U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein

Overview
NameU4/U6 X U5 tri-snRNP complex subunit Prp4 family protein
Smed IDSMED30031203
Length (bp)1567
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein (SMED30031203) t-SNE clustered cells

Violin plots show distribution of expression levels for U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein (SMED30031203) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein (SMED30031203) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein (SMED30031203) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031203

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031203h1SMcG0019100 SmedASXL_014358SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30031203h1SMcG0019100 SmedASXL_014358SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior sideSMED30031203h1SMcG0019100 dd_Smed_v4_3433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30031203h1SMcG0019100 dd_Smed_v4_3433_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Human
Match: TAF5 (TATA-box binding protein associated factor 5 [Source:HGNC Symbol;Acc:HGNC:11539])

HSP 1 Score: 105.916 bits (263), Expect = 2.004e-23
Identity = 54/161 (33.54%), Postives = 83/161 (51.55%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICG-TDAGLIEW 1301
            L+GHS  V    F+   + +L+SS DG++R+W+ +T   +  Y  + +P+WD   +P     F SG  D    LW      P+R   GHL  +    F+ + NY+ +G  D  VRLWD+  GNCVR++    G   I ++ FS  G  +  G TD  ++ W
Sbjct:  539 LYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGP--IHSLTFSPNGRFLATGATDGRVLLW 696          

HSP 2 Score: 66.2402 bits (160), Expect = 8.355e-11
Identity = 43/151 (28.48%), Postives = 68/151 (45.03%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            GH   V   +F   S+ + T S D ++R+W+   G  +  +T +  PI  +  +P      A+GA DG V LWD      V ++ GH  ++ ++ F + G  + SG  D  VRLWD          E  D +     +   E   E++ GT
Sbjct:  625 GHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPN-GRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAI--KAFEDLETDDFTTATGHINLPENSQELLLGT 772          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Human
Match: TAF5L (TATA-box binding protein associated factor 5 like [Source:HGNC Symbol;Acc:HGNC:17304])

HSP 1 Score: 100.523 bits (249), Expect = 9.651e-22
Identity = 57/161 (35.40%), Postives = 83/161 (51.55%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEW 1301
            L GH   V S +F + S  +L+ S D SIR W+  +  +   Y  +A+P+WD+  +P     FASG+ D +  LW   R  P+R   GHL  +  V F+ + NY+ +G  D  VRLW  + GN VRL+    G   + ++AFS  G  +   G D  L  W
Sbjct:  338 LRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISP-YSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGP--VLSLAFSPNGKYLASAGEDQRLKLW 495          

HSP 2 Score: 67.3958 bits (163), Expect = 2.886e-11
Identity = 40/132 (30.30%), Postives = 63/132 (47.73%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGS 1223
            GH   V  V+F   S+ + T S D ++R+W+ + G S+  +T +  P+  +A +P      AS   D  + LWD       +++ GH  +I ++ F      + S   D  VR+WDIR   C      ADGS
Sbjct:  424 GHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPN-GKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIRNTYCS---APADGS 551          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Human
Match: TAF5L (TATA-box binding protein associated factor 5 like [Source:HGNC Symbol;Acc:HGNC:17304])

HSP 1 Score: 100.523 bits (249), Expect = 9.651e-22
Identity = 57/161 (35.40%), Postives = 83/161 (51.55%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEW 1301
            L GH   V S +F + S  +L+ S D SIR W+  +  +   Y  +A+P+WD+  +P     FASG+ D +  LW   R  P+R   GHL  +  V F+ + NY+ +G  D  VRLW  + GN VRL+    G   + ++AFS  G  +   G D  L  W
Sbjct:  338 LRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISP-YSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGP--VLSLAFSPNGKYLASAGEDQRLKLW 495          

HSP 2 Score: 67.3958 bits (163), Expect = 2.886e-11
Identity = 40/132 (30.30%), Postives = 63/132 (47.73%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGS 1223
            GH   V  V+F   S+ + T S D ++R+W+ + G S+  +T +  P+  +A +P      AS   D  + LWD       +++ GH  +I ++ F      + S   D  VR+WDIR   C      ADGS
Sbjct:  424 GHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPN-GKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNSVRVWDIRNTYCS---APADGS 551          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Human
Match: DAW1 (dynein assembly factor with WD repeats 1 [Source:HGNC Symbol;Acc:HGNC:26383])

HSP 1 Score: 84.3445 bits (207), Expect = 8.049e-17
Identity = 56/189 (29.63%), Postives = 93/189 (49.21%), Query Frame = 3
Query:  741 DRSWDRAVFGRENGTVVV--ADLSGVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACF-------ASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            + S DR + G  + TVVV  AD     + L GH   ++S  F      ILT S+D + ++W+   G  + T T +   I        +D+CF       A+ + DG+  ++ A     + K+ GH G I  + F   GN++++G  D   R+WD +TG C+++ E    +  I + AF+  GN +I G+
Sbjct:  228 NTSGDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEI--------LDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGH--TDEIFSCAFNYKGNIVITGS 406          

HSP 2 Score: 63.929 bits (154), Expect = 2.741e-10
Identity = 39/130 (30.00%), Postives = 67/130 (51.54%), Query Frame = 3
Query:  816 SSLFGHSMMVTSVQFTSQ-SDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRL 1202
            ++L GH  +V ++ F +   D+I T S D + ++W+ ETG    T+  +   I  ++ NP+     A+G+ D +  LWD      V  + GH   I ++ F  SG+ +++G  D  V +WD  TG  V +
Sbjct:  128 NTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQ-STLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNI 256          

HSP 3 Score: 58.5362 bits (140), Expect = 1.639e-8
Identity = 39/161 (24.22%), Postives = 71/161 (44.10%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT-DAGLIEW 1301
            L  H + +T+V         +T S D + ++W+  +G  + T   +   ++ IA N       A+G+FD +  LW            GH   I  + F      + +G  D   +LWDI+ G    ++     S  I +++F+ +G+ II G+ D  ++ W
Sbjct:   88 LKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGE--EVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVW 246          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Human
Match: GNB4 (G protein subunit beta 4 [Source:HGNC Symbol;Acc:HGNC:20731])

HSP 1 Score: 80.8777 bits (198), Expect = 5.741e-16
Identity = 52/158 (32.91%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH+  ++  +F   S QI+TSS D +  +W+ ET     T+T ++  +  ++ +P +   F SGA D S  LWD       +   GH+  I AV F+ +G    +G DD   RL+D+R    + L+   +   GI +VAFS++G  ++ G D
Sbjct:  135 VSRELPGHTGYLSCCRFLDDS-QIVTSSGDTTCALWDIETAQQTTTFTGHSGDVMSLSLSPDMRT-FVSGACDASSKLWDIRDGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYD 290          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Celegans
Match: gpb-1 (Guanine nucleotide-binding protein subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:P17343])

HSP 1 Score: 81.2629 bits (199), Expect = 1.419e-16
Identity = 53/158 (33.54%), Postives = 80/158 (50.63%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH+  ++  +F    +QI+TSS D +  +W+ ETG     +T +   +  ++ +P     F SGA D S  LWD       +   GH   I AV F+ SGN   +G DD   RL+DIR    + ++   +   GI +VAFS++G  +  G D
Sbjct:  135 VSRELPGHTGYLSCCRFLDD-NQIVTSSGDMTCALWDIETGQQCTAFTGHTGDVMSLSLSPDFRT-FISGACDASAKLWDIRDGMCKQTFPGHESDINAVAFFPSGNAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLFAGYD 290          

HSP 2 Score: 50.0618 bits (118), Expect = 2.037e-6
Identity = 30/114 (26.32%), Postives = 46/114 (40.35%), Query Frame = 3
Query: 1026 DGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIEWMGIEGSARVPLHLEETISNIVC 1367
            D +  LWD           GH G + ++         +SG  D   +LWDIR G C + +   +    I AVAF  +GN    G+D        I     + ++  +   NI+C
Sbjct:  163 DMTCALWDIETGQQCTAFTGHTGDVMSLSLSPDFRTFISGACDASAKLWDIRDGMCKQTFPGHESD--INAVAFFPSGNAFATGSDDATCRLFDIRADQELAMYSHD---NIIC 271          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Celegans
Match: gpb-1 (Guanine nucleotide-binding protein subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:P17343])

HSP 1 Score: 81.2629 bits (199), Expect = 1.419e-16
Identity = 53/158 (33.54%), Postives = 80/158 (50.63%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH+  ++  +F    +QI+TSS D +  +W+ ETG     +T +   +  ++ +P     F SGA D S  LWD       +   GH   I AV F+ SGN   +G DD   RL+DIR    + ++   +   GI +VAFS++G  +  G D
Sbjct:  135 VSRELPGHTGYLSCCRFLDD-NQIVTSSGDMTCALWDIETGQQCTAFTGHTGDVMSLSLSPDFRT-FISGACDASAKLWDIRDGMCKQTFPGHESDINAVAFFPSGNAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLFAGYD 290          

HSP 2 Score: 50.0618 bits (118), Expect = 2.037e-6
Identity = 30/114 (26.32%), Postives = 46/114 (40.35%), Query Frame = 3
Query: 1026 DGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIEWMGIEGSARVPLHLEETISNIVC 1367
            D +  LWD           GH G + ++         +SG  D   +LWDIR G C + +   +    I AVAF  +GN    G+D        I     + ++  +   NI+C
Sbjct:  163 DMTCALWDIETGQQCTAFTGHTGDVMSLSLSPDFRTFISGACDASAKLWDIRDGMCKQTFPGHESD--INAVAFFPSGNAFATGSDDATCRLFDIRADQELAMYSHD---NIIC 271          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Celegans
Match: taf-5 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:G5EF68])

HSP 1 Score: 75.485 bits (184), Expect = 3.989e-14
Identity = 48/160 (30.00%), Postives = 80/160 (50.00%), Query Frame = 3
Query:  798 DLSGVSSSL--FGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII 1271
            DL G ++S+   GH   V SV F+     +++S+ D ++R+W+ ET  +   Y   A  +W      R    FA+ + D +  +W   R +P+R      G +  + ++ + NY+  G DD  VR+WD+ +G  VR++     S  I AV FS  G  I+
Sbjct:  380 DLQGSTTSVRYTGHGGPVFSVNFSPDRRLLISSAGDRTVRLWSMETQRNAVIYRTPAV-VWQAQFCSR-GYYFATASADKTAAMWSTDRMHPLRIFADPYGDVGCIDYHPNCNYIAGGSDDRYVRVWDVCSGTRVRIFSGHKAS--IIAVKFSPCGRYIV 535          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Celegans
Match: taf-5 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:G5EF68])

HSP 1 Score: 75.485 bits (184), Expect = 3.989e-14
Identity = 48/160 (30.00%), Postives = 80/160 (50.00%), Query Frame = 3
Query:  798 DLSGVSSSL--FGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII 1271
            DL G ++S+   GH   V SV F+     +++S+ D ++R+W+ ET  +   Y   A  +W      R    FA+ + D +  +W   R +P+R      G +  + ++ + NY+  G DD  VR+WD+ +G  VR++     S  I AV FS  G  I+
Sbjct:  380 DLQGSTTSVRYTGHGGPVFSVNFSPDRRLLISSAGDRTVRLWSMETQRNAVIYRTPAV-VWQAQFCSR-GYYFATASADKTAAMWSTDRMHPLRIFADPYGDVGCIDYHPNCNYIAGGSDDRYVRVWDVCSGTRVRIFSGHKAS--IIAVKFSPCGRYIV 535          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Celegans
Match: taf-5 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:G5EF68])

HSP 1 Score: 75.485 bits (184), Expect = 3.989e-14
Identity = 48/160 (30.00%), Postives = 80/160 (50.00%), Query Frame = 3
Query:  798 DLSGVSSSL--FGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII 1271
            DL G ++S+   GH   V SV F+     +++S+ D ++R+W+ ET  +   Y   A  +W      R    FA+ + D +  +W   R +P+R      G +  + ++ + NY+  G DD  VR+WD+ +G  VR++     S  I AV FS  G  I+
Sbjct:  380 DLQGSTTSVRYTGHGGPVFSVNFSPDRRLLISSAGDRTVRLWSMETQRNAVIYRTPAV-VWQAQFCSR-GYYFATASADKTAAMWSTDRMHPLRIFADPYGDVGCIDYHPNCNYIAGGSDDRYVRVWDVCSGTRVRIFSGHKAS--IIAVKFSPCGRYIV 535          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Fly
Match: Taf5 (gene:FBgn0010356 transcript:FBtr0088240)

HSP 1 Score: 105.531 bits (262), Expect = 1.423e-23
Identity = 74/252 (29.37%), Postives = 122/252 (48.41%), Query Frame = 3
Query:  789 VVADLSG-VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT-DAGLIEWMGIEGS-ARVPLHLEETISNIVCHQKDRVIAST-INGGLYLLDQTRLVSRQCENQFSRIINIQKQSDQGNQ-ALILREF 1529
            ++ D SG V+ SL GH+  V    F  + + +L+ S D +IR+W+  T   + TY  + +P+WD+   P     F S ++D +  LW       +R  +GHL  +  V F+ + NY+ +G  D  VRLWD  TG  VRL     GS  + ++AFS  G  +  G+ D  +I W    GS     L    T++ I   +   V+A+  ++  L L D  ++     E+  S  I +    D+ ++   ++R F
Sbjct:  434 MLDDRSGEVTRSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRFAPH-GYYFVSCSYDKTARLWATDSNQALRVFVGHLSDVDCVQFHPNSNYVATGSSDRTVRLWDNMTGQSVRLMTGHKGS--VSSLAFSACGRYLASGSVDHNIIIWDLSNGSLVTTLLRHTSTVTTITFSRDGTVLAAAGLDNNLTLWDFHKVT----EDYISNHITVSHHQDENDEDVYLMRTF 678          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0331597)

