Peroxidasin

Overview
NamePeroxidasin
Smed IDSMED30031201
Length (bp)3771
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peroxidasin (SMED30031201) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peroxidasin (SMED30031201) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031201

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30031201SMESG000065495.1 SmedASXL_003755SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30031201SMESG000065495.1 dd_Smed_v4_3603_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peroxidasin vs. Ensembl Human
Match: PXDN (peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966])

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 400/922 (43.38%), Postives = 557/922 (60.41%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILREN-KVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP--CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            + +F   +  P+F   PQD  V  G  + F C+ +      + W    +  + +   L   +  L I  V    +G Y C A N  GS    A L + P   P     P+  + E G+ V+  C + G P P ITW     + V++   GK+ +     +  N       GRY C A +  GSA VS V+++               +P  ++  +  +   I +A + ++ A   T   L D +R RS +D+ +LFR P     +E A+A +++E+ L  +   ++    V LN T+ +     +  L++P+ L +I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+ F RL+K  YENG NTP G    +LY+G++ P  RLVS+ L+    +TPD   + M+MQWGQFLDHDLD T V  S +RFSDG  C+  C ND PCF ++ PP D R +    C+ F RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   EA  +RDL    G LR G V  S K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W REHNR++ EL  LN HW+GD IYYE+RKIVGA +QHITY  WLP +LG  G++ LG+Y GY+  +++ I + FATAA RFGHTL+NP+LYRLDENF+ I + +LPLHKAFF+P R++ +GGIDP+LRGLF +  K     Q++N EL E+LF+MAH VALDL A+NIQRGRDHG+  Y+ +R +C +  A TF+D   EI + EIREK++++YG   N+DLF   V+E  V G  +GPTL CLL  QFKRLRDGDR WYE+   F PAQL+QIKQ +LARILCDN+DNI+RVQ +VF +A+    +  C  IPR++L  W++C +  R
Sbjct:  423 ATAFIIVQALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTKGGSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDTTVEVGANVQLPCSSQGEPEPAITW---NKDGVQVTESGKFHISPEGFLTINDVGPADAGRYECVARNTIGSASVSMVLSV--------------NVPDVSRNGDPFVATSIVEAIATVDRAINSTRTHLFD-SRPRSPNDLLALFRYPRDPYTVEQARAGEIFERTLQLIQEHVQHGLMVDLNGTSYH-----YNDLVSPQYLNLIANLSGCTAHRRVNNCSD-MCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNTPRGINPHRLYNGHALPMPRLVSTTLIGTETVTPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQHCSNVCSNDPPCFSVMIPPNDSRARSGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQLTSYIDASNVYGSTEHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLKLNPHWDGDTIYYETRKIVGAEIQHITYQHWLPKILGEVGMRTLGEYHGYDPGINAGIFNAFATAAFRFGHTLVNPLLYRLDENFQPIAQDHLPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRVPSQLLNTELTERLFSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAHTFEDLKNEIKNPEIREKLKRLYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQFKRLRDGDRLWYENPGVFSPAQLTQIKQTSLARILCDNADNITRVQSDVFRVAEFPHGYGSCDEIPRVDLRVWQDCCEDCR 1320          

HSP 2 Score: 107.842 bits (268), Expect = 8.094e-23
Identity = 101/409 (24.69%), Postives = 166/409 (40.59%), Query Frame = 1
Query:  235 GQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSL---------PG---------------NSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLRRI---GLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQW----LFIKEVHEFHEGIYICTASNNKGSI-SASAKLK-IAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            G  C  +C C   TV C     + +P +   + + L L         PG               N I +I +  F++ ++L ++ L  N+I  ++  A  G   LE LYL  N IE L    F       +L    N     +P +   L ++KRL L  N L+C CE+ + A  L+     G     + C+ P  ++ + +  +   EL C          P+    PQDA V  G+ + F C+ E   + ++ W    N+ +  +    N      L I+   E  +GIY C A N  G + +    L+      +P  V  P +     G  V   C A G+P P I+  W + ++  L  + +  I     L I+N+ + +  G Y C A++   S   +A I +
Sbjct:   33 GAGCPSRCLCFRTTVRCMHLLLEAVPAVA-PQTSILDLRFNRIREIQPGAFRRLRNLNTLLLNNNQIKRIPSGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKLERLFLHNNRITHLVPGTFNHLESMKRLRLDSNTLHCDCEILWLADLLKTYAESGNAQAAAICEYPRRIQGRSVATITPEELNCER--------PRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWLRNNNELSMKTDSRLNLLDDGTLMIQNTQETDQGIYQCMAKNVAGEVKTQEVTLRYFGSPARPTFVIQPQNTEVLVGESVTLECSATGHPPPRIS--WTRGDRTPLPVDPRVNITPSGGLYIQNVVQGD-SGEYACSATNNIDSVHATAFIIV 429          
BLAST of Peroxidasin vs. Ensembl Human
Match: PXDNL (peroxidasin like [Source:HGNC Symbol;Acc:HGNC:26359])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 364/916 (39.74%), Postives = 519/916 (56.66%), Query Frame = 1
Query:  817 PKFIERPQDAYVAVGDKIRFACQVENINETKVEWH-------FQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL--IRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYE-ETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTP--IGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPR-VQRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVG-PVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKEC 3519
            P+F   P+D  V     + + C+ +      + W         +   T  +S   R     I    +  +G Y C A ++ G    S +L + P       + P   S E G  +  SC A G P P ITW       V++   GK+ V     +         +GRY C A +  G A  +  +T+  I+ +   +   ESS                I DA  +++ A   T   L    +  + SD+ + F  P     +E+A+A +++E  L     ++RE +VK  LT   E +   +  L++P  L++I+ LSGC       +CS + CFH KYR+ DG CNNL  P  G+AL+ F RL++P Y +GI  P  +G   G        P  RLV++   RA  +TPD + + M+M WG FL+HDLD T    S +RFSDG  C+  C ND PCFP+ T   DPR    PC+ F+RS   C SG+ S  +  ++ REQ+NQ T+++DGSNVY S   E+  LRD +   G L+ G P  PS K LLPF+     +C     ++  PCF AGDHR NE+L L  MHT+W REHNR++ EL  LN HW G+ +Y E+RKIVGA +QHITY+ WLP VLG  G + L  Y GYN  V++ I + FATAA RFGHTLINPILYRL+     I EG+LP HKA F+P R++++GGIDP+LRGLF + +K      +++ EL ++LF+ A+  A+D  A  IQRGRDHG+  Y  +R FC +   + F+D   EI  SEIR+K+R++YG PG++DL+   ++E  + G  VGPTL CL + QF+RLRDGDRFWYE+   F PAQL+Q+KQ +L+R+LCDN D+I +VQ +VF  A+   ++++CS IP+++L  W++C
Sbjct:  419 PQFTVTPKDQVVLEEHAVEWLCEADGNPPPVIVWTKTGGQLPVEGQHTVLSSGTLR-----IDRAAQHDQGQYECQAVSSLGVKKVSVQLTVKPKALAVFTQLPQDTSVEVGKNINISCHAQGEPQPIITW---NKEGVQITESGKFHVDDEGTLTIYDAGFPDQGRYECVARNSFGLAVTNMFLTVTAIQGRQAGDDFVESS----------------ILDAVQRVDSAINSTRRHLFS-QKPHTSSDLLAQFHYPRDPLIVEMARAGEIFEHTLQ----LIRE-RVKQGLTVDLEGKEFRYNDLVSPRSLSLIANLSGCTARRPLPNCSNR-CFHAKYRAHDGTCNNLQQPTWGAALTAFARLLQPAYRDGIRAPRGLGLPVGSRQ---PLPPPRLVATVWARAAAVTPDHSYTRMLMHWGWFLEHDLDHTVPALSTARFSDGRPCSSVCTNDPPCFPMNTRHADPRGTHAPCMLFARSSPACASGRPSATVDSVYAREQINQQTAYIDGSNVYGSSERESQALRDPSVPRGLLKTGFPWPPSGKPLLPFSTGPPTECARQEQES--PCFLAGDHRANEHLALAAMHTLWFREHNRMATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPKVLGDPGTRMLRGYRGYNPNVNAGIINSFATAAFRFGHTLINPILYRLNATLGEISEGHLPFHKALFSPSRIIKEGGIDPVLRGLFGVAAKWRAPSYLLSPELTQRLFSAAYSAAVDSAATIIQRGRDHGIPPYVDFRVFCNLTSVKNFEDLQNEIKDSEIRQKLRKLYGSPGDIDLWPALMVEDLIPGTRVGPTLMCLFVTQFQRLRDGDRFWYENPGVFTPAQLTQLKQASLSRVLCDNGDSIQQVQADVFVKAEYPQDYLNCSEIPKVDLRVWQDC 1298          

