD-RGSQIDAKTRDGLTPLHCAARSGH-EASVEVLLEKGAPLLA---------RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDV 467          

HSP 7 Score: 56.9954 bits (136), Expect = 2.002e-14
Identity = 50/201 (24.88%), Postives = 92/201 (45.77%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            K+G++ LH A    +V++A  L+N     ++F   +       + P+H+A + G T+++++LL R           + P  C      E    V+L K + P+  +  N           +PLH+    DH++C+K L+Q  K  ++  ++    TAL +A          +LL+  ANPN   ++  +PL  A K+   +
Sbjct:  239 KSGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARN------GITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGA-PLLARTKN---------GLSPLHMAAQGDHVECVKHLLQH-KAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVK 420          

HSP 8 Score: 43.1282 bits (100), Expect = 2.002e-14
Identity = 87/392 (22.19%), Postives = 161/392 (41.07%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAP--EVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNN----NGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNE-SILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH  IV +LL+ GA+P +   R + T LH +  +   + +     L+++    +    +    L I   ++  T++   + ++L+     D    N +   ++    E +++  SV    G S++     G   L ++ K     + K     LL  R    ++  KN  + L +A   +   +   LL +G+ P+       T L  + +K    +  +L+ YGA  N        L+   +T    +H+A      +    L+ KGA + +          ++ +T LHLA   + + +     L+  G N++ +T  G TP + A  Y   +  + LL  G   NA      + L  +A + N  I+  LLQ+    N     G TAL
Sbjct:  449 MGHLNIVLLLLQNGASPDVSNIRGE-TSLHMAARAGQAEVVRC---LLRNGAMVDARAREDQTPLHIA-SRLGKTEI---VQLLLQHMAHPDAATTNGYT-PLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAK-----LLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETN-------ALTKQGVT---PLHLASQEGHADMAALLMSKGAQINVP--------TKSGLTALHLAA--QEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTAL 806          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 207.223 bits (526), Expect = 1.834e-53
Identity = 179/714 (25.07%), Postives = 332/714 (46.50%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            LHLA   K   ++ +  LL+ G  ++S T KG+T    +    + E    L+ RG D NA +    + L ++A + + +++++LL+N  + +     G T L  +  Q              N  ++ + +ND+   ++   L  A +  +      +L+   + D   + +    TP+ +A    +++    L+  GA +++ +  N  T LHVA +  N  + + L+  GS I  ++R G    + P+H A ++G +  +E+LL  G+ L    + ++   ++PLH+AA  D    VK L  Q  A ++                                DV+   +       T LH+AA  G + + +LLL+  A+P AR +    +G  P+H+A +   +++++L   +G S+ A  + GLT +H AA  G ++I+ +LL+ GA  +     G  S    +HMA+  G  + V+ LL  G+ ++A      R++ T L+IA+   +  +++ L++  A+PD    N G TPLHI+ + G  +    L+  A +S ++    G + LH+ ++ G  +++  LL+ +  P+  G+            ++PL+ A  + +  V  LL+  GA  H         G  P+H AA + +  +   LL+ G   +   + G+TPLH +  EG  D    L+   A +N+  K G
Sbjct:   69 LHLAA--KEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGH------------NQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNAD---VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR-NGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDG----LTPLHCAARSGHEASVEVLLEKGAPL----LARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVD--------------------------------DVTLDYL-------TALHVAAHCGHYRVTKLLLDKRANPNARAL----NGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETS----LHMAARAGQAEVVRCLLRNGAMVDARA----REDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN-GYTPLHISAREGQLETASVLLE-AGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGK----------NGLTPLHVAAHYDNQKVALLLLDKGASPHTT----AKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSG 688          

HSP 2 Score: 197.593 bits (501), Expect = 1.687e-50
Identity = 192/784 (24.49%), Postives = 370/784 (47.19%), Query Frame = 1
Query: 1405 ITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH----------HSFIQDFRIGIDYFIHDS-TNIFIAKIDDNDSSHSL------------KSGY--LIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGV 3681
            + +L  + ++ H  + + L++ GA ++         S+ K  N A +H++ +    E  + L+ +GA++          + +   T L++A   + N L+ + +LLE G N  + T  G TP   A++    +  ++LL    + +    +    L ++A K + +    LLQN  +++ +   G T LH           + + +    +D+   +  T + +A    N +   L            + G   L  A + G+E  V  +L++ A P L    N   ++P+ +A + + +  + HL++H A ++ ++  +  T LHVA    +  + K L+   +N + R+  G      P+H+A +    +++E+L+ +G+S+ +     +   + P+H+AA     + V  L  Q  AS ++++ R ++   +     +  V  V+ +L  GA V  +       + T LHIA+++G  EIVQLLL++ A P A       +G  P+H++   G LE   +  + G S S A   G T LH  +  GS+D+ ++LL+  A  ++   +G    + P+H+A+   ++K   LLL+ G+  +       ++  T L+IA  +N+ ++   L++ GA  +      G TPLH+  Q G       L+    + +NVP  +G+++LHL A++    ++  L+R   N             +T    +PL  AC +G+  +V  L++ GA ++ A+T  G+    P+H AA +G  H+I  LL+ G 
Sbjct:   66 LNALHLAAKEGHMDLVQELLDRGAPVD---------SSTKKGNTA-LHISSLAGQAEVVKTLVKRGADI--------NAQSQNGFTPLYMAA--QENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGA-PLLARTKNG--LSPLHMAAQGDHVECVKHLLQHKAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNG----FTPLHIACKKNRVKVMELLVKYGASIQAV----TESGLTPIHVAAFMGHLNIVLLLL-QNGASPDVSNIRGETSLHMAARAGQAEV--VRCLLRNGAMVDARA----REDQTPLHIASRLGKTEIVQLLLQHMAHPDAATT----NGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNG----LTPLHVAAHYDNQKVALLLLDKGASPHTTA----KNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQ-GVTPLHLASQEGHADMAALLMS-KGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGAN----------LDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVN-AKTKNGYT---PLHQAAQQGNTHIINVLLQHGA 778          

HSP 3 Score: 144.05 bits (362), Expect = 4.880e-34
Identity = 182/737 (24.69%), Postives = 327/737 (44.37%), Query Frame = 1
Query: 1246 ELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLI-------------NYGANINENVCFDLVLSNVKLTNCAS------IHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALH-HSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLM---AGADVSGKCIVS--------------------------RSRNA-TCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGF 3303
            E++  L+    +IN  +    + L++A Q N L +V  LL  G + +       T L  ++Q+ H ++  +L+             +  A  ++     L+L N    +  S      +H+A  Y +      L+++GA +  T            +T LH+A   K  + N +  LL+ G  I++KT  G TP   A R     +  +LL +G    A      S L ++A   + E +K LLQ++   +      LTALH  +    +R+         T + + K   N ++ +L     ++     N + V+ +L K  A    V       +TPI +A  M  ++ +  L+++GA+ + +S+   ET LH+A R     + + L+  G+ +  R+R    E+  P+H+A + G  EI+++LL   +  ++     +     PLH++A      T   L  +  AS ++ + +   F  L  +VSK   + V  +L+   A  D +GK  ++                           ++N  T LHIAA+    +I  +LL+YGA+  A      + G+ P+HLA++ GH ++  L    G  ++     GLT LH AA    V + EIL++ GA+++ +   G      P+ +A   G+ K V  LL+ G+ +NA      ++  T L+ A  +   +++  L++ GA P+    N G T L I  + G+
Sbjct:  112 EVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTA--------RNGITPLHVAS--KRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRV---------TKLLLDK-RANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAV---TESGLTPIHVAAFMGHLNIVLLLLQNGASPD-VSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAR----EDQTPLHIASRLGKTEIVQLLLQHMAHPDAA----TTNGYTPLHISAREGQLETASVLL-EAGASHSLATKKG--FTPL-HVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALT----KQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLG----YTPLIVACHYGNAKMVSFLLQNGASVNAK----TKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVN-GNTALGIARRLGY 799          