HSP 1 Score: 79.7221 bits (195), Expect = 6.838e-16
Identity = 51/158 (32.28%), Postives = 81/158 (51.27%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH   ++  +F    +QI+TSS D S  +W+ ETG+ + ++  +   +  ++  P+    F SGA D S  LWD       +   GH   I AV F+ +G    +G DD   RL+DIR    + ++   +   GI +VAFS++G  ++ G D
Sbjct:  135 VSRELPGHGGYLSCCRFLDD-NQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQCKT-FVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYD 290          

HSP 2 Score: 48.521 bits (114), Expect = 8.697e-6
Identity = 34/123 (27.64%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  816 SSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGH---LGSIKAVLFYKSGNYMVSGGDDGQVRLWD 1175
            +S  GH+  V ++    Q    ++ + D S ++W+   GV  +T+  +   I  +   P   A FA+G+ D +  L+D  R +    M  H   +  I +V F KSG  +++G DD    +WD
Sbjct:  178 TSFLGHTGDVMALSLAPQCKTFVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQA-FATGSDDATCRLFDI-RADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWD 298          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0074110)

HSP 1 Score: 79.7221 bits (195), Expect = 6.838e-16
Identity = 51/158 (32.28%), Postives = 81/158 (51.27%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH   ++  +F    +QI+TSS D S  +W+ ETG+ + ++  +   +  ++  P+    F SGA D S  LWD       +   GH   I AV F+ +G    +G DD   RL+DIR    + ++   +   GI +VAFS++G  ++ G D
Sbjct:  135 VSRELPGHGGYLSCCRFLDD-NQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQCKT-FVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYD 290          

HSP 2 Score: 48.521 bits (114), Expect = 8.697e-6
Identity = 34/123 (27.64%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  816 SSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGH---LGSIKAVLFYKSGNYMVSGGDDGQVRLWD 1175
            +S  GH+  V ++    Q    ++ + D S ++W+   GV  +T+  +   I  +   P   A FA+G+ D +  L+D  R +    M  H   +  I +V F KSG  +++G DD    +WD
Sbjct:  178 TSFLGHTGDVMALSLAPQCKTFVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQA-FATGSDDATCRLFDI-RADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWD 298          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0074108)

HSP 1 Score: 79.7221 bits (195), Expect = 6.838e-16
Identity = 51/158 (32.28%), Postives = 81/158 (51.27%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH   ++  +F    +QI+TSS D S  +W+ ETG+ + ++  +   +  ++  P+    F SGA D S  LWD       +   GH   I AV F+ +G    +G DD   RL+DIR    + ++   +   GI +VAFS++G  ++ G D
Sbjct:  135 VSRELPGHGGYLSCCRFLDD-NQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQCKT-FVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYD 290          

HSP 2 Score: 48.521 bits (114), Expect = 8.697e-6
Identity = 34/123 (27.64%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  816 SSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGH---LGSIKAVLFYKSGNYMVSGGDDGQVRLWD 1175
            +S  GH+  V ++    Q    ++ + D S ++W+   GV  +T+  +   I  +   P   A FA+G+ D +  L+D  R +    M  H   +  I +V F KSG  +++G DD    +WD
Sbjct:  178 TSFLGHTGDVMALSLAPQCKTFVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQA-FATGSDDATCRLFDI-RADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWD 298          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Fly
Match: Gbeta13F (gene:FBgn0001105 transcript:FBtr0074107)

HSP 1 Score: 79.7221 bits (195), Expect = 6.838e-16
Identity = 51/158 (32.28%), Postives = 81/158 (51.27%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH   ++  +F    +QI+TSS D S  +W+ ETG+ + ++  +   +  ++  P+    F SGA D S  LWD       +   GH   I AV F+ +G    +G DD   RL+DIR    + ++   +   GI +VAFS++G  ++ G D
Sbjct:  135 VSRELPGHGGYLSCCRFLDD-NQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQCKT-FVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYD 290          

HSP 2 Score: 48.521 bits (114), Expect = 8.697e-6
Identity = 34/123 (27.64%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  816 SSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGH---LGSIKAVLFYKSGNYMVSGGDDGQVRLWD 1175
            +S  GH+  V ++    Q    ++ + D S ++W+   GV  +T+  +   I  +   P   A FA+G+ D +  L+D  R +    M  H   +  I +V F KSG  +++G DD    +WD
Sbjct:  178 TSFLGHTGDVMALSLAPQCKTFVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQA-FATGSDDATCRLFDI-RADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWD 298          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Zebrafish
Match: taf5 (TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-051120-180])

HSP 1 Score: 109.383 bits (272), Expect = 9.912e-25
Identity = 59/167 (35.33%), Postives = 86/167 (51.50%), Query Frame = 3
Query:  804 SGVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICG-TDAGLIEW 1301
            S  S  L GHS  V  V F+   + +L+SS DG+IR+W+ +T   +  Y  + +P+WD   +P     F SG  D    LW      P+R   GHL  +    F+ + NY+ +G  D  VRLWD+  GNCVR++    G   I ++AFS  G  +  G TD  ++ W
Sbjct:  489 SSESKILHGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVGYKGHNYPVWDTQFSP-FGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYVATGSSDRTVRLWDVLNGNCVRIFTGHKGP--IHSLAFSPNGKFLASGSTDGRVLLW 652          

HSP 2 Score: 75.485 bits (184), Expect = 6.454e-14
Identity = 46/151 (30.46%), Postives = 73/151 (48.34%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            GH   VT  +F   S+ + T S D ++R+W+   G  +  +T +  PI  +A +P      ASG+ DG V LWD      + ++ GH G+I A+ F + G  + SG  D  VRLWD+     +   E  D +     +   +   E++ GT
Sbjct:  581 GHLADVTCTRFHPNSNYVATGSSDRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPN-GKFLASGSTDGRVLLWDIGHGLMIAELKGHTGTIYALKFSRDGEIIASGSIDNTVRLWDVM--RAIDDVETDDFTAATGHIHLPDNSQELLLGT 728          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Zebrafish
Match: taf5l (TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-5987])

HSP 1 Score: 90.8929 bits (224), Expect = 7.669e-19
Identity = 50/162 (30.86%), Postives = 81/162 (50.00%), Query Frame = 3
Query:  819 SLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEW 1301
            +L GHS  V    F + +  +L+ S D ++R W+ ++  +   Y  +A+P+WD+  +P     F++ + D +  LW   R  P+R   GHL  +  V F+ + NY+ +G  D  VRLW  + G  VRL+    G   +  +AFS  G  +   G D  L  W
Sbjct:  349 TLRGHSGPVYRTAFLTDASGLLSCSEDSTVRYWDLKSFTNTVLYRGHAYPVWDVDVSP-CSLYFSTASHDRTARLWSFARTYPLRLYAGHLSDVDCVKFHPNSNYIATGSTDKTVRLWSTQQGASVRLFTGHRGP--VLTLAFSPNGKYLASAGEDQRLKLW 507          

HSP 2 Score: 59.6918 bits (143), Expect = 5.367e-9
Identity = 36/121 (29.75%), Postives = 60/121 (49.59%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGN 1190
            GH   V  V+F   S+ I T S D ++R+W+ + G S+  +T +  P+  +A +P      AS   D  + LWD       + + GH  +I ++ F +  + + S   D  VR+WDIR  +
Sbjct:  436 GHLSDVDCVKFHPNSNYIATGSTDKTVRLWSTQQGASVRLFTGHRGPVLTLAFSPN-GKYLASAGEDQRLKLWDLASGGLFKDLRGHTDTISSLSFSQDSSLVASASMDNTVRVWDIRNAH 555          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Zebrafish
Match: gnb4b (guanine nucleotide binding protein (G protein), beta polypeptide 4b [Source:ZFIN;Acc:ZDB-GENE-041114-167])

HSP 1 Score: 81.6481 bits (200), Expect = 1.864e-16
Identity = 50/158 (31.65%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            V+  L GH+  ++  +F    +QI+TSS D +  +W+ ETG    ++T +   +  ++ +P     F SGA D S  LWD       +   GH+  I AV F+ +GN   +G DD   RL+D+R    + ++   +   GI +VAFS++G  ++ G D
Sbjct:  135 VNRELAGHTGYLSCCRFLDD-NQIITSSGDTTCALWDIETGQQTTSFTGHTGDVMSLSVSPDSKT-FVSGACDASAKLWDIRDGMCRQSFTGHVSDINAVCFFPNGNAFTTGSDDATCRLFDLRADQELMMYTHDNIICGITSVAFSKSGRLLLAGYD 290          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Zebrafish
Match: gnb1a (guanine nucleotide binding protein (G protein), beta polypeptide 1a [Source:NCBI gene;Acc:322104])

HSP 1 Score: 80.4925 bits (197), Expect = 5.229e-16
Identity = 53/159 (33.33%), Postives = 83/159 (52.20%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRK-MIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH+  ++  +F    +QI+TSS D +  +W+ ETG    T+  +   +  ++  P     F SGA D S  LWD  RE   R+   GH   I A+ F+ +GN   +G DD   RL+D+R    + ++   +   GI +VAFS++G  ++ G D
Sbjct:  135 VSRELAGHTGYLSCCRFLDD-NQIVTSSGDTTCALWDIETGQQTTTFAGHTGDVMSLSLAPDTRL-FVSGACDASAKLWDV-REGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYD 290          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Zebrafish
Match: gnb1a (guanine nucleotide binding protein (G protein), beta polypeptide 1a [Source:NCBI gene;Acc:322104])

HSP 1 Score: 80.4925 bits (197), Expect = 5.229e-16
Identity = 53/159 (33.33%), Postives = 83/159 (52.20%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRK-MIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH+  ++  +F    +QI+TSS D +  +W+ ETG    T+  +   +  ++  P     F SGA D S  LWD  RE   R+   GH   I A+ F+ +GN   +G DD   RL+D+R    + ++   +   GI +VAFS++G  ++ G D
Sbjct:  135 VSRELAGHTGYLSCCRFLDD-NQIVTSSGDTTCALWDIETGQQTTTFAGHTGDVMSLSLAPDTRL-FVSGACDASAKLWDV-REGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYD 290          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Xenopus
Match: myadm (myeloid-associated differentiation marker [Source:Xenbase;Acc:XB-GENE-966240])

HSP 1 Score: 108.227 bits (269), Expect = 3.900e-24
Identity = 59/185 (31.89%), Postives = 94/185 (50.81%), Query Frame = 3
Query:  753 DRAVFGRENGTVVVADLSGVSSS----LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLI 1295
            D ++  +E+  V+   +   SSS    L+GHS  V +  F+   + +L+SS DG+IR+W+ +T   +  Y  + +P+WD   +P     F SG  D    LW      P+R   GHL  +    F+ + NY+ +G  D  VRLWD+  GNCVR++    G   I ++AF+  G  +  G   G +
Sbjct:  483 DLSIIDKESDDVLERIMDEKSSSEMKVLYGHSGPVYATSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVICTRFHPNSNYIATGSTDRTVRLWDVLNGNCVRIFTGHKGP--IHSLAFTPNGKFLATGASDGRV 664          

HSP 2 Score: 72.0182 bits (175), Expect = 1.273e-12
Identity = 46/151 (30.46%), Postives = 70/151 (46.36%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            GH   V   +F   S+ I T S D ++R+W+   G  +  +T +  PI  +A  P      A+GA DG V LWD      V ++ GH  ++ A+ F + G  + SG  D  VRLWD  T       +  D +     + F E   +++ GT
Sbjct:  596 GHLADVICTRFHPNSNYIATGSTDRTVRLWDVLNGNCVRIFTGHKGPIHSLAFTPN-GKFLATGASDGRVLLWDIGHGLMVGELKGHTNTVYALRFSRDGEILSSGSMDNTVRLWD--TVKAFEDLDTDDFTSSAGHINFHENSQDLLLGT 743          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Xenopus
Match: myadm (myeloid-associated differentiation marker [Source:Xenbase;Acc:XB-GENE-966240])

HSP 1 Score: 107.457 bits (267), Expect = 6.973e-24
Identity = 59/185 (31.89%), Postives = 94/185 (50.81%), Query Frame = 3
Query:  753 DRAVFGRENGTVVVADLSGVSSS----LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLI 1295
            D ++  +E+  V+   +   SSS    L+GHS  V +  F+   + +L+SS DG+IR+W+ +T   +  Y  + +P+WD   +P     F SG  D    LW      P+R   GHL  +    F+ + NY+ +G  D  VRLWD+  GNCVR++    G   I ++AF+  G  +  G   G +
Sbjct:  489 DLSIIDKESDDVLERIMDEKSSSEMKVLYGHSGPVYATSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVICTRFHPNSNYIATGSTDRTVRLWDVLNGNCVRIFTGHKGP--IHSLAFTPNGKFLATGASDGRV 670          

HSP 2 Score: 71.2478 bits (173), Expect = 2.081e-12
Identity = 46/151 (30.46%), Postives = 70/151 (46.36%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            GH   V   +F   S+ I T S D ++R+W+   G  +  +T +  PI  +A  P      A+GA DG V LWD      V ++ GH  ++ A+ F + G  + SG  D  VRLWD  T       +  D +     + F E   +++ GT
Sbjct:  602 GHLADVICTRFHPNSNYIATGSTDRTVRLWDVLNGNCVRIFTGHKGPIHSLAFTPN-GKFLATGASDGRVLLWDIGHGLMVGELKGHTNTVYALRFSRDGEILSSGSMDNTVRLWD--TVKAFEDLDTDDFTSSAGHINFHENSQDLLLGT 749          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Xenopus
Match: myadm (myeloid-associated differentiation marker [Source:Xenbase;Acc:XB-GENE-966240])