HSP 2 Score: 100.908 bits (250), Expect = 1.035e-20
Identity = 109/409 (26.65%), Postives = 173/409 (42.30%), Query Frame = 1
Query:  235 GQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXX-----------------------ANNRLKTLPI-SLEKLINVKRLELYGNMLYCGCELRYFAGNLRRI---GLDFQKSQCQSPMNVKNQFLEEVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEW-HFQF-----NDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSI-SASAKLKIAP-NQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            G  C  +C C + TV C       IP++  ++ T L L  N I +I  + FK+ K+L  + L+ N I  +  NA  G   L  LYL  N I  L +Q F        L                           NN+L  +P  S   L ++KRL L  N L C C+L +    L+     G     + C+ P  +  + +  V   E    S       P+    PQD  V  G+ + F C+ E   + ++ W H        +DT  N   + +  L I+   E  +G+Y C A N+ G   + SA L+ +    KP  V  P       G+     C A G+P P IT  W + N + L+   +++   + L ++NIT+ +  GR+ C+A++  G+ + +A I +
Sbjct:   21 GLPCPSRCLCFKSTVRCMHLMLDHIPQV-PQQTTVLDLRFNRIREIPGSAFKKLKNLNTLLLNNNHIRKISRNAFEGLENLLYLYLYKNEIHALDKQTFKGLISLEHLYIHFNQLEMLQPETFGDLLRLERLFLHNNKLSKIPAGSFSNLDSLKRLRLDSNALVCDCDLMWLGELLQGFAQHGHTQAAATCEYPRRLHGRAVASVTVEEFNCQS-------PRITFEPQDVEVPSGNTVYFTCRAEGNPKPEIIWIHNNHSLDLEDDTRLN--VFDDGTLMIRNTRESDQGVYQCMARNSAGEAKTQSAMLRYSSLPAKPSFVIQPQDTEVLIGTSTTLECMATGHPHPLIT--WTRDNGLELDGS-RHVATSSGLYLQNITQRD-HGRFTCHANNSHGTVQAAANIIV 415          

HSP 3 Score: 59.6918 bits (143), Expect = 4.869e-8
Identity = 49/188 (26.06%), Postives = 84/188 (44.68%), Query Frame = 1
Query:  817 PKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSL-------YWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKI-APNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            P F+ +PQD  V +G      C         + W      T  N L          +  L+++ + +   G + C A+N+ G++ A+A + + AP Q  + V     +  E+ + VE+ C A G P P I  +W K+   +L  EG++ V  +  +  +      +G+Y C A S  G  KVS  +T+
Sbjct:  330 PSFVIQPQDTEVLIGTSTTLECMATGHPHPLITW------TRDNGLELDGSRHVATSSGLYLQNITQRDHGRFTCHANNSHGTVQAAANIIVQAPPQ--FTVTPKDQVVLEEHA-VEWLCEADGNPPPVI--VWTKTGG-QLPVEGQHTVLSSGTLRIDRAAQHDQGQYECQAVSSLGVKKVSVQLTV 505          
BLAST of Peroxidasin vs. Ensembl Human
Match: PXDNL (peroxidasin like [Source:HGNC Symbol;Acc:HGNC:26359])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 275/569 (48.33%), Postives = 374/569 (65.73%), Query Frame = 1
Query: 1825 NNLINPRRGSALSPFYRLMKPEYENGINTP--IGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPR-VQRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVG-PVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKEC 3519
            NNL  P  G+AL+ F RL++P Y +GI  P  +G   G        P  RLV++   RA  +TPD + + M+M WG FL+HDLD T    S +RFSDG  C+  C ND PCFP+ T   DPR    PC+ F+RS   C SG+ S  +  ++ REQ+NQ T+++DGSNVY S   E+  LRD +   G L+ G P  PS K LLPF+     +C     +   PCF AGDHR NE+L L  MHT+W REHNR++ EL  LN HW G+ +Y E+RKIVGA +QHITY+ WLP VLG  G + L  Y GYN  V++ I + FATAA RFGHTLINPILYRL+     I EG+LP HKA F+P R++++GGIDP+LRGLF + +K      +++ EL ++LF+ A+  A+D  A  IQRGRDHG+  Y  +R FC +   + F+D   EI  SEIR+K+R++YG PG++DL+   ++E  + G  VGPTL CL + QF+RLRDGDRFWYE+   F PAQL+Q+KQ +L+R+LCDN D+I +VQ +VF  A+   ++++CS IP+++L  W++C
Sbjct:    1 NNLQQPTWGAALTAFARLLQPAYRDGIRAPRGLGLPVGSRQ---PLPPPRLVATVWARAAAVTPDHSYTRMLMHWGWFLEHDLDHTVPALSTARFSDGRPCSSVCTNDPPCFPMNTRHADPRGTHAPCMLFARSSPACASGRPSATVDSVYAREQINQQTAYIDGSNVYGSSERESQALRDPSVPRGLLKTGFPWPPSGKPLLPFSTGPPTECARQ--EQESPCFLAGDHRANEHLALAAMHTLWFREHNRMATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPKVLGDPGTRMLRGYRGYNPNVNAGIINSFATAAFRFGHTLINPILYRLNATLGEISEGHLPFHKALFSPSRIIKEGGIDPVLRGLFGVAAKWRAPSYLLSPELTQRLFSAAYSAAVDSAATIIQRGRDHGIPPYVDFRVFCNLTSVKNFEDLQNEIKDSEIRQKLRKLYGSPGDIDLWPALMVEDLIPGTRVGPTLMCLFVTQFQRLRDGDRFWYENPGVFTPAQLTQLKQASLSRVLCDNGDSIQQVQADVFVKAEYPQDYLNCSEIPKVDLRVWQDC 564          
BLAST of Peroxidasin vs. Ensembl Human
Match: EPX (eosinophil peroxidase [Source:HGNC Symbol;Acc:HGNC:3423])

HSP 1 Score: 522.702 bits (1345), Expect = 9.629e-170
Identity = 284/717 (39.61%), Postives = 409/717 (57.04%), Query Frame = 1
Query: 1390 ESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRS--DIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLR--AHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRV--QRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKR-LLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKR-LGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFE-TIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWK 3513
            E +   S   ++   L + I +A+  ++ A+  T + ++   R  S S  D+ S F+QP  A   + +A+D     L    G+L E      L        + T +LT  QL ++SQ SGC    +   CS       KYR+I G+CNN   P  G++     R +  EYE+G++ P GWT  +  +G+  P  R VS++++R    ++T D   + M MQWGQF+DHDLDF+P   +   F+ G+ C  TC    PCFPI  PP DPR+  QR CI F RS  +C   ++ +       R Q+N +TSF+D S VY S+   +  LR+ T   G L +      N R LLPF+      C +    A +PCF AGD R+ E   L  MHT++MREHNRL+ ELR LN  WNGDK+Y E+RKI+GAM+Q ITY  +LP+VLG    +R LG Y GY   VD  +++VF T A RFGHT++ P ++RLD  +  + P  ++PL  AFFA  R++ +GGIDPILRGL A  +K  + D ++  EL ++LF     + LDL ALN+QR RDHGL  YN+WR FCG+ +       S  + + ++  K   +YG P N+D++ GA+ E  + G  VGP L+CL  +QF+R RDGDRFW++    F   Q   + +++L+RI+CDN+  I+ V R++F        F++CS IPRLNL  W+
Sbjct:   21 EGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKSIKQRLRSGSASPMDLLSYFKQPVAATRTVVRAADYMHVAL----GLLEEK-----LQPQRSGPFNVTDVLTEPQLRLLSQASGCALRDQAERCSD------KYRTITGRCNNKRRPLLGASNQALARWLPAEYEDGLSLPFGWTPSRRRNGFLLPLVRAVSNQIVRFPNERLTSDRGRALMFMQWGQFIDHDLDFSPESPARVAFTAGVDCERTCAQLPPCFPIKIPPNDPRIKNQRDCIPFFRSAPSCPQNKNRV-------RNQINALTSFVDASMVYGSEVSLSLRLRNRTNYLGLLAINQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSTETPKLAAMHTLFMREHNRLATELRRLNPRWNGDKLYNEARKIMGAMVQIITYRDFLPLVLGKARARRTLGHYRGYCSNVDPRVANVF-TLAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDPILRGLMATPAKLNRQDAMLVDELRDRLFRQVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTKRQRKALSRISLSRIICDNT-GITTVSRDIFRANIYPRGFVNCSRIPRLNLSAWR 713          
BLAST of Peroxidasin vs. Ensembl Human
Match: MPO (myeloperoxidase [Source:HGNC Symbol;Acc:HGNC:7218])