HSP 4 Score: 126.716 bits (317), Expect = 9.021e-29
Identity = 100/358 (27.93%), Postives = 179/358 (50.00%), Query Frame = 1
Query: 2722 RSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNII 3795
            +S + T    AA+ G+ + V   L+ G D    + T +++G+  +HLA + GH+++V+   D G  V ++   G T LH ++ AG  ++++ L+K GAD+NA++ +G      P++MA+++ H   V+ LLE G       S    D  T L IA  +    V+  L+++     ++        LHI  ++  TK+   L+   + + +V   +G + LH+ A  G+  ++  LL      + T +            I+PL+ A   G+  +V+LL+  G+ I  A+T +   G+ P+HCAA  G    +  LLE G  +    ++GL+PLH +      +C K L+  KA V+ +
Sbjct:   29 KSDSNTSFLRAARAGNIDKVLEYLKGGVD----ISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNG----FTPLYMAAQENHLDVVRYLLENG----GNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVR-----LPALHIAARKDDTKSAALLLQ-NDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTAR----------NGITPLHVASKRGNTNMVRLLLDRGSQID-AKTRD---GLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDV 354          

HSP 5 Score: 125.561 bits (314), Expect = 1.965e-28
Identity = 93/319 (29.15%), Postives = 156/319 (48.90%), Query Frame = 1
Query: 2863 ATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI-GIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            A  +G+++ V  +   GV +S     GL  LH AA  G +D+++ LL  GA V++    GN +    +H++S  G  + VK L++ G+ INA     +++  T LY+A  EN  +V++YL+++G N      + G TPL I  Q+G  + +  L+       + +P      +LH+ A K   + +  LL+   N ++          ++    +PL+ A  +G++ V  LL+  GA +     F    GI P+H A+ RG  +++  LL+ G  ID    DGLTPLH +   G     + L+   A +    K G  P
Sbjct:   39 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTA----LHISSLAGQAEVVKTLVKRGADINA----QSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATED-GFTPLAIALQQGHNQVVSILLENDTKGKVRLP------ALHIAARKDDTKSAALLLQNDHNADV----------QSKSGFTPLHIAAHYGNVNVATLLLNRGAAV----DFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSP 328          

HSP 6 Score: 116.316 bits (290), Expect = 1.371e-25
Identity = 114/431 (26.45%), Postives = 186/431 (43.16%), Query Frame = 1
Query: 2587 ASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADI------------------HWAET-----------FEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNI 3792
              ++I++   +  NAL     + ++  VQ +L  GA V      S  +  T LHI++  G  E+V+ L++ GAD  A+     ++G  P+++A +  HL++V+   + G + S A + G T L  A   G   ++ ILL        E     + ++  +H+A+ K   KS  LLL+     NA     ++   T L+IA      NV   L+  GA  D    N G TPLH+  +RG T  +  L+    S ++     G++ LH  A  GH E S  +L  K  P L          +T   +SPL+ A    H+  VK L++  A +                  H+  T                G  P+H A  + +  V+  L++ G SI    E GLTP+H +   G  +    L+   A+ ++
Sbjct:   54 GGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDS----STKKGNTALHISSLAGQAEVVKTLVKRGADINAQ----SQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILL--------ENDTKGKVRLPALHIAARKDDTKSAALLLQNDH--NADVQ--SKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARN-GITPLHVASKRGNTNMVRLLLD-RGSQIDAKTRDGLTPLHCAARSGH-EASVEVLLEKGAPLLA---------RTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDV 452          

HSP 7 Score: 56.9954 bits (136), Expect = 2.537e-14
Identity = 50/201 (24.88%), Postives = 92/201 (45.77%), Query Frame = 2
Query:  215 KAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRN----------VNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            K+G++ LH A    +V++A  L+N     ++F   +       + P+H+A + G T+++++LL R           + P  C      E    V+L K + P+  +  N           +PLH+    DH++C+K L+Q  K  ++  ++    TAL +A          +LL+  ANPN   ++  +PL  A K+   +
Sbjct:  224 KSGFTPLHIAAHYGNVNVATLLLNRGAA-VDFTARN------GITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGA-PLLARTKN---------GLSPLHMAAQGDHVECVKHLLQH-KAPVDDVTL-DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVK 405          

HSP 8 Score: 43.1282 bits (100), Expect = 2.537e-14
Identity = 87/392 (22.19%), Postives = 161/392 (41.07%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAP--EVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNN----NGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNE-SILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTAL 1971
            +GH  IV +LL+ GA+P +   R + T LH +  +   + +     L+++    +    +    L I   ++  T++   + ++L+     D    N +   ++    E +++  SV    G S++     G   L ++ K     + K     LL  R    ++  KN  + L +A   +   +   LL +G+ P+       T L  + +K    +  +L+ YGA  N        L+   +T    +H+A      +    L+ KGA + +          ++ +T LHLA   + + +     L+  G N++ +T  G TP + A  Y   +  + LL  G   NA      + L  +A + N  I+  LLQ+    N     G TAL
Sbjct:  434 MGHLNIVLLLLQNGASPDVSNIRGE-TSLHMAARAGQAEVVRC---LLRNGAMVDARAREDQTPLHIA-SRLGKTEI---VQLLLQHMAHPDAATTNGYT-PLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAK-----LLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETN-------ALTKQGVT---PLHLASQEGHADMAALLMSKGAQINVP--------TKSGLTALHLAA--QEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTAL 791          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 186.422 bits (472), Expect = 4.582e-47
Identity = 178/692 (25.72%), Postives = 307/692 (44.36%), Query Frame = 1
Query: 1771 FLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGA----------NLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKP 3816
            FL A R   ++     +  G D N  N    + L L++ + + +++  LL N +        G TALH + +      +   ++  TN+         ++ S K    +Y     N ++VV+ L +      +   +    TP+ +A++    + +  LI +G           +  +  S    T LH+A   +N+ +A+ L+  G+N          +E+ P+H A +NG   IIEILL  G+ + +    K+   ++P+H+AA  D    VK L                 +NA +  ++  ++                         T LH+AA  G   + ++LL+ GA P +R +    +G  P+H+A +  HL ++ L      S+ A  + GLT LH A+  G ++I++ILL+ GA  +A     N     P+HMAS  GH +  + LL+  +P++A      +D+ T L+ A     + ++K L++  ANP+      G +PLHI  + G  + +  L+ +      +    G + LH+ ++ G  +++  LL    NPN  G+            ++PL+ A    +L VV LLV  G   H A       G   +H AA + +  V  +LL+ G S +     G+TPLH +  EG  D    LI  +ANVN+ +K G  P
Sbjct:   11 FLRAARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNV---------NAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDG--FTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGAN----------DELTPLHCAARNGHFRIIEILLDNGAPIQA----KTKNGLSPIHMAAQGDHMDCVKQLLQ---------------YNAEIDDITLDHL-------------------------TPLHVAAHCGHHRMAKVLLDKGAKPNSRAL----NGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSA----SNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKA----KDDQTPLHCAARMGHKELVKLLLEHKANPN-STTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKM-TKKGFTPLHVASKYGKVDVAELLLERGANPNAAGK----------NGLTPLHVAVHHNNLDVVNLLVSKGGSPHSA----ARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTP 609          