HSP 1 Score: 106.686 bits (265), Expect = 1.018e-23
Identity = 59/185 (31.89%), Postives = 94/185 (50.81%), Query Frame = 3
Query:  753 DRAVFGRENGTVVVADLSGVSSS----LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLI 1295
            D ++  +E+  V+   +   SSS    L+GHS  V +  F+   + +L+SS DG+IR+W+ +T   +  Y  + +P+WD   +P     F SG  D    LW      P+R   GHL  +    F+ + NY+ +G  D  VRLWD+  GNCVR++    G   I ++AF+  G  +  G   G +
Sbjct:  462 DLSIIDKESDDVLERIMDEKSSSEMKVLYGHSGPVYATSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVICTRFHPNSNYIATGSTDRTVRLWDVLNGNCVRIFTGHKGP--IHSLAFTPNGKFLATGASDGRV 643          

HSP 2 Score: 70.8626 bits (172), Expect = 2.993e-12
Identity = 46/151 (30.46%), Postives = 70/151 (46.36%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            GH   V   +F   S+ I T S D ++R+W+   G  +  +T +  PI  +A  P      A+GA DG V LWD      V ++ GH  ++ A+ F + G  + SG  D  VRLWD  T       +  D +     + F E   +++ GT
Sbjct:  575 GHLADVICTRFHPNSNYIATGSTDRTVRLWDVLNGNCVRIFTGHKGPIHSLAFTPN-GKFLATGASDGRVLLWDIGHGLMVGELKGHTNTVYALRFSRDGEILSSGSMDNTVRLWD--TVKAFEDLDTDDFTSSAGHINFHENSQDLLLGT 722          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Xenopus
Match: rxfp3 (relaxin family peptide receptor 3 [Source:Xenbase;Acc:XB-GENE-478939])

HSP 1 Score: 98.2117 bits (243), Expect = 4.457e-21
Identity = 59/161 (36.65%), Postives = 80/161 (49.69%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEW 1301
            L GHS  V    F S S  +L+ S D SIR WN E   +   Y  +A P+WD+  +P     FAS + D +  LW   R  P+R   GHL  +  + F+ + NY+ +G  D  VRLW  + GN VRL+    G   + A+AFS  G  +   G D  L  W
Sbjct:  302 LRGHSGPVYRTCFLSDSSGLLSCSEDTSIRYWNLENFTNTVLYQGHAHPVWDLDVSP-CSLFFASASHDRTGRLWCFDRTFPLRIYAGHLSDVDCIKFHPNSNYLATGSTDKTVRLWSTQQGNSVRLFTGHRGP--VLALAFSPNGKYLASAGEDQRLKLW 459          

HSP 2 Score: 65.4698 bits (158), Expect = 1.052e-10
Identity = 35/122 (28.69%), Postives = 60/122 (49.18%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNC 1193
            GH   V  ++F   S+ + T S D ++R+W+ + G S+  +T +  P+  +A +P      AS   D  + LWD       +++ GH  +I ++ F    + + S   D  VR+WDIR   C
Sbjct:  388 GHLSDVDCIKFHPNSNYLATGSTDKTVRLWSTQQGNSVRLFTGHRGPVLALAFSPN-GKYLASAGEDQRLKLWDLASGTLYKELRGHTDNISSLTFSPDSSLIASASMDNSVRVWDIRNSYC 508          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Xenopus
Match: rxfp3 (relaxin family peptide receptor 3 [Source:Xenbase;Acc:XB-GENE-478939])

HSP 1 Score: 98.2117 bits (243), Expect = 4.928e-21
Identity = 59/161 (36.65%), Postives = 80/161 (49.69%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEW 1301
            L GHS  V    F S S  +L+ S D SIR WN E   +   Y  +A P+WD+  +P     FAS + D +  LW   R  P+R   GHL  +  + F+ + NY+ +G  D  VRLW  + GN VRL+    G   + A+AFS  G  +   G D  L  W
Sbjct:  337 LRGHSGPVYRTCFLSDSSGLLSCSEDTSIRYWNLENFTNTVLYQGHAHPVWDLDVSP-CSLFFASASHDRTGRLWCFDRTFPLRIYAGHLSDVDCIKFHPNSNYLATGSTDKTVRLWSTQQGNSVRLFTGHRGP--VLALAFSPNGKYLASAGEDQRLKLW 494          

HSP 2 Score: 65.4698 bits (158), Expect = 1.183e-10
Identity = 35/122 (28.69%), Postives = 60/122 (49.18%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNC 1193
            GH   V  ++F   S+ + T S D ++R+W+ + G S+  +T +  P+  +A +P      AS   D  + LWD       +++ GH  +I ++ F    + + S   D  VR+WDIR   C
Sbjct:  423 GHLSDVDCIKFHPNSNYLATGSTDKTVRLWSTQQGNSVRLFTGHRGPVLALAFSPN-GKYLASAGEDQRLKLWDLASGTLYKELRGHTDNISSLTFSPDSSLIASASMDNSVRVWDIRNSYC 543          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Mouse
Match: Taf5 (TATA-box binding protein associated factor 5 [Source:MGI Symbol;Acc:MGI:2442144])

HSP 1 Score: 106.301 bits (264), Expect = 1.081e-23
Identity = 54/161 (33.54%), Postives = 83/161 (51.55%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICG-TDAGLIEW 1301
            L+GHS  V    F+   + +L+SS DG++R+W+ +T   +  Y  + +P+WD   +P     F SG  D    LW      P+R   GHL  +    F+ + NY+ +G  D  VRLWD+  GNCVR++    G   I ++ FS  G  +  G TD  ++ W
Sbjct:  540 LYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGP--IHSLTFSPNGRFLATGATDGRVLLW 697          

HSP 2 Score: 66.6254 bits (161), Expect = 4.463e-11
Identity = 43/151 (28.48%), Postives = 68/151 (45.03%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            GH   V   +F   S+ + T S D ++R+W+   G  +  +T +  PI  +  +P      A+GA DG V LWD      V ++ GH  ++ ++ F + G  + SG  D  VRLWD          E  D +     +   E   E++ GT
Sbjct:  626 GHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPN-GRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWD--AVKAFEDLETDDFTTATGHINLPENSQELLLGT 773          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Mouse
Match: Taf5l (TATA-box binding protein associated factor 5 like [Source:MGI Symbol;Acc:MGI:1919039])

HSP 1 Score: 99.3673 bits (246), Expect = 1.473e-21
Identity = 56/161 (34.78%), Postives = 83/161 (51.55%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEW 1301
            L GH   V S +F + S  +L+ S D SIR W+  +  +   Y  +A+P+WD+  +P     FASG+ D +  LW   R  P+R   GHL  +  V F+ + NY+ +G  D  VRLW  + GN VRL+    G   + +++FS  G  +   G D  L  W
Sbjct:  338 LRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDVDISP-FSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGP--VLSLSFSPNGKYLASAGEDQRLKLW 495          

HSP 2 Score: 69.707 bits (169), Expect = 4.683e-12
Identity = 41/134 (30.60%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKG 1229
            GH   V  V+F   S+ + T S D ++R+W+ + G S+  +T +  P+  ++ +P      AS   D  + LWD       +++ GH  SI ++ F      + S   D  VR+WDIR+  C      ADGS G
Sbjct:  424 GHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLSFSPN-GKYLASAGEDQRLKLWDLASGTLFKELRGHTDSITSLAFSPDSGLIASASMDNSVRVWDIRSTCCN---TPADGSSG 553          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Mouse
Match: Taf5l (TATA-box binding protein associated factor 5 like [Source:MGI Symbol;Acc:MGI:1919039])

HSP 1 Score: 99.3673 bits (246), Expect = 1.473e-21
Identity = 56/161 (34.78%), Postives = 83/161 (51.55%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEW 1301
            L GH   V S +F + S  +L+ S D SIR W+  +  +   Y  +A+P+WD+  +P     FASG+ D +  LW   R  P+R   GHL  +  V F+ + NY+ +G  D  VRLW  + GN VRL+    G   + +++FS  G  +   G D  L  W
Sbjct:  338 LRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDVDISP-FSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGP--VLSLSFSPNGKYLASAGEDQRLKLW 495          

HSP 2 Score: 69.707 bits (169), Expect = 4.683e-12
Identity = 41/134 (30.60%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKG 1229
            GH   V  V+F   S+ + T S D ++R+W+ + G S+  +T +  P+  ++ +P      AS   D  + LWD       +++ GH  SI ++ F      + S   D  VR+WDIR+  C      ADGS G
Sbjct:  424 GHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLSFSPN-GKYLASAGEDQRLKLWDLASGTLFKELRGHTDSITSLAFSPDSGLIASASMDNSVRVWDIRSTCCN---TPADGSSG 553          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Mouse
Match: Daw1 (dynein assembly factor with WDR repeat domains 1 [Source:MGI Symbol;Acc:MGI:1923089])

HSP 1 Score: 85.8853 bits (211), Expect = 1.405e-17
Identity = 58/189 (30.69%), Postives = 94/189 (49.74%), Query Frame = 3
Query:  741 DRSWDRAVFGRENGTVVVADLSGVSS--SLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACF-------ASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            D S DR + G  + TVVV D S      +L GH   ++S  F      ILT S+D +  +W+  +G  + T T +   I        +D+CF       A+ + DG+  +++A     V K+ GH G I  + F   GN +++G  D   R+WD++TG C+++ E    +  I + AF+  GN +I G+
Sbjct:  228 DTSGDRIITGSFDHTVVVWDASTGRKVHTLIGHCAEISSALFNWDCSLILTGSMDKTCMLWDATSGKYVATLTGHDDEI--------LDSCFDYTGKLIATASADGTARVYNATTRKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDVQTGQCLQVLEGH--TDEIFSCAFNYKGNIVITGS 406          

HSP 2 Score: 67.781 bits (164), Expect = 1.170e-11
Identity = 40/127 (31.50%), Postives = 66/127 (51.97%), Query Frame = 3
Query:  819 SLFGHSMMVTSVQFTSQ-SDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCV 1196
            +L GH  +V ++ F +   D+I T S D + ++W+ ETG    T+  +   I  ++ NP+     A+G+ D +  LWD      V  + GHL  I ++ F  SG+ +++G  D  V +WD  TG  V
Sbjct:  129 TLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLSFNPQ-STVVATGSMDTTAKLWDIQNGEEVVTLTGHLAEIISLSFDTSGDRIITGSFDHTVVVWDASTGRKV 254          

HSP 3 Score: 58.151 bits (139), Expect = 1.532e-8
Identity = 41/161 (25.47%), Postives = 69/161 (42.86%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT-DAGLIEW 1301
            L  H + +T+V         +T S D + +VW+  +G  + T   +   ++ IA N       A+G+FD +  LW A          GH   I  + F      + +G  D   +LWDI+ G  V           I +++F  +G+ II G+ D  ++ W
Sbjct:   88 LRAHILPLTNVALNKAGSCFITGSYDRTCKVWDTASGEELHTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLSFNPQSTVVATGSMDTTAKLWDIQNGEEVVTLTGHLAE--IISLSFDTSGDRIITGSFDHTVVVW 246          

HSP 4 Score: 49.6766 bits (117), Expect = 7.033e-6
Identity = 31/119 (26.05%), Postives = 54/119 (45.38%), Query Frame = 3
Query:  816 SSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLW 1172
            ++L GH   +    F      I T+S DG+ RV+N  T   +     +   I  I+ NP+ +    +G+ D +  +WD      ++ + GH   I +  F   GN +++G  D   R+W
Sbjct:  297 ATLTGHDDEILDSCFDYTGKLIATASADGTARVYNATTRKCVTKLEGHEGEISKISFNPQGNR-LLTGSSDKTARIWDVQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNSCRIW 414          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Mouse
Match: Wdr5b (WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:1916794])

HSP 1 Score: 83.1889 bits (204), Expect = 5.711e-17
Identity = 47/154 (30.52%), Postives = 87/154 (56.49%), Query Frame = 3
Query:  819 SLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            +L+GHS+ ++ V ++S S +++++S D +++VW+  +G  ++T   ++  ++    NP  +    SG+FD SV +W+      ++ +  H   I AV F  +G+ +VSG  DG  R+WD  +G C+R   A +G+  +  V FS  G  I+  T
Sbjct:   76 TLYGHSLEISDVAWSSDSSRLVSASDDKTLKVWDMRSGKCLKTLKGHSDFVFCCDFNPPSNL-IVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNCNGSLIVSGSYDGLCRIWDAASGQCLRT-LADEGNPPVSFVKFSPNGKYILTAT 227          

HSP 2 Score: 73.1738 bits (178), Expect = 1.262e-13
Identity = 61/231 (26.41%), Postives = 109/231 (47.19%), Query Frame = 3
Query:  735 IGDRSWD----RAVFGRENGTVVVADL-SGVS-SSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGS-IKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNE-IICGTDAGLIEWMGIEGS---ARVPLHLEETISNIVCHQKDRVIAS 1394
            I D +W     R V   ++ T+ V D+ SG    +L GHS  V    F   S+ I++ S D S+++W  +TG  ++T + ++ PI  +  N    +   SG++DG   +WDA     +R +       +  V F  +G Y+++   D  ++LWD   G C++ +      K     +FS TG + ++ G++  ++    ++      R+  H +  IS   CH    +IAS
Sbjct:   84 ISDVAWSSDSSRLVSASDDKTLKVWDMRSGKCLKTLKGHSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNCN-GSLIVSGSYDGLCRIWDAASGQCLRTLADEGNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCLFASFSVTGRKWVVSGSEDNMVYIWNLQTKEIVQRLQGHTDVVIS-AACHPTKNIIAS 312          