HSP 1 Score: 522.702 bits (1345), Expect = 2.154e-169
Identity = 291/748 (38.90%), Postives = 425/748 (56.82%), Query Frame = 1
Query: 1303 CYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQ--SLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLR--AHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRV--QRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKR-LLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKR-LGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETI-PEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKS-KLEFIDCSNIPRLNLIPWKE 3516
            C+A  L+   K+   +  + +        E +      ++    +   +++A+  ++ A+K+  E ++   R  S S ++  S F+QP  A     +A+D     LD L   LR         + +    + T +LTP QL ++S+ SGC      + C +Q     KYR+I G CNN  +P  G++   F R +  EYE+G + P GWT G   +G+    AR VS+ ++R    ++TPD   S M MQWGQ LDHDLDFTP  A+ + F  G+ C  +CV   PCFP+  PP DPR+  Q  CI F RS   C     +I       R Q+N +TSF+D S VY S+   A  LR+++   G L V      N R LLPF+      C +    A +PCF AGD R++E   L  MHT+ +REHNRL+ EL+ LN  W+G+++Y E+RKIVGAM+Q ITY  +LP+VLG   +++ L  Y  YND VD  I++VF T A R+GHTLI P ++RLD  ++ + P   +PL + FFA  RV+ +GGIDPILRGL A  +K  + +Q+   E+ E+LF     + LDL ALN+QR RDHGL  YN+WR FCG+ + ET       + + ++  K+ + YG P N+D++ G V E     G VGP L+C++  QF++LRDGDRFW+E+   F   Q   + Q++L RI+CDN+  I+ V +N  FM+ S   +F++CS +P LNL  W+E
Sbjct:   18 CWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLHVALDLLERKLR---------SLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQ----DKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITI-------RNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVF-TNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNT-GITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWRE 743          
BLAST of Peroxidasin vs. Ensembl Celegans
Match: pxn-1 (Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q1ENI8])

HSP 1 Score: 711.064 bits (1834), Expect = 0.000e+0
Identity = 375/922 (40.67%), Postives = 550/922 (59.65%), Query Frame = 1
Query:  814 APKFIERPQDAYVAVGDKIRFACQVENINETKVEWHF---QFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNN--LVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFR-QPSLAALELAKASDVYEKVLDDLTGILRENKVK---LNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR-----PCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAH-VPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGI--KRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVF-FMAKSKLEFIDCSNIPRLNLIPWKECYD 3525
            +P+F  +P+D     G +++  C+V    +  + W+    +F  +    L   N  L I    E   G Y C A N+ G +  +  L +  +  P I EGP S+S   G  V F C+A+G PVP+ TW +  S    ++  G+++V  +   L I NI E + EG Y C A +  G+    A +T+I  +         ++  +  ++  E L  I + A+  +  A +KT ++L   ++  + +D++ LFR      A+EL+KA ++YE+ +     ++RE+  K   LN+   + + + + ++L    +  +  LSGC     +  C+   CFH +YRS DG+CNN   P  G +L P  RL+KP YENG NTP+GW  G+LY+GY  P+ R VS +L+    ITP   LS+MVMQWGQF+DHDL  T    S   ++ G  CN TC N  PCF I   P DPRV+      PCI F RS A CGSG++S++  ++ YREQ+N +TSFLD SNVY S+ ++A ELRD   + G LR    + + K  LPF     +DC+ + ++ + + CF AGD R NE L L   HTI++REHNR++ +L+ +N +W+G+ IY+E+RKIVGAMMQHITY  W+PI+ G +    K +G Y GY+  VD+++++ FATAA RFGHT+INP L+RL  +F  I EG++ LHKAFF P+ V+  GG+DP+LRGLFA   K     Q++N ELIEKLF   HEV+LDL  +NIQR RDHGL SY  +R+FC +     ++D  G I    I +K+R +YG P N+DL+ G ++E+K+  GL GPT +C++ +QF+++RDGDRFWYE    F P QL +IK++TLAR+ CDN DNI R+Q++VF +    K  +  C     +NL  W +C D
Sbjct:  314 SPQFTYKPRDNSFREGSEVKVNCEVMGNPKPTINWYHNGKRFISSRKRQLGLSNNVLRIYPFLEEDSGRYTCEAVNSVGKVRHAFSLDLISSVPPNIYEGPQSVSQNLGGSVVFVCKANGNPVPDYTWSFDGSTIGHIK--GRFMVSDDGTELRISNI-EKKDEGYYSCMAGNPVGAMSADAKLTVIGGE---------TRKAAAPQIDEELLRAIAQKARQNVENAVEKTRKQLTQ-DKVTNTNDLKRLFRFSTPKQAVELSKAREIYEESVR----LVREHVEKGLILNVDELHPKNVSYESVLHVTHVQALMGLSGCHTGQYKNPCTDT-CFHHRYRSFDGQCNNKNKPMTGVSLMPLRRLLKPVYENGFNTPVGWEKGRLYNGYPLPNVREVSRQLVATENITPHSKLSSMVMQWGQFVDHDLTHTVTALSRHSYATGAFCNRTCENLDPCFNIPLSPNDPRVKSGSAKYPCIEFERSAAVCGSGETSLVFNRVTYREQMNALTSFLDASNVYGSNEVQAQELRDTYNNNGMLRFDITSEAGKEYLPFEKDSNMDCRRNFSEENPIRCFLAGDLRANEQLALAATHTIFIREHNRIAKKLKSMNGNWDGEIIYHETRKIVGAMMQHITYKHWMPIIFGGQAQMNKFVGTYQGYDPDVDASVTNAFATAAFRFGHTIINPSLFRLGNDFMPIKEGHIALHKAFFTPELVLTQGGVDPLLRGLFASPLKHPMPTQLLNMELIEKLFMKGHEVSLDLAVMNIQRSRDHGLPSYTEYRKFCNLPVPVQWEDMKGYIKDDMIIQKLRGLYGVPQNIDLWVGGIVEEKLENGLFGPTFACIIGEQFRKIRDGDRFWYEKDGVFTPEQLREIKKITLARLFCDNGDNIDRIQKDVFMYPGMDKENYGTCQETEMMNLRAWSKCCD 1217          

HSP 2 Score: 87.0409 bits (214), Expect = 6.872e-17
Identity = 97/437 (22.20%), Postives = 182/437 (41.65%), Query Frame = 1
Query:  172 MNFFIVIIFLGSLNFLSVSTTGQECLPQCRCTEK--TVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENAL-----------------YGPIF------LETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISL-EKLINVKRLELYGNMLYCGCELRYFAGNLRRIGLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQK------------PYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRS 1365
            MN +++++ + + ++  V+  G EC  +C C +K   V C   G   IP+  ++ +  L +  N I K+  +  + F  L  + L+ NKI ++EEN L                 Y P        L +L LK N I+++ EQ+   +   L  L  ++NR+++L   L + L  +    L+ N  +C C        L+++  + +K  C +P+ +++Q L+EV  + L C+   E S                 G++I+  C  +N +   V W ++  +   +SL          + +E H+ +       N   ++ +      P+ +            P     P   S  +GS V+ +C   G P P I W    + +  + +  + +   NN++       E  GRY C A +  G  + +  + LI S
Sbjct:    1 MNLYLLLLVIATSSWQFVA--GLECPVECTCDKKGLVVDCSSSGLTRIPKNISRNVRSLVIRNNRIHKLKRSDLEGFNQLETLVLTHNKIKIIEENVLDHLPELKRLSLAHNELVYIPPLCSDSRPLASLNLKRNHIQFIDEQVL-RYFPDLTQLDFSHNRIQSLRTKLFDNLPALSHAHLHSNPWHCDCRASKVKALLQKVKWE-KKVYCTNPVELRHQALDEVDDSALTCARPAEES---------------WTGEEIKLTC-AKNSSSKLVVWMYENVEVDSSSL----------DGYEIHDTVITVPRKTNVNFMTCTYDFDHIPHHRRLRQSQHQGNGSPQFTYKPRDNSFREGSEVKVNCEVMGNPKPTINWY--HNGKRFISSRKRQLGLSNNVLRIYPFLEEDSGRYTCEAVNSVGKVRHAFSLDLISS 405          
BLAST of Peroxidasin vs. Ensembl Celegans
Match: pxn-2 (PeroXidasiN (Drosophila peroxidase) homolog [Source:UniProtKB/TrEMBL;Acc:G5EG78])