HSP 2 Score: 176.022 bits (445), Expect = 7.075e-44
Identity = 179/709 (25.25%), Postives = 322/709 (45.42%), Query Frame = 1
Query: 1666 LHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHK-GIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVN 3789
            LHLA   K   +  +  LL  G+ +E+ T KG+T    A    + +    L+  G + NA +    + L ++A + + E++KFLL+N  + +     G T L  +  Q          H++    +                    + YG +  V    +  A  D  F  +    TP+ +A    +++    L+  GAN       ++ T LH A RN +  I + L+  G+ I  +++ G    + PIH+A Q    + ++ LL + + ++      +++ + PLH+AA        K L  + +     NS   + F  L  +  K+N + V  +L+     S           T LH+A+ +G   IV++LL+ GA P A  +  +     P+H+A+ SGH E+ +        V A      T LH AA  G  +++++LL+  A+ N+  T G+     P+H+A+ +GH ++V+LLL+    + A  +++ +   T L++A+   + +V + L++ GANP+    N G TPLH+         +  L+    S  +   N G ++LH+ A++   E++  LL+   + N           ++   ++PL+ A   G   +V LL+   A+++      G+K G+ P+H  A  G   +   L++ G S+      G TPLH +   G     KFL+  +ANVN
Sbjct:   44 LHLAS--KEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQG---------HENVVALL--------------------ISYGTKGKV----RLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGAN-------DELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNG----LSPIHMAAQGDHMDCVKQLLQYNAEIDDI----TLDHLTPLHVAAHCGHHRMAKVLLDKGAKP---NSRALNGFTPL-HIACKKNHLRVMDLLLKH---SASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVE----TPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHS----PLHIAAREGHVQTVRLLLD----MEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKN-GLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARN-GYTALHIAAKQNQVEVANSLLQHGASAN----------AESLQGVTPLHLASQEGRPDIVSLLISKQANVNL-----GNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVN 666          

HSP 3 Score: 155.992 bits (393), Expect = 1.195e-37
Identity = 166/656 (25.30%), Postives = 287/656 (43.75%), Query Frame = 1
Query: 1408 TSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESK-----------TSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAG-----SNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI 3327
            T+L  +     +++   L+NYG N+N         S    T    +++A   +  E  +FL++ GAN          + + T      LA+ L+    N +  L+  G   + +           +  G TP   A  Y  +    LLL RG +         + L  +A   +  I++ LL N      K   GL+ +H +   D    +   +      + A+IDD    H      L  A   G+      +L + A P+   ++     TP+ +A + N +  M  L++H A++  ++  +  T LHVA    ++ I K L+  G     SN+ + +         P+H+A ++G  E+ E LL   + +++    K+ +   PLH AA       VK L   ++   N NST +   + L     + +V  V+ +L    D+  +      +  T LH+A++ G  ++ +LLLE GA+P A      ++G+ P+H+A    +L++V L    G S  +A   G T LH AA    V++   LL+ GA  NAE+  G    + P+H+AS++G    V LL+   + +N      N+  LT L++   E    +   L+K GA+       +G TPLH+ C  G  K + +L+
Sbjct:   75 TALHIAALAGQEQVVTELVNYGTNVNAQ-------SQKGFT---PLYMAAQENHLEVVKFLLENGAN----------QSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDEL------TPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQ-----YNAEIDDITLDHLTP---LHVAAHCGHHRMAKVLLDKGAKPNSRALNG---FTPLHIACKKNHLRVMDLLLKHSASIEAVTE-SGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVET---------PLHMASRSGHFEVAEFLLQNAAPVDA----KAKDDQTPLHCAARMGHKELVKLLLEHKA---NPNSTTTAGHSPLHIAAREGHVQTVRLLL----DMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNA----AGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQG----VTPLHLASQEGRPDIVSLLISKQANVNLG----NKSGLTPLHLVAQEGHVGIADILVKQGAS-VYAATRMGYTPLHVACHYGNIKMVKFLL 659          

HSP 4 Score: 152.91 bits (385), Expect = 9.013e-37
Identity = 153/544 (28.12%), Postives = 248/544 (45.59%), Query Frame = 1
Query: 2248 IRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSK--RNVIGVQSVLMAGADVSGK---------CIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI--GIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            I++G ++N  ++ N    LH+A +  ++ +  EL+  G  I L +   +G   L  H+A   G ++++  L+ +G+++N+    +S +   PL++AA  +    VKFL    +   N +    D F  L   + +   NV+     L+      GK         C        T LHIAA   +  + QLLL  GA+          D + P+H A  +GH  I+++  D G  + A    GL+ +H AA    +D ++ LL+     NAE  D     + P+H+A+  GH +  K+LL+ G+  N+    LN    T L+IA  +N   VM  L+K  A+ +    + G TPLH+    G    +  L+  G + S+ NV + T    LH+ +  GH E++ +LL          Q       K   + +PL+ A   GH  +VKLL++  A+ + + T  GH    P+H AA  G    +  LL+      +  + G TPLH +   G  D  + L+   AN N   K G  P   AV  N
Sbjct:   27 IKNGIDIN-TANQNGLNALHLASKEGHVKMVLELLHNG--IVLETTTKKGNTAL--HIAALAGQEQVVTELVNYGTNVNA----QSQKGFTPLYMAAQENHLEVVKFLLENGA---NQSIPTEDGFTPLAVALQQGHENVV----ALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGAN----------DELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQ----YNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNS--RALN--GFTPLHIACKKNHLRVMDLLLKHSASIEAVTES-GLTPLHVASFMGHLNIVKILLQKGASPSASNVKVET---PLHMASRSGHFEVAEFLL----------QNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPN-STTTAGHS---PLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHN 518          

HSP 5 Score: 48.521 bits (114), Expect = 4.182e-12
Identity = 51/213 (23.94%), Postives = 88/213 (41.31%), Query Frame = 2
Query:  179 LLYESTGWQLLDKAGWSILHDAIILNHVDIAQHLINHSLMN-INFPCNSTS---IGLHNLRPIHIACEFGRTSILKMLLQRNVNPEL-----CMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQ-EAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGETR 787
            LL       +  + G++ L  A+   H ++   LI++     +  P  +     + +    P+HIA  +   ++ ++LL R  N EL             +IE  IL  +  PI  +  N           +P+H+    DH+DC+K L+Q  A++       +   T L +A          VLL+ GA PN   ++  +PL  A K+   R
Sbjct:  125 LLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIE--ILLDNGAPIQAKTKN---------GLSPIHMAAQGDHMDCVKQLLQYNAEI---DDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLR 323          