HSP 3 Score: 67.3958 bits (163), Expect = 8.382e-12
Identity = 54/209 (25.84%), Postives = 99/209 (47.37%), Query Frame = 3
Query:  819 SLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIE-WMGIEGSARVPLHLE--ETISNIVCHQKDR-VIASTINGGLYLLDQTR 1433
            +L GHS  ++SV+F+   + + +S+ D  I +W    G   +T   ++  I D+A +    +   S + D ++ +WD      ++ + GH   +    F    N +VSG  D  V++W+++TG C++   A   S  I AV F+  G+ I+ G+  GL   W    G     L  E    +S +      + ++ +T++  L L D +R
Sbjct:   34 TLAGHSAAISSVKFSPNGEWLASSAADALIIIWGAYDGNCKKTLYGHSLEISDVAWSSD-SSRLVSASDDKTLKVWDMRSGKCLKTLKGHSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAH--SDPISAVNFNCNGSLIVSGSYDGLCRIWDAASGQCLRTLADEGNPPVSFVKFSPNGKYILTATLDNTLKLWDYSR 239          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. UniProt/SwissProt
Match: sp|Q15542|TAF5_HUMAN (Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5 PE=1 SV=3)

HSP 1 Score: 105.916 bits (263), Expect = 9.623e-23
Identity = 54/161 (33.54%), Postives = 83/161 (51.55%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICG-TDAGLIEW 1301
            L+GHS  V    F+   + +L+SS DG++R+W+ +T   +  Y  + +P+WD   +P     F SG  D    LW      P+R   GHL  +    F+ + NY+ +G  D  VRLWD+  GNCVR++    G   I ++ FS  G  +  G TD  ++ W
Sbjct:  539 LYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGP--IHSLTFSPNGRFLATGATDGRVLLW 696          

HSP 2 Score: 66.2402 bits (160), Expect = 4.012e-10
Identity = 43/151 (28.48%), Postives = 68/151 (45.03%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            GH   V   +F   S+ + T S D ++R+W+   G  +  +T +  PI  +  +P      A+GA DG V LWD      V ++ GH  ++ ++ F + G  + SG  D  VRLWD          E  D +     +   E   E++ GT
Sbjct:  625 GHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPN-GRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAI--KAFEDLETDDFTTATGHINLPENSQELLLGT 772          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. UniProt/SwissProt
Match: sp|P49846|TAF5_DROME (Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster OX=7227 GN=Taf5 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.426e-22
Identity = 74/252 (29.37%), Postives = 122/252 (48.41%), Query Frame = 3
Query:  789 VVADLSG-VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT-DAGLIEWMGIEGS-ARVPLHLEETISNIVCHQKDRVIAST-INGGLYLLDQTRLVSRQCENQFSRIINIQKQSDQGNQ-ALILREF 1529
            ++ D SG V+ SL GH+  V    F  + + +L+ S D +IR+W+  T   + TY  + +P+WD+   P     F S ++D +  LW       +R  +GHL  +  V F+ + NY+ +G  D  VRLWD  TG  VRL     GS  + ++AFS  G  +  G+ D  +I W    GS     L    T++ I   +   V+A+  ++  L L D  ++     E+  S  I +    D+ ++   ++R F
Sbjct:  434 MLDDRSGEVTRSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRFAPH-GYYFVSCSYDKTARLWATDSNQALRVFVGHLSDVDCVQFHPNSNYVATGSSDRTVRLWDNMTGQSVRLMTGHKGS--VSSLAFSACGRYLASGSVDHNIIIWDLSNGSLVTTLLRHTSTVTTITFSRDGTVLAAAGLDNNLTLWDFHKVT----EDYISNHITVSHHQDENDEDVYLMRTF 678          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. UniProt/SwissProt
Match: sp|Q8C092|TAF5_MOUSE (Transcription initiation factor TFIID subunit 5 OS=Mus musculus OX=10090 GN=Taf5 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.770e-22
Identity = 53/161 (32.92%), Postives = 83/161 (51.55%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICG-TDAGLIEW 1301
            L+GHS  V    F+   + +L+SS DG++R+W+ +T   +  Y  + +P+WD   +P     F SG  D    LW      P+R   GHL  +    ++ + NY+ +G  D  VRLWD+  GNCVR++    G   I ++ FS  G  +  G TD  ++ W
Sbjct:  540 LYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRYHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGP--IHSLTFSPNGRFLATGATDGRVLLW 697          

HSP 2 Score: 65.4698 bits (158), Expect = 6.994e-10
Identity = 42/151 (27.81%), Postives = 68/151 (45.03%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            GH   V   ++   S+ + T S D ++R+W+   G  +  +T +  PI  +  +P      A+GA DG V LWD      V ++ GH  ++ ++ F + G  + SG  D  VRLWD          E  D +     +   E   E++ GT
Sbjct:  626 GHLADVNCTRYHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPN-GRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWD--AVKAFEDLETDDFTTATGHINLPENSQELLLGT 773          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. UniProt/SwissProt
Match: sp|O74319|TAF73_SCHPO (Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf73 PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 2.506e-22
Identity = 52/161 (32.30%), Postives = 85/161 (52.80%), Query Frame = 3
Query:  816 SSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIE 1298
            SSL GH+  V  V  + Q + IL+ S DG  R+W+++T  +I  Y  +  PIWD+  +P     FA+ + D +  LWD     P+R  +GH   +  V F+ +  Y+ +G  D   R+WD+RTG  VR++ A      + A+  S  G  +    ++G+I+
Sbjct:  397 SSLIGHTRPVFGVSISPQKEFILSCSEDGFTRLWSKDTKSTIVKYAGHNAPIWDVQFSP-FGYYFATASHDQTARLWDVEHAAPLRVFVGHQNDVDCVSFHPNAAYLATGSSDHTTRMWDVRTGGTVRVFNAHHSP--VSALCMSADGLSLASADESGIIK 554          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. UniProt/SwissProt
Match: sp|Q6S7B0|TAF5_ARATH (Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana OX=3702 GN=TAF5 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 6.555e-22
Identity = 66/220 (30.00%), Postives = 107/220 (48.64%), Query Frame = 3
Query:  678 VNFSVVTVNGAGLGISAGRIGDRS---WDRAVFGRENGTVVVADLSGVSSS-----------LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLI 1295
            +N S ++ +G+   + AG   D S   WD A  G+     + A+      S           L GHS  V S  F+   D +L+SS D +IR+W+ +   ++  Y  + +P+WD   +P     FAS + D +  +W   R  P+R M GHL  +  V ++ + NY+ +G  D  VRLWD++TG CVR++        + ++A S  G  +  G + G I
Sbjct:  355 LNCSSISHDGS---LVAGGFSDSSIKVWDMAKIGQAGSGALQAENDSSDQSIGPNGRRSYTLLLGHSGPVYSATFSPPGDFVLSSSADTTIRLWSTKLNANLVCYKGHNYPVWDAQFSP-FGHYFASCSHDRTARIWSMDRIQPLRIMAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQTGECVRIFIGHRSM--VLSLAMSPDGRYMASGDEDGTI 568          

HSP 2 Score: 60.4622 bits (145), Expect = 2.739e-8
Identity = 35/134 (26.12%), Postives = 67/134 (50.00%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACF-ASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADG 1220
            + GH   V  VQ+    + I T S D ++R+W+ +TG  +  +  +   +  +A +P  D  + ASG  DG++ +WD      +  ++GH   + ++ +   G+ + SG  D  V+LWD+ +   +   E  +G
Sbjct:  498 MAGHLSDVDCVQWHPNCNYIATGSSDKTVRLWDVQTGECVRIFIGHRSMVLSLAMSP--DGRYMASGDEDGTIMMWDLSTARCITPLMGHNSCVWSLSYSGEGSLLASGSADCTVKLWDVTSSTKLTKAEEKNG 629          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. TrEMBL
Match: A0A0L0DLT8 (Transcription initiation factor TFIID subunit 5 OS=Thecamonas trahens ATCC 50062 OX=461836 GN=AMSG_09301 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.089e-26
Identity = 71/214 (33.18%), Postives = 117/214 (54.67%), Query Frame = 3
Query:  672 DLVNFSVVTVNGAGLGISAGRIGDRSWD---RAVFGRENGTVVVADLSGVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAG-LIEW 1301
            D +N +  + +G  +    G    R WD   R + G     V +A+ S V   L GHS  V  + F+  S   +++S DG+ R+W+ ET  ++  Y+ ++FPIWD+A +P +   FA+ + D +  LW  +   P+R   GHL  +  V F+ + NY+ +G  D  VRLWD+++GNCVR++     + G+ ++AFS  G ++  G   G +IEW
Sbjct:  352 DTLNCASFSRSGGLMATGFGDSSIRLWDLEGRHLTGLNPELVPIAENSVV---LHGHSGPVYGLSFSPDSRFFVSASQDGTARLWSMETRTNLVVYSGHSFPIWDVAVSP-LGHYFATASHDTTARLWSTNMVTPLRIFAGHLSDVDTVAFHPNSNYVATGSSDKSVRLWDVQSGNCVRVYTG--HTDGVASLAFSPDGAKLASGAHNGAVIEW 559          

HSP 2 Score: 68.1662 bits (165), Expect = 2.973e-8
Identity = 36/119 (30.25%), Postives = 63/119 (52.94%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRT 1184
            GH   V +V F   S+ + T S D S+R+W+ ++G  +  YT +   +  +A +P   A  ASGA +G+V  WD +    ++   GH G++ ++ +   G  + S   D  +RLWD+ +
Sbjct:  488 GHLSDVDTVAFHPNSNYVATGSSDKSVRLWDVQSGNCVRVYTGHTDGVASLAFSPD-GAKLASGAHNGAVIEWDINSAKSLKSYTGHKGAVWSLDYAHDGVLLASASADHSIRLWDVES 605          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. TrEMBL
Match: A0A2V3IRN2 (Transcription initiation factor TFIID subunit 5 OS=Gracilariopsis chorda OX=448386 GN=BWQ96_05820 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.698e-24
Identity = 74/228 (32.46%), Postives = 118/228 (51.75%), Query Frame = 3
Query:  657 TNPVNDLVNFSVVTVNG----AGLGISAGRIGDRSWDRAVFGRENGTVVVADLSGVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIEWMGIEGSARV 1328
            TN   D +N S V+ +G    AG G S+ RI    WD A    E G    ++     + L GHS  V +V +T     +L+ S DG +R+W+++    +  Y  + +P+W  + +P +D  F +G  D +  +W+     P+R + GHL  + +V ++ + NY+ +G  D   RLWD+R G CVRL+ A  G+  I ++AFS  G  + CG DA  I+   I    R+
Sbjct:  417 TNSHEDGLNCSAVSEDGSLVAAGFGDSSVRI----WDAATSSIETGGQASSEYG--RNRLIGHSGPVYAVDWTKCGRFLLSGSEDGCLRLWSQDYRTDLVCYKGHNYPVWCASFSP-LDYYFVTGCHDRTARIWNTEVVVPLRILAGHLADVDSVRWHPNCNYVATGSSDRTARLWDVRDGKCVRLFGAHRGT--IHSLAFSPDGRTLACGGDADTIDIWDIASGRRM 635          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. TrEMBL
Match: A0A3L6VXM6 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Aphanomyces astaci OX=112090 GN=DYB28_014131 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 6.948e-24
Identity = 60/182 (32.97%), Postives = 97/182 (53.30%), Query Frame = 3
Query:  831 HSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIE-WMGIEGSARVPLHLEETISNIVCHQ 1373
            H+  V    FT  +   +TSS D ++R+W+  +  S+  Y  + +P+WD+A  P +   FAS + D +  LW   R  P+R + GHL  ++ V F+ + NY+ +G  D  VRLWD++TG+C+R++    G  G+ AVAFS  G  +    D  L+  W          LH+ + +  +V HQ
Sbjct:   67 HAGPVYGCGFTPDNRFAVTSSADSTVRLWSLASRTSMVVYRAHTYPVWDVAVAP-LGYYFASASMDRTARLWSTDRVQPLRVLAGHLSDVECVTFHPNHNYLATGSTDKTVRLWDVQTGHCLRVFAGHYG--GVSAVAFSPNGRYLASAGDDTLVNIW---------DLHMGKKLETLVGHQ 236          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. TrEMBL
Match: A0A067CL81 (WD_REPEATS_REGION domain-containing protein OS=Saprolegnia parasitica (strain CBS 223.65) OX=695850 GN=SPRG_07546 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.199e-23
Identity = 76/269 (28.25%), Postives = 130/269 (48.33%), Query Frame = 3
Query:  618 LEEAINNLEKQIETNPV-------------NDLVNFSVVTVNGAGLGISAGRIGDRSWDRAVFGRENGTVV--VADLSGVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEWMGIEGSARVPLHLEETISNIVCHQK 1376
            + E + N++ ++E N V             ND +N      +G+ +G +      R W       ++GT +    +    S+ L GHS  V    FT  S   LTSS D +IR+W+  +  ++  Y  +++P+WD+A +P +   FAS + D +  LW   R  P+R   GHL  ++ V F+ + NY+ +G  D  VR+WD+++G C+R++    G+  +  VAFS  G  +   G DA +  W          LH+ + +  ++ H K
Sbjct:  384 VAEELQNVQARLELNSVQLPSALCYTICNANDHMNNVAFNASGSVVGAAFDDSSFRVWS------QDGTALGGFPNHDNTSAVLRGHSGPVYGCAFTPDSRFALTSSADTTIRLWSLASRSNMVCYRAHSYPVWDVAMSP-LGYYFASASMDRTARLWSTDRVQPLRIFAGHLSDVETVAFHPNHNYLATGSTDKSVRIWDVQSGQCIRVFTGHYGA--VHTVAFSPNGRYLASAGEDAFVNVW---------DLHMGKRVDTLLGHSK 634          