HSP 1 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 360/894 (40.27%), Postives = 537/894 (60.07%), Query Frame = 1
Query: 1006 GIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNN--LVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFR-QPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETL-----DFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRV------QRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAH-VPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRL-GQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFID-CSNIPRLNLIPWKECYDP----SRLTPEDQVPGLSPSRSRRSTNEFQDQNCKSK 3624
            G Y C ASN + S S    + +  +++P I++ P   +A  G +V   C A G+PVP++ WL+      R  T  +Y +  NN  L IE +T  +  G + C A +  GSA  +A + L+ ++    L E+  KL     L +  + +I K+A+ K+  A   T ++ R  ++  S +D+  LF+   +L  ++L KA ++YE+ +       R  ++ ++   A+E  +      +  +L    +  + + SGCQ       C    CF  KYRS DG+CNN  +P  G +   F RL+ P YENG NTP+GW  GK Y+GY  P+AR VS  L+   + TP  +LSAM MQWGQF+DHDL  T    +   + +G  CN TC N  PCF I     DP++      + PC+ F R+ A CGSG++S I  ++ YR+Q+N +TS+LD S +Y +   +A ELRDL  D G LR   V+ +NK  +PF     +DC+ + ++ + + CF AGD R NE LGL+ MHTI++REHNR++  L  +N +W+G+ I+ E+RK++GAM+QHITYNAWLP +LG      + G+Y GYN  V+ TI++ FATAA+RF HTLIN  L+R D++F+   +G+LPLH AFFAP+R++ +GG+DP+LRGLFA   K  + DQV+N EL EKLF   HEVALDL ALNIQRGRDHGL S+  +R+FC +   +T+ D    + +  +  K++ +YG   N+DL+ G V E++ +  L+GPTL+C++ DQFKRLRDGDRFWYE+ + F  AQL QIK+VTL++I+C N D+I R+QR++F    +  +F + C ++P +NL  W  C D     S     + + G   ++ R+  +    ++C  K
Sbjct:  418 GQYECVASNGEESKSHIFSVSLKESEQPVIIDAPMDTNATIGQQVTLRCNAKGFPVPDVVWLFEGIRIPRRNT--RYTISDNNIELTIEKVTRHD-SGVFTCQAVNSVGSAVATANL-LVGAE----LTEKVDKL-----LDDSTIEKIAKEAKQKVEKALSSTKDQQR-MDKIESPNDLSKLFKFAINLKKVDLGKAREIYEESI-------RLVQMHIDNGLAFESAMISPNVSYEAVLPVSYVQTLMEKSGCQTGQFAESCEDH-CFFSKYRSYDGQCNNHEHPWWGVSEMAFMRLLPPRYENGFNTPVGWEKGKRYNGYEVPNARKVSRVLIGTDETTPHSHLSAMTMQWGQFIDHDLTLTAPALTRHSYKEGAFCNRTCENADPCFNIQLEADDPKLHTGLYQKHPCMEFERNGAACGSGETSPIFQRVTYRDQLNLLTSYLDASGIYGNSEEQALELRDLYSDHGLLRFDIVSGANKPYMPFEKDSDMDCRRNFSRENPIKCFLAGDVRANEQLGLMSMHTIFLREHNRIASRLLEVNENWDGETIFQETRKLIGAMLQHITYNAWLPKILGKATYNTIIGEYKGYNPDVNPTIANEFATAALRFAHTLINTHLFRFDKDFKETKQGHLPLHNAFFAPERLVSEGGVDPLLRGLFAAPIKMPRPDQVLNKELTEKLFNRFHEVALDLAALNIQRGRDHGLPSWTEYRKFCNLTVPKTWSDMKNIVQNDTVISKLQSLYGVTENIDLWVGGVTEKRTADALMGPTLACIIADQFKRLRDGDRFWYENEEMFSKAQLRQIKKVTLSKIICTNGDDIDRIQRDIFVYHGNSTQFYEPCESLPEINLNMWTTCCDAMCSSSSTLARNAIGGDEKAKRRKRRHHHSKKSCHDK 1289          
BLAST of Peroxidasin vs. Ensembl Celegans
Match: skpo-3 (ShK domain and PerOxidase domain containing protein [Source:UniProtKB/TrEMBL;Acc:H2KZ53])

HSP 1 Score: 392.119 bits (1006), Expect = 2.362e-119
Identity = 228/653 (34.92%), Postives = 355/653 (54.36%), Query Frame = 1
Query: 1582 AKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLIN-PRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVN-DSPCFPILTPPGDPRV---QRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFN---IRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKE 3516
            A+  D+    +     + RE  V         +T+D       +Q+   +  + C    +E  C   +C++  +R++DG CNN+   P RG++  P+ RL+   Y+N ++ P+G     L+   ++PS R ++ RL  +      P+ +A++MQ+GQF+ HD+  T +  S+        CN  C N  S C  +     D      Q  CI  SRS   CGSG        L  R+Q+N+ T ++D S +Y S   ++ + RD   + G L++ P+  + K  LPF+    R +  C +         F AGD R N  +GL   HTI+  EHNRL    + LN HW+G+++Y E+RK++GA +Q I Y  WLP VLG+     +G Y GY+  VDST+++ F +AA RFGH +I     RLD +F  I  G LP  K     D ++ +GG+DP++RG+F   S+ VK  Q +   + E +F      + DL  +NIQRGRDHG  +Y  +RE CGM  A  F+  S EI+++  R K++++YG    +DL+ GA+LE  +  GLVGPT++C++  QFKR RDGDRF+YE+   F   QL +I++ +L+RI+CDN++ IS + R  F +       + CS IP ++L  W++
Sbjct:  256 ARCRDIINDPIVAAEDMWRERLVVATEDNTRRQTVDL------DQVIRSNTANACTPRLDEADCEANICYNAMFRTLDGTCNNMKGEPLRGASYRPYTRLLPTIYDNEVSEPVG----SLFTD-ARPSPREITRRLTSSQASVESPDYNALIMQFGQFISHDMAKTTLVPSSK-------CN-VCQNITSRCMSVPITFDDSNANFRQAQCIRVSRSSPICGSGN-------LKPRQQLNENTGYIDASPIYGSSVHDSKKFRD--GNSGFLKL-PMF-NGKAFLPFDQNKCRNRGQCSV--------IFTAGDSRVNLFVGLSAWHTIFTEEHNRLVTAFKRLNPHWDGERLYQEARKMIGAQVQAIVYREWLPKVLGASFATVVGDYRGYDSDVDSTVANEFTSAAFRFGHGMIQEFYQRLDNSFRNISFGALPFQKGTLHSDVLVNEGGVDPLIRGMF---SQNVKRPQRVTTTVTENMFG-----STDLSTINIQRGRDHGHPAYVKYRELCGMGTAFNFEHLSREILNTGTRNKLQEIYGSVDKIDLWVGALLEDPIIRGLVGPTVACIIGPQFKRTRDGDRFYYENPGVFSRRQLVEIRKSSLSRIICDNTNTISTIPREAFRVG----HMVPCSQIPSMDLNQWRD 858          
BLAST of Peroxidasin vs. Ensembl Celegans
Match: skpo-3 (ShK domain and PerOxidase domain containing protein [Source:UniProtKB/TrEMBL;Acc:H2KZ53])