HSP 6 Score: 43.5134 bits (101), Expect = 4.182e-12
Identity = 80/377 (21.22%), Postives = 149/377 (39.52%), Query Frame = 1
Query:  817 IGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQK 1947
            +GH  IV++LL+ GA+P     + + TPLH +  S + +   A   L  +AP     K            + T ++C   +  K  V                LL E+K + NS  T    + ++ LHI     ++       + + +LL       +   K  + L +A +   + +   LL RG++PN      +T L  ++   +  +  LL++ G + +          +       ++H+A   +  E    L+  GA+           E    VT LHLA   +    + ++ L+    N+      G TP     +   +   ++L+ +G    A   +  + L ++    N +++KFLLQ Q + N K
Sbjct:  352 MGHLNIVKILLQKGASPSASNVKVE-TPLHMASRSGHFE--VAEFLLQNAAPVDAKAKD-----------DQTPLHCAARMGHKELV---------------KLLLEHKANPNSTTT----AGHSPLHI---AAREGHV----QTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPH----------SAARNGYTALHIAAKQNQVEVANSLLQHGASA--------NAESLQGVTPLHLAS--QEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSK 668          

HSP 7 Score: 70.0922 bits (170), Expect = 1.673e-11
Identity = 104/459 (22.66%), Postives = 178/459 (38.78%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNL------AATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLR-------KELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGI-DYFIHDSTNIFIAKIDDNDSSHSLKSGY--LIYALQYGNEIDVVRVLKQ 2148
            GH  + +VLL  GA P      +  TPLH +C  N++  +      +A+I+ +  +       +S +  +N  +I   K        +K    L     + H +   +LL        +   VD  + ++            Q PL        KEL+ +LL H+ N N T +   S L +A +                   G  Q +  L+  ++ +  KMT+                             +HVA  Y   +  + L+++GAN             +  +T LH+A+    N+L+ +N L+  G +  S    G T    A + +++E  N LL  G   NA +    + L L++ +  P+I+  L+  Q + N  +  GLT L H   Q+  +GI D  +    +++ A           + GY  L  A  YGN I +V+ L Q
Sbjct:  287 GHHRMAKVLLDKGAKPN-SRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLL-------QNAAPVDAKAKDD------------QTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAARE------------------GHVQTV-RLLLDMEAQQTKMTK------------------------KGFTPLHVASKYGKVDVAELLLERGAN--------PNAAGKNGLTPLHVAV--HHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPL-HLVAQEGHVGIADILVKQGASVYAAT----------RMGYTPLHVACHYGN-IKMVKFLLQ 660          

HSP 8 Score: 52.373 bits (124), Expect = 3.801e-6
Identity = 50/195 (25.64%), Postives = 87/195 (44.62%), Query Frame = 2
Query:  239 DAIILNHVD---IAQHLINHSLMNI--NFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSEL----------IEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            D I L+H+    +A H  +H +  +  +      S  L+   P+HIAC+     ++ +LL+ + + E   E   + L          I  ++L K + P        S + V ++   PLH+     H +  + L+Q A   +++++    +T L  A  +   E V +LLE  ANPN    +  SPL  AA+ G
Sbjct:  270 DDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASP--------SASNVKVE--TPLHMASRSGHFEVAEFLLQNA-APVDAKAK-DDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREG 452          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Medaka
Match: ankrd52a (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101155432])

HSP 1 Score: 158.303 bits (399), Expect = 1.133e-38
Identity = 214/909 (23.54%), Postives = 360/909 (39.60%), Query Frame = 1
Query: 1231 FPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFL-AVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANA----------------------GSVDIMEILLKAGAD-----------VNAEATDGNRSKM--------------------LPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLI--GIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDE----DGLTPLHWSVIEGFYDCTKFLIGLK 3777
            F    E + +LL    ++N  + +  + L  A  +  + ++  L+  G+  N+     +T L  +   R+++   LL+  GA  N    F              +HVA         + L+   +NL    ++ D     T  T LH A   +S     +  LL  G N+ +   K   P   A     +E   LLL R  DK+  + +  + L  +A   + EI+K+LL+   + ++ + +G TALH                                          A   G E     ++   A+   V   N    TP+ L AV  N    +  L+ +GA++N   S   ++ LH+A  +     ++ LI  G +I    + G      P+HVA + G + +I  L+  G+        + +  + PLHLA L   +   + L                S   L ++VS    +  + VL AG +++      R    TCLH AA  G+ E + LLL  GAD   R I G      P+H A  +G  +        G  V+ ++  G T LHY+A +                      GS   +E LL +GAD           V+  A  GN+  +                     P+H+A++ GH ++++LL E  + ++      +    + LY+A  +     ++ L+  GA+  + +N L  TP+H+    G +  +  +I  G      NV    G + L L    GH +   +LL    +P       D+  K+ S   + L++A   GH   V  L+K  A     +     +G  P+H AA RG+  ++ +L++A V+ D  D+       TPLHW+  +G  DC + L+ LK
Sbjct:   17 FSRNAEEVQLLLHKTEDVNALDQERRTPLHAAACVGDVHIIDLLIESGASVNVKDQVWLTPLHRAAASRNERAVSLLLRRGAEANARDKFWQT----------PLHVASANRATRCAEALLSHLSNL----NIADR----TGRTALHHAA--QSGFQEMVKLLLNKGANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDKLGYTPLHAAAASGHIEIVKYLLRMGAEIDEPNTFGNTALH-----------------------------------------MACYMGQEAVATELVNHGAN---VNQPNKCGYTPLHLAAVSTNGALCLELLVNNGADVNQ-QSKEGKSPLHMAAIHGRFTRSQILIQNGGDIDCVDKYGN----TPLHVAAKYGHELLISTLMTNGAD----TARRGIHGMFPLHLAVLYGFSDCCRKLL---------------SSGQLYSIVSS---MSKEHVLSAGFEINTPDNFGR----TCLHAAASGGNVECLNLLLSSGADLNKRDIMGR----TPLHYAAANGRYQCTVTLVSAGAEVNESDQTGCTPLHYSAASQAFGRVERHFSGNHQKEEEEEKGSYFCLEHLLDSGADPSMVNSKGYSAVHYAAYHGNKQNLELLLEMSFNALGDIESSIPVSPLHLAADNGHWQALRLLTETAAYVDMQ----DAAGRSVLYLAAQKGHVRCVEVLLAQGASCFLNDNRLMWTPIHVAAANGHSDCLRMMIDYGEEGDLTNVADKFGQTPLMLAVLGGHTDCVRFLLERASSP-------DAQDKRGS---TALHRAAVLGHDDCVTALLKHKASPLCRDI----QGRTPLHYAASRGQTEILSSLMQAAVAADPQDQLLDNKQYTPLHWAAYKGHEDCLEVLLELK 808          