HSP 2 Score: 69.3218 bits (168), Expect = 1.475e-8
Identity = 38/117 (32.48%), Postives = 62/117 (52.99%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDI 1178
            GH   V +V F    + + T S D S+R+W+ ++G  I  +T +   +  +A +P      AS   D  V +WD H    V  ++GH  +I +++F +  + +VSGG D  VRLWD+
Sbjct:  547 GHLSDVETVAFHPNHNYLATGSTDKSVRIWDVQSGQCIRVFTGHYGAVHTVAFSPN-GRYLASAGEDAFVNVWDLHMGKRVDTLLGHSKAIYSLMFSQESSMIVSGGADHTVRLWDM 662          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. TrEMBL
Match: A0A396ZY90 (WD_REPEATS_REGION domain-containing protein (Fragment) OS=Aphanomyces astaci OX=112090 GN=DYB36_014276 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.416e-23
Identity = 60/184 (32.61%), Postives = 98/184 (53.26%), Query Frame = 3
Query:  825 FGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIE-WMGIEGSARVPLHLEETISNIVCHQ 1373
            +GH+  V    FT  +   +TSS D ++R+W+  +  S+  +  + +P+WD+A  P +   FAS + D +  LW   R  P+R   GHL  ++ V F+ + NY+ +G  D  VRLWD++TG+C+R++    G  G+ AVAFS  G  +    D  L+  W          LH+ + +  +V HQ
Sbjct:  162 YGHAGPVYGCGFTPDNRFAVTSSADSTVRLWSLASRTSMVVFRAHTYPVWDVAVAP-LGYYFASASMDRTARLWSTDRVQPLRVFAGHLSDVECVTFHPNHNYLATGSTDKTVRLWDVQTGHCLRVFAGHYG--GVSAVAFSPNGRYLASAGDDTLVNIW---------DLHMGKKLETLVGHQ 333          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Cavefish
Match: taf5 (TATA-box binding protein associated factor 5 [Source:NCBI gene;Acc:103038729])

HSP 1 Score: 108.612 bits (270), Expect = 1.323e-24
Identity = 56/161 (34.78%), Postives = 84/161 (52.17%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICG-TDAGLIEW 1301
            L+GHS  V  V F+   + +L+SS DG+IR+W+ +T   +  Y  + +P+WD   +P     F SG  D    LW      P+R   GHL  I    F+ + NY+ +G  D  +RLWD+  G+CVR+     G   I ++AFS  G  +  G TD  ++ W
Sbjct:  467 LYGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQPLRMFAGHLADITCTRFHPNSNYVATGSADRTIRLWDVLNGHCVRVLTGHKGP--IHSLAFSPNGKYLASGSTDGRVLLW 624          

HSP 2 Score: 72.7886 bits (177), Expect = 3.676e-13
Identity = 49/152 (32.24%), Postives = 73/152 (48.03%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWD-IRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            GH   +T  +F   S+ + T S D +IR+W+   G  +   T +  PI  +A +P      ASG+ DG V LWD      + ++ GH  +I A+ F + G  + SG  D  VRLWD IR  + V   E  D +     V   +   E++ GT
Sbjct:  553 GHLADITCTRFHPNSNYVATGSADRTIRLWDVLNGHCVRVLTGHKGPIHSLAFSPN-GKYLASGSTDGRVLLWDIGHGLMIGELKGHTDTIYALRFSRDGEILASGSMDNTVRLWDAIRAFDDV---ETDDFTAATGHVHLPDNSQELLLGT 700          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Cavefish
Match: taf5 (TATA-box binding protein associated factor 5 [Source:NCBI gene;Acc:103038729])

HSP 1 Score: 108.612 bits (270), Expect = 1.323e-24
Identity = 56/161 (34.78%), Postives = 84/161 (52.17%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICG-TDAGLIEW 1301
            L+GHS  V  V F+   + +L+SS DG+IR+W+ +T   +  Y  + +P+WD   +P     F SG  D    LW      P+R   GHL  I    F+ + NY+ +G  D  +RLWD+  G+CVR+     G   I ++AFS  G  +  G TD  ++ W
Sbjct:  467 LYGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQPLRMFAGHLADITCTRFHPNSNYVATGSADRTIRLWDVLNGHCVRVLTGHKGP--IHSLAFSPNGKYLASGSTDGRVLLW 624          

HSP 2 Score: 72.7886 bits (177), Expect = 3.676e-13
Identity = 49/152 (32.24%), Postives = 73/152 (48.03%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWD-IRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            GH   +T  +F   S+ + T S D +IR+W+   G  +   T +  PI  +A +P      ASG+ DG V LWD      + ++ GH  +I A+ F + G  + SG  D  VRLWD IR  + V   E  D +     V   +   E++ GT
Sbjct:  553 GHLADITCTRFHPNSNYVATGSADRTIRLWDVLNGHCVRVLTGHKGPIHSLAFSPN-GKYLASGSTDGRVLLWDIGHGLMIGELKGHTDTIYALRFSRDGEILASGSMDNTVRLWDAIRAFDDV---ETDDFTAATGHVHLPDNSQELLLGT 700          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Cavefish
Match: taf5l (TATA-box binding protein associated factor 5 like [Source:NCBI gene;Acc:103041723])

HSP 1 Score: 91.2781 bits (225), Expect = 4.186e-19
Identity = 49/162 (30.25%), Postives = 81/162 (50.00%), Query Frame = 3
Query:  819 SLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEW 1301
            +L GH   V    F + S  +L+ S D ++R W+  +  ++  Y  +A+P+WD+  +P     F + + D +  LW   R  P+R   GHL  +  V F+ + NY+ +G  D  VRLW  + G+ VRL+    G   + ++AFS  G  +   G D  +  W
Sbjct:  349 TLRGHCGPVYRTAFLTDSSGLLSCSEDSTVRYWDLNSFTNVALYRGHAYPVWDVDVSP-CSLYFCTASQDRTARLWTFQRTYPLRLYAGHLADVDCVKFHPNSNYIATGSTDKTVRLWSTQQGSSVRLFTGHRGP--VLSLAFSPNGKYLASAGEDQRVKLW 507          

HSP 2 Score: 65.4698 bits (158), Expect = 7.355e-11
Identity = 37/118 (31.36%), Postives = 57/118 (48.31%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIR 1181
            GH   V  V+F   S+ I T S D ++R+W+ + G S+  +T +  P+  +A +P      AS   D  V LWD       + + GH  S+ ++ F      + S   D  VR+WDIR
Sbjct:  436 GHLADVDCVKFHPNSNYIATGSTDKTVRLWSTQQGSSVRLFTGHRGPVLSLAFSPN-GKYLASAGEDQRVKLWDLASGTLFKDLRGHTDSVMSLSFSPDSALVASAALDNSVRVWDIR 552          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Cavefish
Match: gnb4b (guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2-like [Source:NCBI gene;Acc:103029911])

HSP 1 Score: 84.3445 bits (207), Expect = 1.978e-17
Identity = 52/158 (32.91%), Postives = 85/158 (53.80%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            V+  L GH+  ++  +F S  +QI+TSS D +  +W+ ETG     +T ++  +  ++ +P  +  F SGA D S  LWD       +  IGH+  I AV F+ +GN   +G DD   RL+D+R    + ++       GI +VAFS++G  ++ G D
Sbjct:  135 VTRELPGHTGYLSCCRFLSD-NQIVTSSGDTTCALWDIETGQQTIAFTGHSGDVMSLSLSPD-NKTFVSGACDASTKLWDIRDGMCRQTFIGHISDINAVCFFPNGNAFATGSDDATCRLFDLRADQELMMYSHDSIICGITSVAFSKSGRLLLAGYD 290          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Cavefish
Match: gnb4b (guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2-like [Source:NCBI gene;Acc:103029911])

HSP 1 Score: 83.9593 bits (206), Expect = 2.564e-17
Identity = 52/158 (32.91%), Postives = 85/158 (53.80%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            V+  L GH+  ++  +F S  +QI+TSS D +  +W+ ETG     +T ++  +  ++ +P  +  F SGA D S  LWD       +  IGH+  I AV F+ +GN   +G DD   RL+D+R    + ++       GI +VAFS++G  ++ G D
Sbjct:  122 VTRELPGHTGYLSCCRFLSD-NQIVTSSGDTTCALWDIETGQQTIAFTGHSGDVMSLSLSPD-NKTFVSGACDASTKLWDIRDGMCRQTFIGHISDINAVCFFPNGNAFATGSDDATCRLFDLRADQELMMYSHDSIICGITSVAFSKSGRLLLAGYD 277          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Sea Lamprey
Match: taf5l (TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-5987])

HSP 1 Score: 92.8189 bits (229), Expect = 3.016e-20
Identity = 59/194 (30.41%), Postives = 94/194 (48.45%), Query Frame = 3
Query:  789 VVADLSGVS-SSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIEWMGIEGSARVPLHLEETISNIVC 1367
            VV D  G    +L  HS  V +V+F      +L+ S D S+R W+  T  +   Y  +A+P+WD+  +  +   F SG+ D +  LW   R  P+R   GH+  +  V F+ +G+Y+ +G  D  VRLW  + G+  RL+    G+  + A+AFS  G  +  G +   +    I GS  +   L     +I C
Sbjct:  327 VVEDSKGSDVKTLRAHSGPVYAVRFLPGGAGLLSCSEDASVRFWDPRTFTNTAVYQGHAYPVWDVDVSA-LGLYFCSGSHDRTARLWVPERAFPLRVYAGHVSDVNVVRFHPNGSYVATGSADRTVRLWSAQQGSAARLFTGHRGA--VLALAFSPGGRLLASGGEDQRVRLWDI-GSGAIVKELRGHSDDITC 516          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Sea Lamprey
Match: GNB3 (G protein subunit beta 3 [Source:HGNC Symbol;Acc:HGNC:4400])

HSP 1 Score: 77.411 bits (189), Expect = 3.102e-16
Identity = 51/158 (32.28%), Postives = 80/158 (50.63%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH+  ++  +F    ++I+TSS D +  +W+ ETG     +  ++  +  +A  P   A F SGA D S  LWD       +   GH   I A+ F+ +GN   +G DD   RL+D+R    + L+   +   GI +VAFS +G  ++ G D
Sbjct:   47 VSRELPGHTGYLSCCRFLDD-NRIVTSSGDTTCALWDIETGQQTTAFVGHSGDVMSLALAPDGRA-FVSGACDASAKLWDVRDGMCRQTFSGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELVLYSHDNIICGITSVAFSRSGRLLLAGYD 202          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002506.1 (pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 gene:ENSPMAG00000002224.1 transcript:ENSPMAT00000002506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 8.401e-13
Identity = 62/208 (29.81%), Postives = 94/208 (45.19%), Query Frame = 3
Query:  759 AVFGRENGTVVVADLS-GVSSSLF-GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIA-------SNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIEWMGIEGSARVPLHLEETIS 1355
            A+ G  +GT+ + DL+ G ++  F GH+  V SV F++ + QI++ S D +I++WN   GV   T  ++    W          +NP I +C     +D  V +W+          IGH G +  V     G+   SGG DGQ  LWD+  G  +      DG   I A+ FS      +C      I+   +EG   V    +E IS
Sbjct:   78 ALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNT-LGVCKYTIQEDGHTEWVSCVRFSPNNNNPIIVSC----GWDKLVKVWNLTNCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLY---TLDGGDTINALCFSPN-RYWLCAATGPSIKIWDLEGKVIVDELRQEVIS 276          

HSP 2 Score: 56.225 bits (134), Expect = 5.821e-9
Identity = 49/171 (28.65%), Postives = 81/171 (47.37%), Query Frame = 3
Query:  819 SLFGHSMMVTSVQFTSQ-SDQILTSSLDGSIRVWN---EET--GVSIETYTDNAFPIWDIASNPRIDACFA-SGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII---CGTDAGLIEW 1301
            +L GH+  VT +  T Q  D IL++S D ++ +W    +ET  G+   +   +   + D+  +   D  FA SG++DG++ LWD       R+ +GH   + +V F      +VSG  D  ++LW+   G C    +    ++ +  V FS   N  I   CG D  +  W
Sbjct:   10 TLKGHNGWVTQIATTPQFPDMILSASRDKTLIMWKLTRDETNYGIPQRSLHGHGHFVSDVVISS--DGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNT-LGVCKYTIQEDGHTEWVSCVRFSPNNNNPIIVSCGWDKLVKVW 177          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Sea Lamprey
Match: pafah1b1b (platelet-activating factor acetylhydrolase 1b, regulatory subunit 1b [Source:NCBI gene;Acc:394247])

HSP 1 Score: 67.3958 bits (163), Expect = 1.927e-12
Identity = 52/191 (27.23%), Postives = 92/191 (48.17%), Query Frame = 3
Query:  819 SLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETG---VSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEWMGIEGSARVPLHLEETISNIVCHQKD 1379
            +L GH   VT V F      I+++S D +I+VW+ ETG    +++ +TD+   I    S   + +C A    D +V LWD      +R M GH  ++ +V F  +G+++VS   D  +++W+++TG CV+ +      + +  V  ++ G+ I  C  D  +  W+      +  L   E +   V    D
Sbjct:   42 ALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDLSGKMLASCSA----DMTVKLWDFQSFECLRTMHGHDHNVSSVAFMPNGDHLVSASRDKTMKMWEVQTGYCVKTFTGH--REWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPD 226          

HSP 2 Score: 48.521 bits (114), Expect = 2.077e-6
Identity = 38/173 (21.97%), Postives = 70/173 (40.46%), Query Frame = 3
Query:  819 SLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVW-------------NEETGVSIETYTDNAFPI------WDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            +  GH   V  V+       I + S D ++RVW             +E     +    D A P+       +     +      SG+ D ++ +WD      V  ++GH   ++ VLF+  G +++S  DD  +R+WD +   C +    A     + ++ F +T   +I G+
Sbjct:  168 TFTGHREWVRMVRPNQDGSLIASCSNDQTVRVWVTATKECKAELREHEHVVECVSWAPDAASPVILEATGAEAKKGGKPGPYLLSGSRDKTIKMWDISTGICVITLVGHDNWVRGVLFHPGGKFILSCADDKTLRVWDYKNKRCQK--SLAAHEHFVTSLDFHKTAPYVITGS 338          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 67.3958 bits (163), Expect = 2.898e-12
Identity = 48/184 (26.09%), Postives = 88/184 (47.83%), Query Frame = 3
Query:  792 VADLSGVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDA-CFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIEWMG-IEGSARVPLH 1337
            V  + G S+    H+  V SV F++    ++T+S D SI+VW       +  Y+ N    W  ++    D     SG+ D +V +WD++    V     H G +  V F+ SG  + + G D  V++WDIR    ++ ++    +  + +++F  TGN +I  ++   ++ +  +EG     LH
Sbjct:   88 VPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFL--YSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAA--VNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLH 267          