HSP 1 Score: 392.119 bits (1006), Expect = 2.362e-119
Identity = 228/653 (34.92%), Postives = 355/653 (54.36%), Query Frame = 1
Query: 1582 AKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLIN-PRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVN-DSPCFPILTPPGDPRV---QRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFN---IRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKE 3516
            A+  D+    +     + RE  V         +T+D       +Q+   +  + C    +E  C   +C++  +R++DG CNN+   P RG++  P+ RL+   Y+N ++ P+G     L+   ++PS R ++ RL  +      P+ +A++MQ+GQF+ HD+  T +  S+        CN  C N  S C  +     D      Q  CI  SRS   CGSG        L  R+Q+N+ T ++D S +Y S   ++ + RD   + G L++ P+  + K  LPF+    R +  C +         F AGD R N  +GL   HTI+  EHNRL    + LN HW+G+++Y E+RK++GA +Q I Y  WLP VLG+     +G Y GY+  VDST+++ F +AA RFGH +I     RLD +F  I  G LP  K     D ++ +GG+DP++RG+F   S+ VK  Q +   + E +F      + DL  +NIQRGRDHG  +Y  +RE CGM  A  F+  S EI+++  R K++++YG    +DL+ GA+LE  +  GLVGPT++C++  QFKR RDGDRF+YE+   F   QL +I++ +L+RI+CDN++ IS + R  F +       + CS IP ++L  W++
Sbjct:  256 ARCRDIINDPIVAAEDMWRERLVVATEDNTRRQTVDL------DQVIRSNTANACTPRLDEADCEANICYNAMFRTLDGTCNNMKGEPLRGASYRPYTRLLPTIYDNEVSEPVG----SLFTD-ARPSPREITRRLTSSQASVESPDYNALIMQFGQFISHDMAKTTLVPSSK-------CN-VCQNITSRCMSVPITFDDSNANFRQAQCIRVSRSSPICGSGN-------LKPRQQLNENTGYIDASPIYGSSVHDSKKFRD--GNSGFLKL-PMF-NGKAFLPFDQNKCRNRGQCSV--------IFTAGDSRVNLFVGLSAWHTIFTEEHNRLVTAFKRLNPHWDGERLYQEARKMIGAQVQAIVYREWLPKVLGASFATVVGDYRGYDSDVDSTVANEFTSAAFRFGHGMIQEFYQRLDNSFRNISFGALPFQKGTLHSDVLVNEGGVDPLIRGMF---SQNVKRPQRVTTTVTENMFG-----STDLSTINIQRGRDHGHPAYVKYRELCGMGTAFNFEHLSREILNTGTRNKLQEIYGSVDKIDLWVGALLEDPIIRGLVGPTVACIIGPQFKRTRDGDRFYYENPGVFSRRQLVEIRKSSLSRIICDNTNTISTIPREAFRVG----HMVPCSQIPSMDLNQWRD 858          
BLAST of Peroxidasin vs. Ensembl Celegans
Match: skpo-2 (ShK domain and PerOxidase domain containing protein [Source:UniProtKB/TrEMBL;Acc:P91060])

HSP 1 Score: 387.882 bits (995), Expect = 3.110e-119
Identity = 221/626 (35.30%), Postives = 338/626 (53.99%), Query Frame = 1
Query: 1687 DFTTLLTPEQLAIISQLS-----------GCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR-PCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKL---RVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAK-SKLEFIDCSNIPRLNLIPWKE 3516
            D T + T E  +I   LS            C  + E  +C++ LC+H +YRS DG CNNL  P  GSA +   RL  P Y+NG+N P   T+  L    S+PSAR  +SRLL +       + +A++MQWGQF+ HDL       S +   +   C     N   C  +     DP   R  C+  +RS   CG+G S       ++REQ N+ T+F+DGS +Y S   +    R   + + KL   RV P    N  ++                       AGD R N  +GL  +H +++R+HNR++  L+ +N HW+ +++++ESRKIVGAM+Q IT+  +LP VLG    +R+G YPGY+  +D ++++ F + A RFGH +I      L+E F+ +  G +P +   F    ++ + GIDP++RGL  + +K     Q +   + E++F  +     DLG++NIQRGRDHG+  Y  WR+FCG+ + + F+     I +  + + ++ VY H   +D++ G++LE  V   LVGPTLSC++ +QFKR R+GDR WYE+   F P QL QIK++T++R+LCD  ++   V R  F + K +    + C  IP L+   WKE
Sbjct:  155 DCTFITTNEDTSIRKTLSIRDVRDSNANFNCAPTQETPNCNRNLCYHLRYRSFDGTCNNLKKPMIGSAFTALMRLKNPMYDNGLNAP---TSSFLR---SRPSAR-DASRLLLSSSTQIQHHSNALLMQWGQFIAHDL-------SKTTMLNNQECAACTSNKGRCTSVFLSRSDPTFGRFMCLPVARSTPVCGTGVS-------NFREQFNENTAFIDGSMIYGSSDRDQFLFRQGAFLKTKLINNRVFPPVDKNNNVV-----------------------AGDDRANIFVGLASLHVLYLRQHNRIAATLQRVNPHWDQERVFHESRKIVGAMIQRITFTEYLPKVLGVAFEERIGAYPGYDPNIDPSVANEFTSCAFRFGHGMIQEFYPFLNEKFQHV--GGIPFNDGMFKSTHIL-NNGIDPLIRGLMTLPAKM---PQRLTPAVTERIFGNS-----DLGSINIQRGRDHGVPPYTVWRKFCGLPEVKDFEGLKQVISNQVVIDNLKVVYKHVDAIDMYVGSLLEDPVKDALVGPTLSCIIGEQFKRTRNGDRLWYENSKVFSPEQLLQIKKITMSRVLCDAGEHFPMVPRKAFSVFKPTAHNLVKCDEIPDLDYNAWKE 725          
BLAST of Peroxidasin vs. Ensembl Fly
Match: Pxn (gene:FBgn0011828 transcript:FBtr0072954)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 404/985 (41.02%), Postives = 591/985 (60.00%), Query Frame = 1
Query:  796 FEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNS----LYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKP-YIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQV---RLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKL---RDPNRQRSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQ-RPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNI-RGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKE---CYDPSRLTPEDQVPGLSPSRSRRSTNEFQDQNCKSKTNQC-SSNISNL----EERIKSLED 3684
             E  EL P+ +  PQ   + +G      C  +      ++W         N+    L   N  L +    + H G+Y CTA N  G  S  A +K+  +Q P  +   P+++ A  G+ +E  C+A   P   +   W    ++    ++   KY I    +L ++N+T  +  GRY C   +  G A  SA++T IR+  +L   +   ++                +A  +I++A   T + L   R      +  ++  +FR P+  A +LA+A+++YE+ L ++   ++E     NLT   EE  +F  LL+ E L ++++LSGC    E  +C+  +CFH +YRSIDG CNNL +P  G++L+ F RL  P YENG + P+GWT G LY G++KPSARLVS+ L+   +ITPD  ++ MVMQWGQFLDHDLD   + + +S   DG+ C ++C    PC+PI  PP DPRV+ R CI   RS A CGSG +S+    + +REQ+NQ+TS++D S VY      A ELR+LT  EG LRVG   P  K +LPF   +  +DC+ +  +  + CF +GD R NE +GLL MHTIWMREHNR++ +L+ +N+HW+GD +Y E+RKIVGA MQHIT+  WLP+++G  G++ +G+Y GYN  ++ +I++ FATAA+RFGHT+INPIL+RL+E F+ IP+G+L LHKAFFAP R+  +GG+DP++RG  A+ +K    DQ +N EL EKLF  AH VALDL A+NIQRGRDHG+  YN +R+ C +  A+ F+D +GEI S+EIR+KM+++YGHP NVD++ G +LE +V GG VGP   CLL++QF+RLRDGDR +YE+   F P QL+QIKQ    R+LCD  DN  +V  NVF +AK +  +  C +I  +NL  W+E   C  P  +  +  +P     RS R   +   +N +  T +   S + +L    EER+  LE+
Sbjct:  452 IELKEL-PEILTAPQSQTIKLGKAFVLECDADGNPLPTIDWQLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSVEATIKVERSQSPPQLAIEPSNLVAITGTTIELPCQAD-QPEDGLQISWRHDGRLIDPNVQLAEKYQISGAGSLFVKNVTIPD-GGRYECQLKNQFGRASASALVT-IRNNVDLAPGDRYVRI-------------AFAEAAKEIDLAINNTLDMLFSNRSDKAPPNYGELLRVFRFPTGEARQLARAAEIYERTLVNIRKHVQEGD---NLTMKSEE-YEFRDLLSREHLHLVAELSGCMEHREMPNCTD-MCFHSRYRSIDGTCNNLQHPTWGASLTAFRRLAPPIYENGFSMPVGWTKGMLYSGHAKPSARLVSTSLVATKEITPDARITHMVMQWGQFLDHDLDHA-IPSVSSESWDGIDCKKSCEMAPPCYPIEVPPNDPRVRNRRCIDVVRSSAICGSGMTSLFFDSVQHREQINQLTSYIDASQVYGYSTAFAQELRNLTSQEGLLRVGVHFPRQKDMLPFAAPQDGMDCRRNLDENTMSCFVSGDIRVNEQVGLLAMHTIWMREHNRIASKLKQINSHWDGDTLYQEARKIVGAQMQHITFKQWLPLIIGESGMEMMGEYQGYNPQLNPSIANEFATAALRFGHTIINPILHRLNETFQPIPQGHLLLHKAFFAPWRLAYEGGVDPLMRGFLAVPAKLKTPDQNLNTELTEKLFQTAHAVALDLAAINIQRGRDHGMPGYNVYRKLCNLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEGGKVGPLFQCLLVEQFRRLRDGDRLYYENPGVFSPEQLTQIKQANFGRVLCDVGDNFDQVTENVFILAKHQGGYKKCEDIIGINLYLWQECGRCNSPPAIF-DSYIPQTYTKRSNRQKRDLGKENDEVATAESYDSPLESLYDVNEERVSGLEE 1412          