HSP 2 Score: 154.836 bits (390), Expect = 1.566e-37
Identity = 200/838 (23.87%), Postives = 343/838 (40.93%), Query Frame = 1
Query: 1552 ALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQ--ETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVA-VQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLAT------------ESGHLEIV------KLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPIN----------------AVFSRLNRDNLTALYIATSENREN---VMKYLIKSGANPDIQ----------------------------------ENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGAD---IHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVT 3834
            A+   + E  Q L+ K  +    V+ LD+       T LH A  +    ++ I+ L+E G ++  K     TP   A       A +LLL RG + NA +   ++ L +++  +     + LL +  + N  D  G TALHH+    F+  +   ++   N+  + ID        K    I+   Y   ++VV++L   ++       + +  TP+  A     I  + +L+R GA    I  PN    T LH+A      A+A EL+  G+N++  ++ G      P+H+A V       +E+L+  G+ +N     +S E  +PLH+AA++      +F             TRS                  Q ++  G D+     V +  N T LH+AA+ G   ++  L+  GAD   R I     G+ P+HLA              SG L  +      +     G  ++  ++ G TCLH AA+ G+V+ + +LL +GAD+N     G      P+H A+  G  +    L+  G+ +N                  F R+ R + +  +    E  +     +++L+ SGA+P +                                   E+++  +PLH+    G  +A+  L   A + +++    G S L+L A+KGH          +C   L  Q    F        +P++ A   GH   +++++ +G +    + A+ F    G  P+  A + G    +  LLE   S D  D+ G T LH + + G  DC   L+  KA+    D  G+ P  YA +
Sbjct:   15 AIFSRNAEEVQLLLHKTED----VNALDQERR----TPLHAAACV--GDVHIIDLLIESGASVNVKDQVWLTPLHRAAASRNERAVSLLLRRGAEANARDKFWQTPLHVASANRATRCAEALLSHLSNLNIADRTGRTALHHAAQSGFQEMVKLLLNKGANL--SAIDK-------KERQPIHCAAYLGHLEVVKLLLSRSNDK--SCKDKLGYTPLHAAAASGHIEIVKYLLRMGAE---IDEPNTFGNTALHMACYMGQEAVATELVNHGANVNQPNKCG----YTPLHLAAVSTNGALCLELLVNNGADVNQ----QSKEGKSPLHMAAIHG-----RF-------------TRS------------------QILIQNGGDID---CVDKYGN-TPLHVAAKYGHELLISTLMTNGADTARRGI----HGMFPLHLAVLYGFSDCCRKLLSSGQLYSIVSSMSKEHVLSAGFEINTPDNFGRTCLHAAASGGNVECLNLLLSSGADLNKRDIMGR----TPLHYAAANGRYQCTVTLVSAGAEVNESDQTGCTPLHYSAASQAFGRVER-HFSGNHQKEEEEEKGSYFCLEHLLDSGADPSMVNSKGYSAVHYAAYHGNKQNLELLLEMSFNALGDIESSIPVSPLHLAADNGHWQALRLLTETA-AYVDMQDAAGRSVLYLAAQKGH---------VRCVEVLLAQGASCFLNDNRLMWTPIHVAAANGHSDCLRMMIDYGEEGDLTNVADKF----GQTPLMLAVLGGHTDCVRFLLERASSPDAQDKRGSTALHRAAVLGHDDCVTALLKHKASPLCRDIQGRTPLHYAAS 757          

HSP 3 Score: 131.339 bits (329), Expect = 2.447e-30
Identity = 137/501 (27.35%), Postives = 226/501 (45.11%), Query Frame = 1
Query: 2398 EEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIAT-SENRENVMKYLIKSGANPDIQENNLGATPLHITCQRG-FTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGA------------------DIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTAN 3840
            E   P+H A   G   II++L+  G+S+N    +K    + PLH AA +     V  L  ++ A  N    R   +   L + S          L++   +S   I  R+   T LH AAQ G  E+V+LLL  GA+    +   D+    P+H A   GHLE+VKL        S  +  G T LH AA +G ++I++ LL+ GA+++   T GN +    +HMA   G +     L+ +G+ +N    + N+   T L++A  S N    ++ L+ +GA+ + Q++  G +PLH+    G FT++ + +       ++     G + LH+ A+ GH  L   L+         G  T   +++  + + PL+ A  +G     + L+  G                   +I+  + F    G   +H AA  G    +  LL +G  +++ D  G TPLH++   G Y CT  L+   A VN  D+ G  P  Y+  + 
Sbjct:   40 ERRTPLHAAACVGDVHIIDLLIESGASVN----VKDQVWLTPLHRAAASRNERAVSLLL-RRGAEAN---ARDKFWQTPLHVASANRATRCAEALLS--HLSNLNIADRT-GRTALHHAAQSGFQEMVKLLLNKGAN----LSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDKLGYTPLHAAAASGHIEIVKYLLRMGAEIDEPNTFGNTA----LHMACYMGQEAVATELVNHGANVN----QPNKCGYTPLHLAAVSTNGALCLELLVNNGADVN-QQSKEGKSPLHMAAIHGRFTRSQILIQN--GGDIDCVDKYGNTPLHVAAKYGHELLISTLM-------TNGADT---ARRGIHGMFPLHLAVLYGFSDCCRKLLSSGQLYSIVSSMSKEHVLSAGFEINTPDNF----GRTCLHAAASGGNVECLNLLLSSGADLNKRDIMGRTPLHYAAANGRYQCTVTLVSAGAEVNESDQTGCTPLHYSAASQ 500          

HSP 4 Score: 119.783 bits (299), Expect = 9.576e-27
Identity = 200/895 (22.35%), Postives = 368/895 (41.12%), Query Frame = 1
Query: 1243 KELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLI-----------YALQYGNEIDVVRVL-KQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAK----------ELIFAGSNIHLRSRLGQGEE--------VLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSR-NATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAE----------------DC-----------------GLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQ-ENNLGATPLHITCQRGFTK--AIMYLIGIANSSLNVPLNTGISSLHLTAEKGHN-ELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEG-HKGIQ-PIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTP 3717
            +E++ +LL    N++  + K    +  A  L  L +V  LL R +D +       T L  +    H ++ + L+  GA I+E   F             ++H+A     +     L++ GAN+         +  +   T LHLA +  + +L  +  L+  G ++  ++ +G +P   A  + +     +L+  G D + V+    + L ++A   +  ++  L+ N  D+ ++  +G+  LH + +  F       +  S+    + +      H L +G+ I           +A   G  ++ + +L    AD +   I   +  TP+  A           L+  GA +N  S     T LH +  ++     +          E    GS   L   L  G +           +H A  +G  + +E+LL    S N+   ++S   V+PLHLAA N     ++ LT + +A +++      S   L     K +V  V+ +L  GA     C ++ +R   T +H+AA  G  + ++++++YG +     +  D+ G  P+ LA   GH + V+   +   S  A +                DC                 G T LHYAA+ G  +I+  L++A    + +    +  +  P+H A+ KGH+  +++LLE  +     F     +  T L+ A      +  + L++S     I   +  G +PLH      F +  A + L+    + +N   N+G S+L + A+KGH+  ++  L R K +  L  +     +K T+     L+ AC   H     L++    +IH        +  +Q P+H AA  G   V+  LL  G ++   DE+G TP
Sbjct:  153 QEMVKLLLNKGANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDKLGYTPLHAAAASGHIEIVKYLLRMGAEIDEPNTF----------GNTALHMACYMGQEAVATELVNHGANV--------NQPNKCGYTPLHLAAVSTNGAL-CLELLVNNGADVNQQSKEGKSPLHMAAIHGRFTRSQILIQNGGDIDCVDKYGNTPLHVAAKYGHELLISTLMTNGADTARRGIHGMFPLHLAVLYGFSDCCRKLL--SSGQLYSIVSSMSKEHVLSAGFEINTPDNFGRTCLHAAASGGNVECLNLLLSSGADLNKRDI---MGRTPLHYAAANGRYQCTVTLVSAGAEVNE-SDQTGCTPLHYSAASQAFGRVERHFSGNHQKEEEEEKGSYFCLEHLLDSGADPSMVNSKGYSAVHYAAYHGNKQNLELLLEM--SFNALGDIESSIPVSPLHLAADNGHWQALRLLT-ETAAYVDMQDAAGRSV--LYLAAQKGHVRCVEVLLAQGA----SCFLNDNRLMWTPIHVAAANGHSDCLRMMIDYGEEGDLTNVA-DKFGQTPLMLAVLGGHTDCVRFLLERASSPDAQDKRGSTALHRAAVLGHDDCVTALLKHKASPLCRDIQGRTPLHYAASRGQTEILSSLMQAAVAADPQDQLLDNKQYTPLHWAAYKGHEDCLEVLLELKT-----FIHEEGNPFTPLHCALMNGHCSAAERLLESARVHVINCRDAKGRSPLHAA---AFAEDVAGLQLVLRHGAEINAVDNSGRSALMVAADKGHSGTVAILLHRAKADLTLLDE-----NKNTA-----LHLACSKAHEMCALLIL---GEIHSPTLINATNSALQMPLHLAARNGLATVVQALLSRGATVLAVDEEGHTP 991          