HSP 2 Score: 56.6102 bits (135), Expect = 6.661e-9
Identity = 39/159 (24.53%), Postives = 71/159 (44.65%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEI-ICGTDAGLIEW 1301
            GH   V SVQF+     ++++S D ++R+W          +  +   +  ++ +    +   + + D S+ +W  HR+  +  +  H   +++  F   G  +VSG DD  VR+WD  +  CV  +    G   +  V F  +G  I   GTD  +  W
Sbjct:   58 GHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQS-LVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGF--VNQVDFHPSGTCIAAAGTDNTVKVW 213          

HSP 3 Score: 53.1434 bits (126), Expect = 9.667e-8
Identity = 34/152 (22.37%), Postives = 63/152 (41.45%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            GH   +TSV F     Q+ + S+D  + VWN +       +  +   +  +  +P       S + D +V LW    +        H  ++++V F   G  +V+  DD  +++W +       L+     S  + +  FS  G  I+ G+D
Sbjct:   16 GHRDTITSVDFNPNMKQLASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPS-GHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKF--LYSLNQHSNWVRSAKFSPDGRLIVSGSD 164          

HSP 4 Score: 47.3654 bits (111), Expect = 5.666e-6
Identity = 27/104 (25.96%), Postives = 51/104 (49.04%), Query Frame = 3
Query:  987 NPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIE 1298
            NP +    ASG+ D  + +W+   +    + +GH  ++ +V F  SG+ +VS   D  VRLW         +++A   +  + +V+FS  G  ++  +D   I+
Sbjct:   27 NPNMKQ-LASGSMDACLMVWNFKPQTRAYRFVGHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTAT--VRSVSFSADGQSLVTASDDKSIK 127          

HSP 5 Score: 46.595 bits (109), Expect = 9.634e-6
Identity = 39/159 (24.53%), Postives = 60/159 (37.74%), Query Frame = 3
Query:  819 SLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETY-----------------------TDNAFPIWDIASNPRIDACFASGAF------------------DGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLW 1172
            SL  HS  V S +F+     I++ S D ++RVW+  +   + T+                       TDN   +WDI  N  +      GA                   D ++ + D         + GH G   AV F ++G++  SGG D QV +W
Sbjct:  139 SLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVW 297          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 94.3597 bits (233), Expect = 7.125e-21
Identity = 48/166 (28.92%), Postives = 88/166 (53.01%), Query Frame = 3
Query:  798 DLSGVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLI 1295
            D      +L GHS  V S  F+  +  +L+ S D ++R+W+ +T  ++ +Y  +  P+WD++ +P +   FA+ + D +  LW      P+R   GHL  +  V F+ +G Y+ +G  D   R+WD+ TG+ VRL+     +  + ++A    G  +  G++ G+I
Sbjct:  513 DEDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSP-LGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGH--TAPVISIAVCPDGRWLSTGSEDGII 675          

HSP 2 Score: 63.1586 bits (152), Expect = 5.355e-11
Identity = 37/119 (31.09%), Postives = 62/119 (52.10%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGH-LGSIKAVLFYKSGNYMVSGGDDGQVRLWDIR 1181
            GH   V  V F      + T S D + R+W+  TG S+  +  +  P+  IA  P      ++G+ DG + +WD      +++M GH   +I ++ + K GN ++SGG D  VR+WD++
Sbjct:  607 GHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPD-GRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Yeast
Match: PRP46 (Member of the NineTeen Complex (NTC); this complex contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs [Source:SGD;Acc:S000006072])

HSP 1 Score: 71.2478 bits (173), Expect = 9.866e-14
Identity = 56/225 (24.89%), Postives = 95/225 (42.22%), Query Frame = 3
Query:  762 VFGRENGTVVVADLS--GVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIEWMGIEGSARVPLHLEET--ISNIVCHQKDRVIASTINGGLYLLD 1424
            + G  + T+ V DL+   + ++L GH M V  V  + +   + + S D +++ W+ E    I  Y  +   +  ++ +P +D   A+   D  + LWD     PV  ++GH G I  V        +VS   D  VRLWD+  G  +++       + + A A       +       +  W   EGS       E+T  I+ +  +Q D + A   NG L   D
Sbjct:  156 ITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLD-LIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKV--LTHHKRSVRATALHPKEFSVASACTDDIRSWGLAEGSLLTNFESEKTGIINTLSINQDDVLFAGGDNGVLSFYD 377          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Yeast
Match: MET30 (F-box protein containing five copies of the WD40 motif; controls cell cycle function, sulfur metabolism, and methionine biosynthesis as part of the ubiquitin ligase complex; interacts with and regulates Met4p, localizes within the nucleus; dissociation of Met30p from SCF complex in response to cadmium stress is regulated by Cdc48p [Source:SGD;Acc:S000001308])

HSP 1 Score: 63.929 bits (154), Expect = 3.207e-11
Identity = 46/158 (29.11%), Postives = 77/158 (48.73%), Query Frame = 3
Query:  756 RAVF-GRENGTVVVADL--SGVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADG 1220
            R +F G  + T+ + DL    +   L GHS  V ++ F  +  +++T SLD +IRVWN  TG  I TY  ++  +  + S  ++     SG+ D +V +W          + GH   +  V  +       S  DD  +R+WDIRT +C++++    G
Sbjct:  313 RLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDR--KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKV---IVSGSADKTVKVWHVESRT-CYTLRGHTEWVNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVG 464          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Yeast
Match: SEC27 (Essential beta'-coat protein of the COPI coatomer; involved in ER-to-Golgi and Golgi-to-ER transport; contains WD40 domains that mediate cargo selective interactions; 45% sequence identity to mammalian beta'-COP [Source:SGD;Acc:S000003105])

HSP 1 Score: 59.6918 bits (143), Expect = 6.508e-10
Identity = 51/207 (24.64%), Postives = 93/207 (44.93%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIE-TYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMI-GHLGSIKAVLFYKSGN--YMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIE-W----MGIEGSARVPLHLEETISNIVCHQKDRVIASTINGGLYLL 1421
             H   + S+        +L+ S D ++++WN E   ++E T+  +   +  +A NP+  + FASG  D +V +W   +  P   +  G    +  V +Y   +  YM++  DD  +++WD +T +CV   E       +    F  T   II G++ G ++ W      +E +  V L     I+     +K+  IAS  + G  +L
Sbjct:   95 AHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGH--MSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKN-YIASGFDNGFTVL 298          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Yeast
Match: STE4 (G protein beta subunit; forms a dimer with Ste18p to activate mating signaling pathway, forms heterotrimer with Gpa1p and Ste18p to dampen signaling; pheromone-induced phosphorylation plays critical role in chemotropism; may recruit Rho1p to polarized growth site during mating; contains WD40 repeats [Source:SGD;Acc:S000005738])

HSP 1 Score: 58.151 bits (139), Expect = 1.221e-9
Identity = 35/130 (26.92%), Postives = 67/130 (51.54%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDN-----AFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRT 1184
            V+S   GH+  ++ ++FT  +  ILT+S D +  +W+      +  Y+D+     A  I +  ++      FAS   DG   +WD+   + V+    +   I A+ F+K G  +V+G D+G + ++D+R+
Sbjct:  173 VASIFKGHTCYISDIEFTDNA-HILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYDLRS 301          

HSP 2 Score: 49.2914 bits (116), Expect = 8.270e-7
Identity = 50/215 (23.26%), Postives = 82/215 (38.14%), Query Frame = 3
Query:  822 LFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFP----------------------------IWDIASNPRIDACFASGAFDGSVC-----------------------LWDAHRENPVRKMIGHLGSIKAVLFYK------SGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLI 1295
            L GH+  ++  +++  S +IL++S DG + +W+  +G+       NA P                            I+ ++   R+    AS  F G  C                       LWD  +   VR+   HLG + A+   +      S N   S G DG   +WD R+ + V+ +   D    I A+ F + G  I+ G+D G I
Sbjct:   88 LKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLK-----QNAIPLDSQWVLSCAISPSSTLVASAGLNNNCTIYRVSKENRVAQNVAS-IFKGHTCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGSDGYTYIWDSRSPSAVQSFYVNDSD--INALRFFKDGMSIVAGSDNGAI 294          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Nematostella
Match: EDO29288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T426])

HSP 1 Score: 105.531 bits (262), Expect = 4.316e-26
Identity = 62/196 (31.63%), Postives = 100/196 (51.02%), Query Frame = 3
Query:  813 SSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEWMGIEGSARVPLHLEETISNIVCHQKDRVIAST 1397
            S  L GHS  V +V     +  +L+ S D +IR+W+  T  ++  Y  + +P+WD+   PR    FAS + D +  LW    + P+R   GH+  +  V F+ + NY+ +G  D  VRLWDI+TG+ VRL+     +  ++++AFS  G  +I  G D  L+ W   EG+    L         +C  +D  I ++
Sbjct:   14 SRRLVGHSGPVFAVSIDHDNKFLLSCSEDKTIRLWSLFTFTTLVAYRGHNYPVWDVQFCPR-GHYFASTSHDRTARLWSTDHQQPLRIFAGHVSDVNKVAFHPNCNYIATGSSDRTVRLWDIQTGSSVRLFTGHKAA--VQSLAFSRNGRHLISSGVDTRLLVWDLAEGTLVAELKGHTDTVYSLCFSRDGTILAS 206          

HSP 2 Score: 53.1434 bits (126), Expect = 4.174e-8
Identity = 31/115 (26.96%), Postives = 56/115 (48.70%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLW 1172
            GH   V  V F    + I T S D ++R+W+ +TG S+  +T +   +  +A +       +SG  D  + +WD      V ++ GH  ++ ++ F + G  + S G D  ++LW
Sbjct:  103 GHVSDVNKVAFHPNCNYIATGSSDRTVRLWDIQTGSSVRLFTGHKAAVQSLAFSRNGRHLISSGV-DTRLLVWDLAEGTLVAELKGHTDTVYSLCFSRDGTILASAGLDNCIKLW 216          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Nematostella
Match: EDO33060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST98])

HSP 1 Score: 108.227 bits (269), Expect = 6.317e-25
Identity = 61/196 (31.12%), Postives = 100/196 (51.02%), Query Frame = 3
Query:  813 SSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEWMGIEGSARVPLHLEETISNIVCHQKDRVIAST 1397
            S  L GHS  V +V     +  +L+ S D +IR+W+  T  ++  Y  + +P+WD+   PR    FAS + D +  LW    + P+R   GH+  +  + F+ + NY+ +G  D  VRLWDI+TG+ VRL+     +  ++++AFS  G  +I  G D  L+ W   EG+    L         +C  +D  I ++
Sbjct:  340 SRRLVGHSGPVFAVSIDHDNKFLLSCSEDKTIRLWSLFTFTTLVAYRGHNYPVWDVQFCPR-GHYFASTSHDRTARLWSTDHQQPLRIFAGHVSDVNVIAFHPNCNYIATGSSDRTVRLWDIQTGSSVRLFTGHKAA--VQSLAFSRNGRHLISSGVDTRLLVWDLAEGTLVAELKGHTDTVYSLCFSRDGTILAS 532          

HSP 2 Score: 53.5286 bits (127), Expect = 1.272e-7
Identity = 30/116 (25.86%), Postives = 57/116 (49.14%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWD 1175
            GH   V  + F    + I T S D ++R+W+ +TG S+  +T +   +  +A +       +SG  D  + +WD      V ++ GH  ++ ++ F + G  + S G D  ++LW+
Sbjct:  429 GHVSDVNVIAFHPNCNYIATGSSDRTVRLWDIQTGSSVRLFTGHKAAVQSLAFSRNGRHLISSGV-DTRLLVWDLAEGTLVAELKGHTDTVYSLCFSRDGTILASAGLDNCIKLWN 543          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Nematostella
Match: EDO40844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z1])

HSP 1 Score: 85.5001 bits (210), Expect = 3.287e-18
Identity = 55/158 (34.81%), Postives = 83/158 (52.53%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH+  ++  +F     QI+TSS D +  +W+ ET  +I TY+ +   +  ++ NP  +  F SGA D S  LWD      V+   GH   I AV F+ SG    +G DD   RL+DIR    + ++   +   GI +VAFS++G  ++ G D
Sbjct:  135 VSRELPGHTGYLSCCRFIDDC-QIITSSGDMTCALWDIETAQTISTYSGHTGDVMSLSLNPN-NQSFVSGACDASAKLWDIRGGTCVQTFTGHESDINAVAFFPSGFAFGTGSDDATCRLFDIRADQELMMYSHDNIICGITSVAFSKSGRLLLAGYD 290          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Nematostella
Match: EDO43158 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZJ8])

HSP 1 Score: 85.8853 bits (211), Expect = 6.590e-18
Identity = 55/183 (30.05%), Postives = 92/183 (50.27%), Query Frame = 3
Query:  774 ENGTVVVADLSGVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEWMGIEGS 1319
            EN  +    L  V+  L GHS  V +  F S+   +L++S D ++R+W+  +  +I  Y  +  P+W +  + +    FA+G+ D S  LW+     P+R    H+   + V F+ +  Y+ +G  D   RLWD+++GNCVRL+    GS  +  +A S  G  ++  G D  +  W    GS
Sbjct:  332 ENPRIETTSLGTVT--LRGHSGPVYATCFGSEGKILLSASEDTTVRLWSLHSYSNIVQYKGHNHPVWSLDLSAQ-SLYFATGSQDSSARLWNTEYNYPLR---FHVFGFQGVKFHPNCTYLATGSSDRTCRLWDLQSGNCVRLFRGHKGS--VLVLAISPDGQHLLSAGDDRSIRVWDLAAGS 506          