HSP 2 Score: 110.923 bits (276), Expect = 4.975e-24
Identity = 109/443 (24.60%), Postives = 175/443 (39.50%), Query Frame = 1
Query:  244 CLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXX-----------------------XXXXANNRLKTLPI-SLEKLINVKRLELYGNMLYCGCELRYFAGNLRRIGLDFQKS------QCQSPMNVKNQFLEEVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTF----NSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPAS-------------------------------------ISAEKGS-RVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            C   C C E+TV C R     +P++     T L L  N I ++ AN F     L  + L+ N+++ +++ AL G   L  +YL NN +  LP  IF                                L + NN+L  LP+    +L N+KRL L GN + C C +       RR  LD Q+        C +P  ++NQ      F+ L  + F+ ++  P+F+  PQDA VA G+++  +C+V  +   ++ W     +        +    +  L I+       GIY C A N  G++  S  +++  N   + ++ P                                       I A  GS  V   C A G+P P+I W +V   Q+   T    +    +L++    +    G Y C A +  GS + +A I L
Sbjct:   26 CPAGCTCLERTVRCIRAKLSAVPKLPQDTQT-LDLRFNHIEELPANAFSGLAQLTTLFLNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIFQRMPRLEAIFLENNDIWQLPAGLFDNLPRLNRLIMYNNKLTQLPVDGFNRLNNLKRLRLDGNAIDCNCGVYSL---WRRWHLDVQRQLVSISLTCAAPQMLQNQ-----GFSSLGEHHFKCAK--PQFLVAPQDAQVAAGEQVELSCEVTGLPRPQITWMHNTQELGLEEQAQAEILPSGSLLIRSADTSDMGIYQCIARNEMGALR-SQPVRLVVNGGNHPLDSPIDARSNQVWADAGTPMHGATPLPSPLPSPPHFTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQW-FVNGRQLLQSTPSLQLQANGSLILLQPNQLSA-GTYRCEARNSLGSVQATARIEL 454          

HSP 3 Score: 64.6994 bits (156), Expect = 5.962e-10
Identity = 52/201 (25.87%), Postives = 86/201 (42.79%), Query Frame = 1
Query:  823 FIERPQDAYVAV--GDKIRFACQVENINETKVEWHF---QFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRL--ETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKL 1404
            F  +P D  VA+     +   C      +  ++W     Q   +T +     N  L + + ++   G Y C A N+ GS+ A+A++++   + P I+  P S + + G      C A G P+P I W   + N V L   T    +  +N  ++      E  G Y C A + +G   V A I + RS++   L  E S L
Sbjct:  367 FTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQWFVNGRQLLQSTPSLQLQANGSLILLQPNQLSAGTYRCEARNSLGSVQATARIEL--KELPEILTAPQSQTIKLGKAFVLECDADGNPLPTIDW---QLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSVEATIKVERSQSPPQLAIEPSNL 562          
BLAST of Peroxidasin vs. Ensembl Fly
Match: Pxn (gene:FBgn0011828 transcript:FBtr0072951)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 404/985 (41.02%), Postives = 591/985 (60.00%), Query Frame = 1
Query:  796 FEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNS----LYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKP-YIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQV---RLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKL---RDPNRQRSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQ-RPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNI-RGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKE---CYDPSRLTPEDQVPGLSPSRSRRSTNEFQDQNCKSKTNQC-SSNISNL----EERIKSLED 3684
             E  EL P+ +  PQ   + +G      C  +      ++W         N+    L   N  L +    + H G+Y CTA N  G  S  A +K+  +Q P  +   P+++ A  G+ +E  C+A   P   +   W    ++    ++   KY I    +L ++N+T  +  GRY C   +  G A  SA++T IR+  +L   +   ++                +A  +I++A   T + L   R      +  ++  +FR P+  A +LA+A+++YE+ L ++   ++E     NLT   EE  +F  LL+ E L ++++LSGC    E  +C+  +CFH +YRSIDG CNNL +P  G++L+ F RL  P YENG + P+GWT G LY G++KPSARLVS+ L+   +ITPD  ++ MVMQWGQFLDHDLD   + + +S   DG+ C ++C    PC+PI  PP DPRV+ R CI   RS A CGSG +S+    + +REQ+NQ+TS++D S VY      A ELR+LT  EG LRVG   P  K +LPF   +  +DC+ +  +  + CF +GD R NE +GLL MHTIWMREHNR++ +L+ +N+HW+GD +Y E+RKIVGA MQHIT+  WLP+++G  G++ +G+Y GYN  ++ +I++ FATAA+RFGHT+INPIL+RL+E F+ IP+G+L LHKAFFAP R+  +GG+DP++RG  A+ +K    DQ +N EL EKLF  AH VALDL A+NIQRGRDHG+  YN +R+ C +  A+ F+D +GEI S+EIR+KM+++YGHP NVD++ G +LE +V GG VGP   CLL++QF+RLRDGDR +YE+   F P QL+QIKQ    R+LCD  DN  +V  NVF +AK +  +  C +I  +NL  W+E   C  P  +  +  +P     RS R   +   +N +  T +   S + +L    EER+  LE+
Sbjct:  452 IELKEL-PEILTAPQSQTIKLGKAFVLECDADGNPLPTIDWQLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSVEATIKVERSQSPPQLAIEPSNLVAITGTTIELPCQAD-QPEDGLQISWRHDGRLIDPNVQLAEKYQISGAGSLFVKNVTIPD-GGRYECQLKNQFGRASASALVT-IRNNVDLAPGDRYVRI-------------AFAEAAKEIDLAINNTLDMLFSNRSDKAPPNYGELLRVFRFPTGEARQLARAAEIYERTLVNIRKHVQEGD---NLTMKSEE-YEFRDLLSREHLHLVAELSGCMEHREMPNCTD-MCFHSRYRSIDGTCNNLQHPTWGASLTAFRRLAPPIYENGFSMPVGWTKGMLYSGHAKPSARLVSTSLVATKEITPDARITHMVMQWGQFLDHDLDHA-IPSVSSESWDGIDCKKSCEMAPPCYPIEVPPNDPRVRNRRCIDVVRSSAICGSGMTSLFFDSVQHREQINQLTSYIDASQVYGYSTAFAQELRNLTSQEGLLRVGVHFPRQKDMLPFAAPQDGMDCRRNLDENTMSCFVSGDIRVNEQVGLLAMHTIWMREHNRIASKLKQINSHWDGDTLYQEARKIVGAQMQHITFKQWLPLIIGESGMEMMGEYQGYNPQLNPSIANEFATAALRFGHTIINPILHRLNETFQPIPQGHLLLHKAFFAPWRLAYEGGVDPLMRGFLAVPAKLKTPDQNLNTELTEKLFQTAHAVALDLAAINIQRGRDHGMPGYNVYRKLCNLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEGGKVGPLFQCLLVEQFRRLRDGDRLYYENPGVFSPEQLTQIKQANFGRVLCDVGDNFDQVTENVFILAKHQGGYKKCEDIIGINLYLWQECGRCNSPPAIF-DSYIPQTYTKRSNRQKRDLGKENDEVATAESYDSPLESLYDVNEERVSGLEE 1412          

HSP 2 Score: 110.923 bits (276), Expect = 4.975e-24
Identity = 109/443 (24.60%), Postives = 175/443 (39.50%), Query Frame = 1
Query:  244 CLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXX-----------------------XXXXANNRLKTLPI-SLEKLINVKRLELYGNMLYCGCELRYFAGNLRRIGLDFQKS------QCQSPMNVKNQFLEEVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTF----NSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPAS-------------------------------------ISAEKGS-RVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            C   C C E+TV C R     +P++     T L L  N I ++ AN F     L  + L+ N+++ +++ AL G   L  +YL NN +  LP  IF                                L + NN+L  LP+    +L N+KRL L GN + C C +       RR  LD Q+        C +P  ++NQ      F+ L  + F+ ++  P+F+  PQDA VA G+++  +C+V  +   ++ W     +        +    +  L I+       GIY C A N  G++  S  +++  N   + ++ P                                       I A  GS  V   C A G+P P+I W +V   Q+   T    +    +L++    +    G Y C A +  GS + +A I L
Sbjct:   26 CPAGCTCLERTVRCIRAKLSAVPKLPQDTQT-LDLRFNHIEELPANAFSGLAQLTTLFLNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIFQRMPRLEAIFLENNDIWQLPAGLFDNLPRLNRLIMYNNKLTQLPVDGFNRLNNLKRLRLDGNAIDCNCGVYSL---WRRWHLDVQRQLVSISLTCAAPQMLQNQ-----GFSSLGEHHFKCAK--PQFLVAPQDAQVAAGEQVELSCEVTGLPRPQITWMHNTQELGLEEQAQAEILPSGSLLIRSADTSDMGIYQCIARNEMGALR-SQPVRLVVNGGNHPLDSPIDARSNQVWADAGTPMHGATPLPSPLPSPPHFTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQW-FVNGRQLLQSTPSLQLQANGSLILLQPNQLSA-GTYRCEARNSLGSVQATARIEL 454          