HSP 5 Score: 53.1434 bits (126), Expect = 2.151e-6
Identity = 53/209 (25.36%), Postives = 85/209 (40.67%), Query Frame = 2
Query:  179 LLYESTGW-QLLDKAGWSILHDAIILNHVDIAQHLINHSLMNINFPCNSTSIGLHNLR----PIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKV--FIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGET 784
            LL E+  +  + D AG S+L+ A    HV   + L+              S  L++ R    PIH+A   G +  L+M++      +L                           N++D +       PL L V+  H DC++ L++ A      + R   +   A +L  + C    V  LL+  A+P   DI  ++PL YAA RG+T
Sbjct:  597 LLTETAAYVDMQDAAGRSVLYLAAQKGHVRCVEVLL----------AQGASCFLNDNRLMWTPIHVAAANGHSDCLRMMIDYGEEGDLT--------------------------NVADKF----GQTPLMLAVLGGHTDCVRFLLERASSPDAQDKRGSTALHRAAVLGHDDC----VTALLKHKASPLCRDIQGRTPLHYAASRGQT 761          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Planmine SMEST
Match: SMESG000004641.1 (SMESG000004641.1)

HSP 1 Score: 1986.07 bits (5144), Expect = 0.000e+0
Identity = 990/1012 (97.83%), Postives = 993/1012 (98.12%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF 3855
            GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNG                KELIDILLAHRININETNSKNESILFLAVQLNLLGLV+NLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKN +IMK LLQNQVD NQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGA+PDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF
Sbjct:  161 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNG----------------KELIDILLAHRININETNSKNESILFLAVQLNLLGLVNNLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGADPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF 1156          

HSP 2 Score: 332.028 bits (850), Expect = 6.799e-95
Identity = 160/161 (99.38%), Postives = 160/161 (99.38%), Query Frame = 2
Query:  296 MNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            MNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSS PIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG
Sbjct:    1 MNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSTPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 161          

HSP 3 Score: 51.6026 bits (122), Expect = 4.498e-6
Identity = 137/631 (21.71%), Postives = 252/631 (39.94%), Query Frame = 1
Query: 2137 VLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKN----------IAIAKELIFAGSNIHLRSRLGQ--------------GEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGAD-----PFARMITGDR-DGILPVHLATESGHLEIVKLFFDWGVSVSAAED--------CGLTCLHYAA--NAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLT------AEKGHNELS-FWLLRCKCNPNLTG-----QITDSF-----------------SKKTSYNISP-----LNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDE----PDEDGLTPLHWSVIEGFYDCTKFLIGLK-ANVNI 3792
            +L+  A+P++  I N    +P+F A +    + +  L+++GAN    +  +Q T LH +  + N          I  A E+++  S+  L    GQ                 V    V     + +I  +L  +   +NS   +  V   N   L  +         L H+    ININ T S + + L   V    +  V ++L+ G+D +    + R++  T L  + Q    ++ +LL+ YGA+      F  +++  +      +H+A      E  +   D G ++    D          +T LH A    + S++ +  LL+ G ++ ++ + G+     P   A      ++  LLL  G   NAV    N  N + L ++  +   ++MK L+++  + + Q++N G T LH +  + F   I Y I  + +     ++   SS  L       A +  NE+    +L+   +P+L        +T  F                     +Y  SP     L+ A    ++ + K L+  G++IH        + + PIH A   G   +I  LL  G S++        + + PLH + +       KFL   + A++NI
Sbjct:  136 LLESGANPNVCDISNK---SPLFYAAKRGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDI--------LLAHR----ININETNSKNESILFLAVQLNLLGLVNNLLIRGSDPN----IGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDT----PFLFAIRYSKIEACNLLLFRGCDKNAV----NAINESGLILSAIKKNHDIMKCLLQNQVDLN-QKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASINI 738          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Planmine SMEST
Match: SMESG000004641.1 (SMESG000004641.1)

HSP 1 Score: 1948.71 bits (5047), Expect = 0.000e+0
Identity = 972/996 (97.59%), Postives = 976/996 (97.99%), Query Frame = 1
Query:  820 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNG                KELIDILLAHRININETNSKNESILFLAVQLNLLGLV+NLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKN +IMK LLQNQVD NQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGA+PDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDK+ 
Sbjct:  161 GHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNG----------------KELIDILLAHRININETNSKNESILFLAVQLNLLGLVNNLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGADPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKLA 1140          

HSP 2 Score: 332.028 bits (850), Expect = 5.816e-95
Identity = 160/161 (99.38%), Postives = 160/161 (99.38%), Query Frame = 2
Query:  296 MNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 778
            MNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSS PIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG
Sbjct:    1 MNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSTPIFCQKFNISDTYVLLDAWNPLHLVVIHDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRG 161          