HSP 2 Score: 68.5514 bits (166), Expect = 2.613e-12
Identity = 51/185 (27.57%), Postives = 82/185 (44.32%), Query Frame = 3
Query:  651 IETNPVNDLVNFSVVTVNGAGLGISAGRIGDRSWDRAVFGRENGTVVVADLSGVSS--SLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVR 1199
            I  NP  +  +   VT+ G    + A   G       +   E+ TV +  L   S+     GH+  V S+  ++QS    T S D S R+WN E    +  +    F    +  +P      A+G+ D +  LWD    N VR   GH GS+  +     G +++S GDD  +R+WD+  G+ ++
Sbjct:  330 IPENPRIETTSLGTVTLRGHSGPVYATCFGSEG-KILLSASEDTTVRLWSLHSYSNIVQYKGHNHPVWSLDLSAQSLYFATGSQDSSARLWNTEYNYPLRFHV---FGFQGVKFHPNC-TYLATGSSDRTCRLWDLQSGNCVRLFRGHKGSVLVLAISPDGQHLLSAGDDRSIRVWDLAAGSLLK 509          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Nematostella
Match: KATNB1 (Katanin p80 WD40 repeat-containing subunit B1 [Source:UniProtKB/TrEMBL;Acc:A7SV12])

HSP 1 Score: 80.1073 bits (196), Expect = 7.512e-16
Identity = 51/171 (29.82%), Postives = 81/171 (47.37%), Query Frame = 3
Query:  699 VNGAGLGISAGRI-----GDRSWDRAVFGRENGTVVVADLSGVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCV 1196
            +N   LG S GR+      DR  +    G+ N          V  SL GH+  V  VQF S  D ++  S  G++++W+ E    + T T +   I  +  +P  D   ASG+ D ++ LWD  R+  +    GH   +  + F   G +++SGG+DG  +LWD+  G  +
Sbjct:   21 INCLSLGPSTGRVMVTGGEDRKVNMWAVGQPN----------VIMSLAGHTSPVECVQFNSGEDLVVAGSQSGTLKIWDLEAAKILRTLTGHKSSIRSLDFHPFGD-FVASGSLDTNLKLWDIRRKGCIFTYKGHTDCVNHLRFSPDGRWIISGGEDGAAKLWDLTAGKII 180          

HSP 2 Score: 53.1434 bits (126), Expect = 2.084e-7
Identity = 37/146 (25.34%), Postives = 63/146 (43.15%), Query Frame = 3
Query:  753 DRAVFGRENGTVVVADLSGVS--SSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRT 1184
            D  V G ++GT+ + DL       +L GH   + S+ F    D + + SLD ++++W+      I TY  +   +  +  +P       SG  DG+  LWD      +     H G +    F+     + +G  D  V+ WD+ T
Sbjct:   74 DLVVAGSQSGTLKIWDLEAAKILRTLTGHKSSIRSLDFHPFGDFVASGSLDTNLKLWDIRRKGCIFTYKGHTDCVNHLRFSPD-GRWIISGGEDGAAKLWDLTAGKIINDFKMHTGPVNCAEFHPKEFLLATGSSDRTVKYWDLET 218          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Medaka
Match: taf5 (TATA-box binding protein associated factor 5 [Source:NCBI gene;Acc:101175542])

HSP 1 Score: 107.842 bits (268), Expect = 3.004e-24
Identity = 56/164 (34.15%), Postives = 85/164 (51.83%), Query Frame = 3
Query:  813 SSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICG-TDAGLIEW 1301
            S  L+GHS  V  + F+   + +L+ S DG++R+W+  T   +  Y  + +P+WD   +P     F SG  D    LW      P+R   GHL  +    F+ + NY+V+G  D  +RLWD+ TGNCVR++    G   I  +AFS  G  +  G TD  ++ W
Sbjct:  484 SKILYGHSGPVYGISFSPDRNYLLSCSEDGTVRLWSLLTFTCLVGYKGHNYPVWDTQFSP-YGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYVVTGSSDRTIRLWDVLTGNCVRIFTGHKGP--IHTLAFSPNGKFLASGATDGRVLLW 644          

HSP 2 Score: 76.2554 bits (186), Expect = 3.112e-14
Identity = 48/151 (31.79%), Postives = 72/151 (47.68%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGT 1280
            GH   VT  +F   S+ ++T S D +IR+W+  TG  +  +T +  PI  +A +P      ASGA DG V LWD      V ++ GH  ++ A+ F + G  + SG  D  VRLWD          E  D +     +   +   E++ GT
Sbjct:  573 GHLADVTCTRFHPNSNYVVTGSSDRTIRLWDVLTGNCVRIFTGHKGPIHTLAFSPN-GKFLASGATDGRVLLWDIGHGLMVSELKGHTDTVYALRFSRDGEILASGSMDNTVRLWD--AAKAFDDLETDDFTAATGHIHLQDNSQELLLGT 720          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Medaka
Match: taf5l (TATA-box binding protein associated factor 5 like [Source:NCBI gene;Acc:101159161])

HSP 1 Score: 87.8113 bits (216), Expect = 5.831e-18
Identity = 51/162 (31.48%), Postives = 80/162 (49.38%), Query Frame = 3
Query:  819 SLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII-CGTDAGLIEW 1301
            +L GHS  V    F + S  +L+ S D +IR W+  +  +   Y  +A+P+WD+  +P     F S + D +  LW   R  P+R   GHL  +  + F+ + NY+ +G  D  VRLW  + G  VRL+    G   + ++AFS  G  +   G D  +  W
Sbjct:  349 TLRGHSGPVYRTAFLTDSSGLLSCSEDTTIRYWDLGSFTNTVLYQGHAYPVWDVDVSP-CSLYFGSCSQDRTARLWTFSRTYPLRIYAGHLSDVDCIKFHPNSNYLATGSTDKTVRLWSTQQGASVRLFTGHRGP--VLSLAFSPNGKYLASAGEDQRVKLW 507          

HSP 2 Score: 65.4698 bits (158), Expect = 6.288e-11
Identity = 41/148 (27.70%), Postives = 69/148 (46.62%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEII 1271
            GH   V  ++F   S+ + T S D ++R+W+ + G S+  +T +  P+  +A +P      AS   D  V LWD       + + GH  S+ ++ F    + + S   D  VR+WDIR+ +       ADGS       +S   N ++
Sbjct:  436 GHLSDVDCIKFHPNSNYLATGSTDKTVRLWSTQQGASVRLFTGHRGPVLSLAFSPN-GKYLASAGEDQRVKLWDLASGTLFKDLRGHTDSVTSLSFSPDSSLVASSSMDNSVRVWDIRSSHS---GTPADGSSSELVGLYSGNTNNVL 579          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Medaka
Match: ol-gb1 (guanine nucleotide-binding protein beta subunit [Source:NCBI gene;Acc:100049498])

HSP 1 Score: 81.6481 bits (200), Expect = 2.101e-16
Identity = 54/159 (33.96%), Postives = 83/159 (52.20%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRK-MIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH+  ++  +F    +QI+TSS D S  +W+ ETG    T+  +   +  ++  P     F SGA D S  LWD  RE   R+   GH   I A+ F+ +GN   +G DD   RL+D+R    + ++   +   GI +VAFS++G  ++ G D
Sbjct:  135 VSRELAGHTGYLSCCRFLDD-NQIVTSSGDTSCALWDIETGQQTTTFAGHTGDVMSLSLAPDTRL-FVSGACDASAKLWDI-REGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMIYSHDNIICGITSVAFSKSGRLLLAGYD 290          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Medaka
Match: ol-gb1 (guanine nucleotide-binding protein beta subunit [Source:NCBI gene;Acc:100049498])

HSP 1 Score: 80.8777 bits (198), Expect = 2.489e-16
Identity = 54/159 (33.96%), Postives = 83/159 (52.20%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRK-MIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH+  ++  +F    +QI+TSS D S  +W+ ETG    T+  +   +  ++  P     F SGA D S  LWD  RE   R+   GH   I A+ F+ +GN   +G DD   RL+D+R    + ++   +   GI +VAFS++G  ++ G D
Sbjct:  135 VSRELAGHTGYLSCCRFLDD-NQIVTSSGDTSCALWDIETGQQTTTFAGHTGDVMSLSLAPDTRL-FVSGACDASAKLWDI-REGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMIYSHDNIICGITSVAFSKSGRLLLAGYD 290          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Medaka
Match: ol-gb1 (guanine nucleotide-binding protein beta subunit [Source:NCBI gene;Acc:100049498])

HSP 1 Score: 80.8777 bits (198), Expect = 2.489e-16
Identity = 54/159 (33.96%), Postives = 83/159 (52.20%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRK-MIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH+  ++  +F    +QI+TSS D S  +W+ ETG    T+  +   +  ++  P     F SGA D S  LWD  RE   R+   GH   I A+ F+ +GN   +G DD   RL+D+R    + ++   +   GI +VAFS++G  ++ G D
Sbjct:  135 VSRELAGHTGYLSCCRFLDD-NQIVTSSGDTSCALWDIETGQQTTTFAGHTGDVMSLSLAPDTRL-FVSGACDASAKLWDI-REGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMIYSHDNIICGITSVAFSKSGRLLLAGYD 290          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Planmine SMEST
Match: SMESG000026747.1 (SMESG000026747.1)

HSP 1 Score: 989.949 bits (2558), Expect = 0.000e+0
Identity = 480/482 (99.59%), Postives = 482/482 (100.00%), Query Frame = 3
Query:   87 MKKIGDLNNALENLFNKNGILRCSYFSVFEPHFEDLIQEFRRCFLYFIDTNNPKHDIIFFFYSILSHLTNEYLHVDVSKAKQFFDESLLLIHGKIANLELNLEEIYFEDVVSQNCKYFVKLIELSKEDHEIFVDAIRQTESAYLPVFLRQNIVIRVVAEDPGNMGNASATESLEIKHLEEAINNLEKQIETNPVNDLVNFSVVTVNGAGLGISAGRIGDRSWDRAVFGRENGTVVVADLSGVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIEWMGIEGSARVPLHLEETISNIVCHQKDRVIASTINGGLYLLDQTRLVSRQCENQFSRIINIQKQSDQGNQALILREFE 1532
            MKKIGDLNNALENLFNKNGILRCSYFSVFEPHFEDLIQEFRRCFLYFIDTNNPKHDIIFFFYSILSHLTNEYLHVDVSKAKQFFDESLLLIHGKIANLELNLEEIYFEDVVSQNCKYFVKLIELSKEDHEIFVDAIRQTESAYLPVFLRQNIVIRVVAEDPGNMGNASATESLEIKHLEEAINNLEKQIETNPVNDLVNFSVVTVNGAGLGISAGRIGDRSWDRAVFGRENGTVVVADLSGVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIEWMGIEGSARVPLHLEETISNIVCHQKDRVIASTINGGL+LLDQTRLVSRQCENQFSRIINIQKQSDQGNQAL+LREFE
Sbjct:    1 MKKIGDLNNALENLFNKNGILRCSYFSVFEPHFEDLIQEFRRCFLYFIDTNNPKHDIIFFFYSILSHLTNEYLHVDVSKAKQFFDESLLLIHGKIANLELNLEEIYFEDVVSQNCKYFVKLIELSKEDHEIFVDAIRQTESAYLPVFLRQNIVIRVVAEDPGNMGNASATESLEIKHLEEAINNLEKQIETNPVNDLVNFSVVTVNGAGLGISAGRIGDRSWDRAVFGRENGTVVVADLSGVSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIEWMGIEGSARVPLHLEETISNIVCHQKDRVIASTINGGLFLLDQTRLVSRQCENQFSRIINIQKQSDQGNQALVLREFE 482          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Planmine SMEST
Match: SMESG000013017.1 (SMESG000013017.1)

HSP 1 Score: 100.138 bits (248), Expect = 6.387e-22
Identity = 61/188 (32.45%), Postives = 101/188 (53.72%), Query Frame = 3
Query:  789 VVADLSG-VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGH-LGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDAGLIE-W-MGIEGSARVPLHL 1340
            ++A++SG V   L GH+  V  + +++  +Q+LT+S DG++R+W   T  ++  Y D   P+W +   P      A+G  D  V L+ A    P+R+ +G   G +  V F+ + NY+ SG  D  VRL+DIR+G  VR +    G+  +  + FS+ G  ++ G DAG +  W +GI       L+L
Sbjct:  412 IMANMSGAVYKELKGHAGGVYDIAWSTDRNQVLTASSDGTVRLWCMMTWTNLAKYQDGGEPLWAVDFAPVYGHYLATGGNDRCVNLYAADNLKPLRRFVGDCYGPVTCVKFHNNVNYVASGSTDRVVRLFDIRSGGMVRSFTGHKGT--LNCLQFSDDGRFLLSGCDAGSVNIWDLGIPSGLMDSLNL 597          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Planmine SMEST
Match: SMESG000018712.1 (SMESG000018712.1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.735e-16
Identity = 51/158 (32.28%), Postives = 82/158 (51.90%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH+  ++  +F    +QI+TSS D +  +W+ ETG  + T+T +   +  ++  P +   F SGA D S  LWD       +   GH   I A+ F+ +G    +G DD   RL+DIR    + ++   +   GI +VAFS++G  ++ G D
Sbjct:  135 VSRELPGHTGYLSCCRFIDD-NQIVTSSGDVTCGLWDIETGQQVATFTGHTGDVMSLSLAPDMRT-FVSGACDASAKLWDLRDGQCKQTFPGHESDINAITFFPNGQAFATGSDDATCRLFDIRADQEIGMFSHDNIICGITSVAFSKSGRLLLGGYD 290          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Planmine SMEST
Match: SMESG000005136.1 (SMESG000005136.1)