HSP 3 Score: 64.6994 bits (156), Expect = 5.962e-10
Identity = 52/201 (25.87%), Postives = 86/201 (42.79%), Query Frame = 1
Query:  823 FIERPQDAYVAV--GDKIRFACQVENINETKVEWHF---QFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRL--ETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKL 1404
            F  +P D  VA+     +   C      +  ++W     Q   +T +     N  L + + ++   G Y C A N+ GS+ A+A++++   + P I+  P S + + G      C A G P+P I W   + N V L   T    +  +N  ++      E  G Y C A + +G   V A I + RS++   L  E S L
Sbjct:  367 FTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQWFVNGRQLLQSTPSLQLQANGSLILLQPNQLSAGTYRCEARNSLGSVQATARIEL--KELPEILTAPQSQTIKLGKAFVLECDADGNPLPTIDW---QLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSVEATIKVERSQSPPQLAIEPSNL 562          
BLAST of Peroxidasin vs. Ensembl Fly
Match: Pxn (gene:FBgn0011828 transcript:FBtr0072952)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 404/985 (41.02%), Postives = 591/985 (60.00%), Query Frame = 1
Query:  796 FEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNS----LYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKP-YIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQV---RLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKL---RDPNRQRSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQ-RPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNI-RGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKE---CYDPSRLTPEDQVPGLSPSRSRRSTNEFQDQNCKSKTNQC-SSNISNL----EERIKSLED 3684
             E  EL P+ +  PQ   + +G      C  +      ++W         N+    L   N  L +    + H G+Y CTA N  G  S  A +K+  +Q P  +   P+++ A  G+ +E  C+A   P   +   W    ++    ++   KY I    +L ++N+T  +  GRY C   +  G A  SA++T IR+  +L   +   ++                +A  +I++A   T + L   R      +  ++  +FR P+  A +LA+A+++YE+ L ++   ++E     NLT   EE  +F  LL+ E L ++++LSGC    E  +C+  +CFH +YRSIDG CNNL +P  G++L+ F RL  P YENG + P+GWT G LY G++KPSARLVS+ L+   +ITPD  ++ MVMQWGQFLDHDLD   + + +S   DG+ C ++C    PC+PI  PP DPRV+ R CI   RS A CGSG +S+    + +REQ+NQ+TS++D S VY      A ELR+LT  EG LRVG   P  K +LPF   +  +DC+ +  +  + CF +GD R NE +GLL MHTIWMREHNR++ +L+ +N+HW+GD +Y E+RKIVGA MQHIT+  WLP+++G  G++ +G+Y GYN  ++ +I++ FATAA+RFGHT+INPIL+RL+E F+ IP+G+L LHKAFFAP R+  +GG+DP++RG  A+ +K    DQ +N EL EKLF  AH VALDL A+NIQRGRDHG+  YN +R+ C +  A+ F+D +GEI S+EIR+KM+++YGHP NVD++ G +LE +V GG VGP   CLL++QF+RLRDGDR +YE+   F P QL+QIKQ    R+LCD  DN  +V  NVF +AK +  +  C +I  +NL  W+E   C  P  +  +  +P     RS R   +   +N +  T +   S + +L    EER+  LE+
Sbjct:  452 IELKEL-PEILTAPQSQTIKLGKAFVLECDADGNPLPTIDWQLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSVEATIKVERSQSPPQLAIEPSNLVAITGTTIELPCQAD-QPEDGLQISWRHDGRLIDPNVQLAEKYQISGAGSLFVKNVTIPD-GGRYECQLKNQFGRASASALVT-IRNNVDLAPGDRYVRI-------------AFAEAAKEIDLAINNTLDMLFSNRSDKAPPNYGELLRVFRFPTGEARQLARAAEIYERTLVNIRKHVQEGD---NLTMKSEE-YEFRDLLSREHLHLVAELSGCMEHREMPNCTD-MCFHSRYRSIDGTCNNLQHPTWGASLTAFRRLAPPIYENGFSMPVGWTKGMLYSGHAKPSARLVSTSLVATKEITPDARITHMVMQWGQFLDHDLDHA-IPSVSSESWDGIDCKKSCEMAPPCYPIEVPPNDPRVRNRRCIDVVRSSAICGSGMTSLFFDSVQHREQINQLTSYIDASQVYGYSTAFAQELRNLTSQEGLLRVGVHFPRQKDMLPFAAPQDGMDCRRNLDENTMSCFVSGDIRVNEQVGLLAMHTIWMREHNRIASKLKQINSHWDGDTLYQEARKIVGAQMQHITFKQWLPLIIGESGMEMMGEYQGYNPQLNPSIANEFATAALRFGHTIINPILHRLNETFQPIPQGHLLLHKAFFAPWRLAYEGGVDPLMRGFLAVPAKLKTPDQNLNTELTEKLFQTAHAVALDLAAINIQRGRDHGMPGYNVYRKLCNLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEGGKVGPLFQCLLVEQFRRLRDGDRLYYENPGVFSPEQLTQIKQANFGRVLCDVGDNFDQVTENVFILAKHQGGYKKCEDIIGINLYLWQECGRCNSPPAIF-DSYIPQTYTKRSNRQKRDLGKENDEVATAESYDSPLESLYDVNEERVSGLEE 1412          

HSP 2 Score: 110.923 bits (276), Expect = 4.975e-24
Identity = 109/443 (24.60%), Postives = 175/443 (39.50%), Query Frame = 1
Query:  244 CLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXX-----------------------XXXXANNRLKTLPI-SLEKLINVKRLELYGNMLYCGCELRYFAGNLRRIGLDFQKS------QCQSPMNVKNQFLEEVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTF----NSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPAS-------------------------------------ISAEKGS-RVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            C   C C E+TV C R     +P++     T L L  N I ++ AN F     L  + L+ N+++ +++ AL G   L  +YL NN +  LP  IF                                L + NN+L  LP+    +L N+KRL L GN + C C +       RR  LD Q+        C +P  ++NQ      F+ L  + F+ ++  P+F+  PQDA VA G+++  +C+V  +   ++ W     +        +    +  L I+       GIY C A N  G++  S  +++  N   + ++ P                                       I A  GS  V   C A G+P P+I W +V   Q+   T    +    +L++    +    G Y C A +  GS + +A I L
Sbjct:   26 CPAGCTCLERTVRCIRAKLSAVPKLPQDTQT-LDLRFNHIEELPANAFSGLAQLTTLFLNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIFQRMPRLEAIFLENNDIWQLPAGLFDNLPRLNRLIMYNNKLTQLPVDGFNRLNNLKRLRLDGNAIDCNCGVYSL---WRRWHLDVQRQLVSISLTCAAPQMLQNQ-----GFSSLGEHHFKCAK--PQFLVAPQDAQVAAGEQVELSCEVTGLPRPQITWMHNTQELGLEEQAQAEILPSGSLLIRSADTSDMGIYQCIARNEMGALR-SQPVRLVVNGGNHPLDSPIDARSNQVWADAGTPMHGATPLPSPLPSPPHFTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQW-FVNGRQLLQSTPSLQLQANGSLILLQPNQLSA-GTYRCEARNSLGSVQATARIEL 454          