HSP 3 Score: 82.8037 bits (203), Expect = 1.592e-15
Identity = 198/920 (21.52%), Postives = 372/920 (40.43%), Query Frame = 1
Query: 1489 NVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVE--------------------TNVTL-----LHLAILLKSNSLNYINFLL-EMGLNIESKTS-KGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSN-QKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRV-------LKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCH---------------LIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNST----MILKSVERVN--PLHLAALNDLTSTVKFLTHQQS---ASININSTRSDSFNALL---TLVSKRNVIG-VQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLH-----------------------------------------YAANAGS-VDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLG----ATPLHITCQRGFTKAIMYLIGIA---NSSLNVPLNTGISSLHLTAEKG-HNELSFWLLRCKCNPNLTGQITDSF-------SKKT----------------------SYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHK-GIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPK 3819
            N+ F    +++ L N   IH+A  +      + L+ +  N  L ++++    +E                    T V L     LHL ++   + L+ +  L+ E  + IES++     T  + A    ++E  N+LL  G + N  +  N+S L  +A + +  I++ LL+   +       + +T LH S I +          D+    I  I         KS   +  +  G +I+  +V       LK A   D V  + ++      L+     I+++C                L+ H  N+N  +S N E++L +A++   + +   L+  GS+      +G+ + +  +  ++Q    ++ E+L+ +G+++N      ++L +V+  N   +H+A +     T +FL  + +    ++++   R    N  L    ++ K N +  +  +L  G ++  K     S+  T    A +    E   LLL  G D  A     +   IL    A +  H +I+K      V ++  ++ GLT LH                                         YA   G+ +D++ +L K  AD +      N + M PI +A E     ++  L+ +G+ +N + S  N++  T L++A       + K LI +G+N  ++ + LG      P+H+  Q G  + I  L+      NS++ +     ++ LHL A     + + F   +   + N+    +DSF       SK+                       S N + L+ A   G   +V+LL+++GAD  +A    G + GI P+H A   G   ++    + GVS+   ++ GLT LH++   G  D  + L+   A+VN     G + K
Sbjct:    2 NINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSTPIFCQKFNISDTYVLLDAWNPLHLVVI--HDHLDCLKMLIQEAKVFIESRSIISRKTALILACELCRLETVNVLLESGANPNVCDISNKSPLFYAAKRGHDTIVEVLLKYGANPRIGTKRHQITPLHASCISNNI--------DNLAATIQLIKSAPEVVYWKSS-CVLEINRG-QINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGKELIDILLAHRININETNSKN-ESILFLAVQLNLLGLVNNLLIRGSD----PNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESK----TSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS---AIKKNH-DIMKCLLQNQVDLNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVT-MTPIFLAVEMNSISNMCHLIRHGANLNYI-SSPNQE--TVLHVALRNKNIAIAKELIFAGSNIHLR-SRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGAD-PFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSK 889          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Planmine SMEST
Match: SMESG000004641.1 (SMESG000004641.1)

HSP 1 Score: 1771.9 bits (4588), Expect = 0.000e+0
Identity = 885/907 (97.57%), Postives = 888/907 (97.91%), Query Frame = 1
Query: 1135 EYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF 3855
            EYKVDINSVCTVDGVSNNNG                KELIDILLAHRININETNSKNESILFLAVQLNLLGLV+NLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKN +IMK LLQNQVD NQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGA+PDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF
Sbjct:    3 EYKVDINSVCTVDGVSNNNG----------------KELIDILLAHRININETNSKNESILFLAVQLNLLGLVNNLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGADPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPKDYAVTANLMSLF 893          

HSP 2 Score: 52.373 bits (124), Expect = 2.713e-6
Identity = 130/601 (21.63%), Postives = 239/601 (39.77%), Query Frame = 1
Query:  844 LLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLM--IVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPN----IGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDT----PFLFAIRYSKIEACNLLLFRGCDKNAV----NAINESGLILSAIKKNPEIMKFLLQNQVDSN-QKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASINI 2601
            L+++GAN    +  +Q T LH +  + N          I  A E+++  S+  L    GQ                 V    V     + +I  +L  +   +NS   +  V   N LH+  +  +    +F   ++      +  ININ T S + + L   V    +  V ++L+ G+D +    + R++  T L  + Q    ++ +LL+ YGA+      F  +++  +      +H+A      E  +   D G ++    D          +T LH A    + S++ +  LL+ G ++ ++ + G+     P   A      ++  LLL  G   NAV    N  N + L ++  +    +MK+L+++  D + Q++N G T LH +  + F   I Y I  + +     ++   SS  L       A +  NE+    +L+   +P+L        +T  F                     +Y  SP     L+ A    ++ + K L+  G++IH        + + PIH A   G   +I  LL  G S++        + + PLH + +       KFL   + A++NI
Sbjct:  357 LIRHGANLNYISSPNQETVLHVALRNKN----------IAIAKELIFAGSNIHLRSRLGQ--------------GEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQ------SASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGAD-----PFARMITGDR-DGILPVHLATESGHLEIVKLFFDWGVSVSAAED--------CGLTCLHYAA--NAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGADPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLT------AEKGHNELS-FWLLRCKCNPNLTG-----QITDSF-----------------SKKTSYNISP-----LNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDE----PDEDGLTPLHWSVIEGFYDCTKFLIGLK-ANVNI 872          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Planmine SMEST
Match: SMESG000004641.1 (SMESG000004641.1)

HSP 1 Score: 1734.54 bits (4491), Expect = 0.000e+0
Identity = 867/891 (97.31%), Postives = 871/891 (97.76%), Query Frame = 1
Query: 1135 EYKVDINSVCTVDGVSNNNGLHILLMIVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNPEIMKFLLQNQVDSNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIG 3807
            EYKVDINSVCTVDGVSNNNG                KELIDILLAHRININETNSKNESILFLAVQLNLLGLV+NLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKN +IMK LLQNQVD NQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGA+PDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDK+ 
Sbjct:    3 EYKVDINSVCTVDGVSNNNG----------------KELIDILLAHRININETNSKNESILFLAVQLNLLGLVNNLLIRGSDPNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILSAIKKNHDIMKCLLQNQVDLNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGADPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLTAEKGHNELSFWLLRCKCNPNLTGQITDSFSKKTSYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKLA 877          

HSP 2 Score: 80.1073 bits (196), Expect = 9.209e-15
Identity = 139/618 (22.49%), Postives = 260/618 (42.07%), Query Frame = 1
Query: 2245 LIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNST----MILKSVERVN--PLHLAALNDLTSTVKFLTHQQS---ASININSTRSDSFNALL---TLVSKRNVIG-VQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGADPFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLH-----------------------------------------YAANAGS-VDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGANPDIQENNLG----ATPLHITCQRGFTKAIMYLIGIA---NSSLNVPLNTGISSLHLTAEKG-HNELSFWLLRCKCNPNLTGQITDSF-------SKKT----------------------SYNISPLNQACGFGHLTVVKLLVKFGADIHWAETFEGHK-GIQPIHCAAIRGKYHVIPTLLEAGVSIDEPDEDGLTPLHWSVIEGFYDCTKFLIGLKANVNIIDKIGKKPK 3819
            L+ H  N+N  +S N E++L +A++   + +   L+  GS+      +G+ + +  +  ++Q    ++ E+L+ +G+++N      ++L +V+  N   +H+A +     T +FL  + +    ++++   R    N  L    ++ K N +  +  +L  G ++  K     S+  T    A +    E   LLL  G D  A     +   IL    A +  H +I+K      V ++  ++ GLT LH                                         YA   G+ +D++ +L K  AD +      N + M PI +A E     ++  L+ +G+ +N + S  N++  T L++A       + K LI +G+N  ++ + LG      P+H+  Q G  + I  L+      NS++ +     ++ LHL A     + + F   +   + N+    +DSF       SK+                       S N + L+ A   G   +V+LL+++GAD  +A    G + GI P+H A   G   ++    + GVS+   ++ GLT LH++   G  D  + L+   A+VN     G + K
Sbjct:   29 LLAHRININETNSKN-ESILFLAVQLNLLGLVNNLLIRGSD----PNIGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKT----SKGDTPFLFAIRYSKIEACNLLLFRGCDKNAVNAINESGLILS---AIKKNH-DIMKCLLQNQVDLNQKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVL-KQAADPDLVFIHNNVT-MTPIFLAVEMNSISNMCHLIRHGANLNYI-SSPNQE--TVLHVALRNKNIAIAKELIFAGSNIHLR-SRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGAD-PFARMITGDRDGILPVHLATESGHLEIVKLFFDWGVSVSAAEDCGLTCLHYAANAGSVDIMEILLKAGADVNAEATDGNRSK 626          