HSP 1 Score: 77.7962 bits (190), Expect = 6.059e-15
Identity = 48/156 (30.77%), Postives = 81/156 (51.92%), Query Frame = 3
Query:  828 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHL-GSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGI-EAVAFSETGNEIICGTDAG 1289
            GHS  V  + ++     ++++S DG+++ W   T   I T++    PIW +  +P  +     G    S+ ++     NP+R+    + G++  V F+ + NY+ SGG D  VRL+DIR+G  VR   +  G KGI  ++ FS  G  +I G + G
Sbjct:  313 GHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCIATFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPNPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVR---SFTGHKGIVSSLRFSLDGKYLISGCEMG 464          
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Planmine SMEST
Match: SMESG000038555.1 (SMESG000038555.1)

HSP 1 Score: 76.2554 bits (186), Expect = 6.915e-15
Identity = 52/158 (32.91%), Postives = 80/158 (50.63%), Query Frame = 3
Query:  810 VSSSLFGHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTD 1283
            VS  L GH+  ++  +F   S QI+TSS D +  +W+ ETG  +  +T +   +  ++  P     F SGA D S  LWD       +   GH   I AV F+ +G    +G DD   RL+DIR+   + ++       GI +VAFS++G  ++ G D
Sbjct:  135 VSRELPGHTGYLSCCRFLDDS-QIVTSSGDVTCGLWDIETGQQLAAFTGHTGDVMSLSLAPDHRT-FVSGACDASAKLWDLRDGKCKQTFPGHESDINAVTFFPNGFGFATGSDDATCRLFDIRSDQEIGMYSNDSIICGITSVAFSKSGRLLLGGYD 290          
The following BLAST results are available for this feature:
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TAF52.004e-2333.54TATA-box binding protein associated factor 5 [Sour... [more]
TAF5L9.651e-2235.40TATA-box binding protein associated factor 5 like ... [more]
TAF5L9.651e-2235.40TATA-box binding protein associated factor 5 like ... [more]
DAW18.049e-1729.63dynein assembly factor with WD repeats 1 [Source:H... [more]
GNB45.741e-1632.91G protein subunit beta 4 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpb-11.419e-1633.54Guanine nucleotide-binding protein subunit beta-1 ... [more]
gpb-11.419e-1633.54Guanine nucleotide-binding protein subunit beta-1 ... [more]
taf-53.989e-1430.00TAF (TBP-associated transcription factor) family ... [more]
taf-53.989e-1430.00TAF (TBP-associated transcription factor) family ... [more]
taf-53.989e-1430.00TAF (TBP-associated transcription factor) family ... [more]
back to top
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Taf51.423e-2329.37gene:FBgn0010356 transcript:FBtr0088240[more]
Gbeta13F6.838e-1632.28gene:FBgn0001105 transcript:FBtr0331597[more]
Gbeta13F6.838e-1632.28gene:FBgn0001105 transcript:FBtr0074110[more]
Gbeta13F6.838e-1632.28gene:FBgn0001105 transcript:FBtr0074108[more]
Gbeta13F6.838e-1632.28gene:FBgn0001105 transcript:FBtr0074107[more]
back to top
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf59.912e-2535.33TAF5 RNA polymerase II, TATA box binding protein (... [more]
taf5l7.669e-1930.86TAF5-like RNA polymerase II, p300/CBP-associated f... [more]
gnb4b1.864e-1631.65guanine nucleotide binding protein (G protein), be... [more]
gnb1a5.229e-1633.33guanine nucleotide binding protein (G protein), be... [more]
gnb1a5.229e-1633.33guanine nucleotide binding protein (G protein), be... [more]
back to top
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myadm3.900e-2431.89myeloid-associated differentiation marker [Source:... [more]
myadm6.973e-2431.89myeloid-associated differentiation marker [Source:... [more]
myadm1.018e-2331.89myeloid-associated differentiation marker [Source:... [more]
rxfp34.457e-2136.65relaxin family peptide receptor 3 [Source:Xenbase;... [more]
rxfp34.928e-2136.65relaxin family peptide receptor 3 [Source:Xenbase;... [more]
back to top
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Taf51.081e-2333.54TATA-box binding protein associated factor 5 [Sour... [more]
Taf5l1.473e-2134.78TATA-box binding protein associated factor 5 like ... [more]
Taf5l1.473e-2134.78TATA-box binding protein associated factor 5 like ... [more]
Daw11.405e-1730.69dynein assembly factor with WDR repeat domains 1 [... [more]
Wdr5b5.711e-1730.52WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:191... [more]
back to top
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15542|TAF5_HUMAN9.623e-2333.54Transcription initiation factor TFIID subunit 5 OS... [more]
sp|P49846|TAF5_DROME1.426e-2229.37Transcription initiation factor TFIID subunit 5 OS... [more]
sp|Q8C092|TAF5_MOUSE1.770e-2232.92Transcription initiation factor TFIID subunit 5 OS... [more]
sp|O74319|TAF73_SCHPO2.506e-2232.30Transcription initiation factor TFIID subunit taf7... [more]
sp|Q6S7B0|TAF5_ARATH6.555e-2230.00Transcription initiation factor TFIID subunit 5 OS... [more]
back to top
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L0DLT81.089e-2633.18Transcription initiation factor TFIID subunit 5 OS... [more]
A0A2V3IRN21.698e-2432.46Transcription initiation factor TFIID subunit 5 OS... [more]
A0A3L6VXM66.948e-2432.97WD_REPEATS_REGION domain-containing protein (Fragm... [more]
A0A067CL811.199e-2328.25WD_REPEATS_REGION domain-containing protein OS=Sap... [more]
A0A396ZY901.416e-2332.61WD_REPEATS_REGION domain-containing protein (Fragm... [more]
back to top
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf51.323e-2434.78TATA-box binding protein associated factor 5 [Sour... [more]
taf51.323e-2434.78TATA-box binding protein associated factor 5 [Sour... [more]
taf5l4.186e-1930.25TATA-box binding protein associated factor 5 like ... [more]
gnb4b1.978e-1732.91guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
gnb4b2.564e-1732.91guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
back to top
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf5l3.016e-2030.41TAF5-like RNA polymerase II, p300/CBP-associated f... [more]
GNB33.102e-1632.28G protein subunit beta 3 [Source:HGNC Symbol;Acc:H... [more]
ENSPMAT00000002506.18.401e-1329.81pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 ... [more]
pafah1b1b1.927e-1227.23platelet-activating factor acetylhydrolase 1b, reg... [more]
POC1A2.898e-1226.09POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TAF57.125e-2128.92Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
PRP469.866e-1424.89Member of the NineTeen Complex (NTC); this complex... [more]
MET303.207e-1129.11F-box protein containing five copies of the WD40 m... [more]
SEC276.508e-1024.64Essential beta'-coat protein of the COPI coatomer;... [more]
STE41.221e-926.92G protein beta subunit; forms a dimer with Ste18p ... [more]
back to top
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO292884.316e-2631.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330606.317e-2531.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408443.287e-1834.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431586.590e-1830.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
KATNB17.512e-1629.82Katanin p80 WD40 repeat-containing subunit B1 [So... [more]
back to top
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf53.004e-2434.15TATA-box binding protein associated factor 5 [Sour... [more]
taf5l5.831e-1831.48TATA-box binding protein associated factor 5 like ... [more]
ol-gb12.101e-1633.96guanine nucleotide-binding protein beta subunit [S... [more]
ol-gb12.489e-1633.96guanine nucleotide-binding protein beta subunit [S... [more]
ol-gb12.489e-1633.96guanine nucleotide-binding protein beta subunit [S... [more]
back to top
BLAST of U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026747.10.000e+099.59SMESG000026747.1[more]
SMESG000013017.16.387e-2232.45SMESG000013017.1[more]
SMESG000018712.13.735e-1632.28SMESG000018712.1[more]
SMESG000005136.16.059e-1530.77SMESG000005136.1[more]
SMESG000038555.16.915e-1532.91SMESG000038555.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031203 ID=SMED30031203|Name=U4/U6 X U5 tri-snRNP complex subunit Prp4 family protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1567bp
CTCATGTGATTTTATTTCAAATTATAAATTAATTTCATTTGTAGTTAATT
TTTATTAAATCATAAATCATAAATCAAGTTTAATTAATGAAAAAAATAGG
TGATTTAAATAATGCCCTGGAAAATTTATTCAACAAAAACGGCATATTAC
GATGTAGTTATTTTAGTGTTTTTGAGCCACATTTTGAGGATCTTATTCAA
GAATTCCGCAGATGCTTTCTGTATTTTATTGATACGAATAATCCAAAACA
TGACATAATTTTCTTTTTCTACTCAATTCTCAGCCATTTAACAAATGAAT
ATTTGCATGTAGATGTTTCAAAAGCTAAACAATTTTTTGATGAATCCCTT
TTGCTTATTCACGGGAAAATTGCTAATTTAGAATTGAATCTAGAGGAAAT
ATATTTCGAAGATGTCGTTTCTCAGAACTGCAAATATTTCGTGAAATTGA
TCGAATTAAGCAAAGAAGATCACGAAATATTTGTCGATGCCATCAGACAA
ACCGAGAGCGCATATTTGCCGGTCTTTCTCAGACAGAATATTGTTATAAG
AGTCGTTGCAGAGGATCCCGGAAACATGGGGAACGCCAGTGCTACTGAGA
GCCTGGAAATAAAACACCTAGAGGAAGCAATCAATAATCTGGAAAAACAA
ATTGAAACGAACCCGGTCAATGATTTGGTGAATTTCTCGGTTGTCACGGT
GAATGGAGCTGGCCTGGGAATATCAGCCGGGCGCATCGGAGATCGCAGCT
GGGATCGAGCCGTATTTGGCAGGGAGAATGGAACGGTTGTCGTAGCGGAT
TTGTCGGGCGTTTCCAGCTCGCTATTCGGCCATTCAATGATGGTAACAAG
CGTTCAGTTCACCAGCCAATCGGATCAAATTCTCACCAGTTCATTGGATG
GATCAATAAGAGTGTGGAACGAAGAGACAGGTGTCTCCATCGAAACGTAC
ACCGACAATGCGTTTCCGATTTGGGACATCGCGTCTAATCCTAGAATTGA
TGCCTGCTTTGCCAGCGGGGCATTCGACGGCTCTGTCTGCCTCTGGGACG
CCCATAGAGAGAATCCTGTACGAAAAATGATTGGCCATTTGGGATCGATT
AAAGCAGTTCTTTTCTATAAATCGGGTAATTATATGGTGAGTGGAGGCGA
TGACGGACAGGTGAGACTGTGGGACATCCGGACGGGGAATTGCGTCCGGT
TATGGGAGGCAGCAGACGGGTCAAAGGGCATTGAAGCGGTTGCATTTAGC
GAGACCGGCAATGAGATAATCTGTGGAACCGACGCTGGATTGATCGAATG
GATGGGAATCGAGGGAAGCGCGCGCGTTCCACTGCACTTGGAGGAGACAA
TCTCAAATATAGTGTGCCACCAGAAAGATAGAGTGATTGCAAGCACGATA
AATGGTGGTCTCTACTTGCTGGACCAAACCAGGCTTGTATCTAGGCAATG
TGAGAATCAGTTCAGCAGGATCATCAATATCCAGAAGCAATCGGATCAAG
GCAATCAGGCGCTTATCCTGCGGGAGTTTGAGTGATCCGATTTGTTAATG
AATAAATTATTATGTCA
back to top

protein sequence of SMED30031203-orf-1

>SMED30031203-orf-1 ID=SMED30031203-orf-1|Name=SMED30031203-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=483bp
MKKIGDLNNALENLFNKNGILRCSYFSVFEPHFEDLIQEFRRCFLYFIDT
NNPKHDIIFFFYSILSHLTNEYLHVDVSKAKQFFDESLLLIHGKIANLEL
NLEEIYFEDVVSQNCKYFVKLIELSKEDHEIFVDAIRQTESAYLPVFLRQ
NIVIRVVAEDPGNMGNASATESLEIKHLEEAINNLEKQIETNPVNDLVNF
SVVTVNGAGLGISAGRIGDRSWDRAVFGRENGTVVVADLSGVSSSLFGHS
MMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIAS
NPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHLGSIKAVLFYKSGNYM
VSGGDDGQVRLWDIRTGNCVRLWEAADGSKGIEAVAFSETGNEIICGTDA
GLIEWMGIEGSARVPLHLEETISNIVCHQKDRVIASTINGGLYLLDQTRL
VSRQCENQFSRIINIQKQSDQGNQALILREFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0046540U4/U6 x U5 tri-snRNP complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR037783Taf5
IPR036322WD40_repeat_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003743translation initiation factor activity
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 168..188
NoneNo IPR availablePANTHERPTHR19879TRANSCRIPTION INITIATION FACTOR TFIIDcoord: 234..401
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 350..364
score: 39.37
coord: 265..279
score: 33.2
coord: 308..322
score: 34.87
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 239..278
e-value: 6.7E-6
score: 35.6
coord: 324..363
e-value: 1.0E-7
score: 41.6
coord: 366..406
e-value: 20.0
score: 8.8
coord: 281..321
e-value: 0.0093
score: 25.2
IPR001680WD40 repeatPFAMPF00400WD40coord: 326..363
e-value: 2.0E-7
score: 31.6
coord: 246..278
e-value: 3.1E-4
score: 21.5
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 331..372
score: 16.29
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 246..287
score: 14.986
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 215..442
e-value: 5.0E-41
score: 142.5
IPR037783Transcription initiation factor TFIID subunit 5PANTHERPTHR19879:SF1CANNONBALL-RELATEDcoord: 234..401
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 350..364
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 246..372
score: 30.69
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 224..436