HSP 3 Score: 52.7582 bits (125), Expect = 1.859e-6
Identity = 130/601 (21.63%), Postives = 239/601 (39.77%), Query Frame = 1
Query:  844 LLKYGANPRIGTKRHQITPLHASCISNNIDNLAATIQLIKSAPEVVYWKSSCVLEINRGQINCTKVNCFLLVILKSAVCLDDVQFNCHIKKINYLLSEYKVDINSVCTVDGVSNNNGLHILLM--IVKKFQFPLRKELIDILLAHRININETNSKNESILFLAVQXXXXXXXXXXXIRGSDPN----IGRNQPITSLMFSIQKRHKKMTELLINYGANINENVCFDLVLSNVKLTNCASIHVALIYSDQETFQFLIDKGANLFLTVDLLDEREVETNVTLLHLAILLKSNSLNYINFLLEMGLNIESKTSKGDT----PFLFAIRYSKIEACNLLLFRGCDKNAV----NAINESGLILSAIKKNPEIMKFLLQNQVDSN-QKDNYGLTALHHSFIQDFRIGIDYFIHDSTNIFIAKIDDNDSSHSLKSGYLIYALQYGNEIDVVRVLKQAADPDLVFIHNNVTMTPIFLAVEMNSISNMCHLIRHGANLNYISSPNQETVLHVALRNKNIAIAKELIFAGSNIHLRSRLGQGEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQSASINI 2601
            L+++GAN    +  +Q T LH +  + N          I  A E+++  S+  L    GQ                 V    V     + +I  +L  +   +NS   +  V   N LH+  +  +    +F   ++      +  ININ T S + + L   V    +  V ++L+ G+D +    + R++  T L  + Q    ++ +LL+ YGA+      F  +++  +      +H+A      E  +   D G ++    D          +T LH A    + S++ +  LL+ G ++ ++ + G+     P   A      ++  LLL  G   NAV    N  N + L ++  +    +MK+L+++  D + Q++N G T LH +  + F   I Y I  + +     ++   SS  L       A +  NE+    +L+   +P+L        +T  F                     +Y  SP     L+ A    ++ + K L+  G++IH        + + PIH A   G   +I  LL  G S++        + + PLH + +       KFL   + A++NI
Sbjct:  357 LIRHGANLNYISSPNQETVLHVALRNKN----------IAIAKELIFAGSNIHLRSRLGQ--------------GEEVLPIHVAVQNGLDEIIEILLMFGSSLNSTMILKSVERVNPLHLAALNDLTSTVKFLTHQQ------SASININSTRSDSFNALLTLVSKRNVIGVQSVLMAGADVSGKCIVSRSRNATCLHIAAQVGSFEIVQLLLEYGAD-----PFARMITGDR-DGILPVHLATESGHLEIVKLFFDWGVSVSAAED--------CGLTCLHYAA--NAGSVDIMEILLKAGADVNAEATDGNRSKMLPIHMASEKGHKKSVKLLLEYGSPINAVFSRLNRDNLTALYIATSENRENVMKYLIKSGADPDIQENNLGATPLHITCQRGFTKAIMYLIGIANSSLNVPLNTGISSLHLT------AEKGHNELS-FWLLRCKCNPNLTG-----QITDSF-----------------SKKTSYNISP-----LNQACGFGHLTVVKLLVKFGADIHWAETFEGHKGIQPIHCAAIRGKYHVIPTLLEAGVSIDE----PDEDGLTPLHWSVIEGFYDCTKFLIGLK-ANVNI 872          
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Planmine SMEST
Match: SMESG000004641.1 (SMESG000004641.1)

HSP 1 Score: 181.415 bits (459), Expect = 2.397e-53
Identity = 87/88 (98.86%), Postives = 87/88 (98.86%), Query Frame = 2
Query:  296 MNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSKPIFCQKFNISDTYVLLDAWNPLHL 559
            MNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSS PIFCQKFNISDTYVLLDAWNPLHL
Sbjct:    1 MNINFPCNSTSIGLHNLRPIHIACEFGRTSILKMLLQRNVNPELCMEVIKSELIEPVILSKSSTPIFCQKFNISDTYVLLDAWNPLHL 88          
The following BLAST results are available for this feature:
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK24.215e-5425.03ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK26.704e-5326.28ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.258e-5225.10ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.260e-5225.10ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.261e-5225.10ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-441.200e-4824.52AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.200e-4824.52AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-447.182e-4524.26AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-447.182e-4524.26AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-449.884e-4524.26AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank26.686e-5126.70gene:FBgn0261788 transcript:FBtr0344224[more]
Ank26.764e-5126.70gene:FBgn0261788 transcript:FBtr0303125[more]
Ank21.900e-5026.70gene:FBgn0261788 transcript:FBtr0303121[more]
Ank22.154e-5026.70gene:FBgn0261788 transcript:FBtr0303117[more]
Ank22.179e-5026.70gene:FBgn0261788 transcript:FBtr0303124[more]
back to top
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a2.930e-5626.49ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b7.196e-5125.66ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b1.867e-4926.23ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b2.725e-4925.23ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b3.144e-4925.89ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm43.942e-5325.24tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm44.704e-5325.24tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm45.217e-5325.24tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm46.477e-5325.10tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm47.355e-5325.24tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank23.725e-5224.83ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank23.108e-5125.38ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank24.095e-5126.24ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank35.058e-5124.27ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank25.125e-5125.38ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
back to top
BLAST of Ankyrin repeat and SOCS box containing 14b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01484|ANK2_HUMAN6.091e-5225.10Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=... [more]
sp|Q8C8R3|ANK2_MOUSE2.600e-5124.83Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV... [more]
sp|G5E8K5|ANK3_MOUSE9.924e-5024.27Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|Q12955|ANK3_HUMAN2.434e-4924.69Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|O70511|ANK3_RAT6.904e-4924.38Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
back to top
BLAST of Ankyrin repeat and SOCS box containing 14b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DXP04.673e-3040.13ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A267ELS23.877e-3040.13ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267E6009.310e-3040.13ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A1I8HIL93.415e-14241.79ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A1I8G7H13.691e-9836.58ANK_REP_REGION domain-containing protein OS=Macros... [more]
back to top
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b3.599e-5526.78ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1a1.009e-5426.50ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3a6.576e-5223.76ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ENSAMXT00000017800.21.374e-5125.07pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ank3b3.836e-5123.85ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
back to top
BLAST of Ankyrin repeat and SOCS box containing 14b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5