HSP 3 Score: 64.6994 bits (156), Expect = 5.962e-10
Identity = 52/201 (25.87%), Postives = 86/201 (42.79%), Query Frame = 1
Query:  823 FIERPQDAYVAV--GDKIRFACQVENINETKVEWHF---QFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRL--ETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKL 1404
            F  +P D  VA+     +   C      +  ++W     Q   +T +     N  L + + ++   G Y C A N+ GS+ A+A++++   + P I+  P S + + G      C A G P+P I W   + N V L   T    +  +N  ++      E  G Y C A + +G   V A I + RS++   L  E S L
Sbjct:  367 FTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQWFVNGRQLLQSTPSLQLQANGSLILLQPNQLSAGTYRCEARNSLGSVQATARIEL--KELPEILTAPQSQTIKLGKAFVLECDADGNPLPTIDW---QLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSVEATIKVERSQSPPQLAIEPSNL 562          
BLAST of Peroxidasin vs. Ensembl Fly
Match: Pxn (gene:FBgn0011828 transcript:FBtr0072953)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 404/985 (41.02%), Postives = 591/985 (60.00%), Query Frame = 1
Query:  796 FEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNS----LYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKP-YIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQV---RLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKL---RDPNRQRSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQ-RPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNI-RGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKE---CYDPSRLTPEDQVPGLSPSRSRRSTNEFQDQNCKSKTNQC-SSNISNL----EERIKSLED 3684
             E  EL P+ +  PQ   + +G      C  +      ++W         N+    L   N  L +    + H G+Y CTA N  G  S  A +K+  +Q P  +   P+++ A  G+ +E  C+A   P   +   W    ++    ++   KY I    +L ++N+T  +  GRY C   +  G A  SA++T IR+  +L   +   ++                +A  +I++A   T + L   R      +  ++  +FR P+  A +LA+A+++YE+ L ++   ++E     NLT   EE  +F  LL+ E L ++++LSGC    E  +C+  +CFH +YRSIDG CNNL +P  G++L+ F RL  P YENG + P+GWT G LY G++KPSARLVS+ L+   +ITPD  ++ MVMQWGQFLDHDLD   + + +S   DG+ C ++C    PC+PI  PP DPRV+ R CI   RS A CGSG +S+    + +REQ+NQ+TS++D S VY      A ELR+LT  EG LRVG   P  K +LPF   +  +DC+ +  +  + CF +GD R NE +GLL MHTIWMREHNR++ +L+ +N+HW+GD +Y E+RKIVGA MQHIT+  WLP+++G  G++ +G+Y GYN  ++ +I++ FATAA+RFGHT+INPIL+RL+E F+ IP+G+L LHKAFFAP R+  +GG+DP++RG  A+ +K    DQ +N EL EKLF  AH VALDL A+NIQRGRDHG+  YN +R+ C +  A+ F+D +GEI S+EIR+KM+++YGHP NVD++ G +LE +V GG VGP   CLL++QF+RLRDGDR +YE+   F P QL+QIKQ    R+LCD  DN  +V  NVF +AK +  +  C +I  +NL  W+E   C  P  +  +  +P     RS R   +   +N +  T +   S + +L    EER+  LE+
Sbjct:  452 IELKEL-PEILTAPQSQTIKLGKAFVLECDADGNPLPTIDWQLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSVEATIKVERSQSPPQLAIEPSNLVAITGTTIELPCQAD-QPEDGLQISWRHDGRLIDPNVQLAEKYQISGAGSLFVKNVTIPD-GGRYECQLKNQFGRASASALVT-IRNNVDLAPGDRYVRI-------------AFAEAAKEIDLAINNTLDMLFSNRSDKAPPNYGELLRVFRFPTGEARQLARAAEIYERTLVNIRKHVQEGD---NLTMKSEE-YEFRDLLSREHLHLVAELSGCMEHREMPNCTD-MCFHSRYRSIDGTCNNLQHPTWGASLTAFRRLAPPIYENGFSMPVGWTKGMLYSGHAKPSARLVSTSLVATKEITPDARITHMVMQWGQFLDHDLDHA-IPSVSSESWDGIDCKKSCEMAPPCYPIEVPPNDPRVRNRRCIDVVRSSAICGSGMTSLFFDSVQHREQINQLTSYIDASQVYGYSTAFAQELRNLTSQEGLLRVGVHFPRQKDMLPFAAPQDGMDCRRNLDENTMSCFVSGDIRVNEQVGLLAMHTIWMREHNRIASKLKQINSHWDGDTLYQEARKIVGAQMQHITFKQWLPLIIGESGMEMMGEYQGYNPQLNPSIANEFATAALRFGHTIINPILHRLNETFQPIPQGHLLLHKAFFAPWRLAYEGGVDPLMRGFLAVPAKLKTPDQNLNTELTEKLFQTAHAVALDLAAINIQRGRDHGMPGYNVYRKLCNLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEGGKVGPLFQCLLVEQFRRLRDGDRLYYENPGVFSPEQLTQIKQANFGRVLCDVGDNFDQVTENVFILAKHQGGYKKCEDIIGINLYLWQECGRCNSPPAIF-DSYIPQTYTKRSNRQKRDLGKENDEVATAESYDSPLESLYDVNEERVSGLEE 1412          

HSP 2 Score: 110.923 bits (276), Expect = 4.975e-24
Identity = 109/443 (24.60%), Postives = 175/443 (39.50%), Query Frame = 1
Query:  244 CLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXX-----------------------XXXXANNRLKTLPI-SLEKLINVKRLELYGNMLYCGCELRYFAGNLRRIGLDFQKS------QCQSPMNVKNQFLEEVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTF----NSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPAS-------------------------------------ISAEKGS-RVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            C   C C E+TV C R     +P++     T L L  N I ++ AN F     L  + L+ N+++ +++ AL G   L  +YL NN +  LP  IF                                L + NN+L  LP+    +L N+KRL L GN + C C +       RR  LD Q+        C +P  ++NQ      F+ L  + F+ ++  P+F+  PQDA VA G+++  +C+V  +   ++ W     +        +    +  L I+       GIY C A N  G++  S  +++  N   + ++ P                                       I A  GS  V   C A G+P P+I W +V   Q+   T    +    +L++    +    G Y C A +  GS + +A I L
Sbjct:   26 CPAGCTCLERTVRCIRAKLSAVPKLPQDTQT-LDLRFNHIEELPANAFSGLAQLTTLFLNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIFQRMPRLEAIFLENNDIWQLPAGLFDNLPRLNRLIMYNNKLTQLPVDGFNRLNNLKRLRLDGNAIDCNCGVYSL---WRRWHLDVQRQLVSISLTCAAPQMLQNQ-----GFSSLGEHHFKCAK--PQFLVAPQDAQVAAGEQVELSCEVTGLPRPQITWMHNTQELGLEEQAQAEILPSGSLLIRSADTSDMGIYQCIARNEMGALR-SQPVRLVVNGGNHPLDSPIDARSNQVWADAGTPMHGATPLPSPLPSPPHFTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQW-FVNGRQLLQSTPSLQLQANGSLILLQPNQLSA-GTYRCEARNSLGSVQATARIEL 454          

HSP 3 Score: 64.6994 bits (156), Expect = 5.962e-10
Identity = 52/201 (25.87%), Postives = 86/201 (42.79%), Query Frame = 1
Query:  823 FIERPQDAYVAV--GDKIRFACQVENINETKVEWHF---QFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRL--ETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKL 1404
            F  +P D  VA+     +   C      +  ++W     Q   +T +     N  L + + ++   G Y C A N+ GS+ A+A++++   + P I+  P S + + G      C A G P+P I W   + N V L   T    +  +N  ++      E  G Y C A + +G   V A I + RS++   L  E S L
Sbjct:  367 FTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQWFVNGRQLLQSTPSLQLQANGSLILLQPNQLSAGTYRCEARNSLGSVQATARIEL--KELPEILTAPQSQTIKLGKAFVLECDADGNPLPTIDW---QLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSVEATIKVERSQSPPQLAIEPSNL 562          
BLAST of Peroxidasin vs. Ensembl Fly
Match: CG10211 (gene:FBgn0032685 transcript:FBtr0343824)

HSP 1 Score: 353.599 bits (906), Expect = 1.966e-101
Identity = 235/655 (35.88%), Postives = 348/655 (53.13%), Query Frame = 1
Query: 1639 ENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTP--IGWTAGKLYHGYSKPSARLVSSRLLRAHKITPD-PNL----SAMVMQWGQFLDHDLDFTPVDAS-NSRFSDGLGCNETCVNDSPCFPILTPPGD---PRV-----QRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSE-----GIKRL--GQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFA--MAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHD---QFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLE-FIDCSNIPRLNLIPWKE 3516
            +N    N  T   +T+D + LL   Q     QL  C         SQQ   +  +R++ G+CNNL NP  G +L+ F RL+  +YE+GI+ P   G T      G + P+ R +S+       I PD  NL    S MVMQ+ QF+DHDL  TP+    +        CN        C P   P GD   P V     +R C    RS+     GQ S     L  R+Q+NQ T FLDGS VY      + +LR  +      R+       K LLP     +   +      +  CF  GD R +E  GL  +HT ++REHNR+ + LRG+N HWNG+++++ +RKIV A +QHI +N +LP +L        G+K L  G Y  YN      + + FA AA R GH+L+ P + RL    + + E  L L   FF  D +++ G ID ILRGL A   + +  DQ +  E+   LF         +DL ALNIQR RDHG+ SYN++R  C +K+A  ++D S EI  +E+  + +++Y    ++DLF GA+ E+ + GGLVGPTL+C++  QF++LR  DRFWYE+ +   +F  AQL+++++VTLA+I+C+N +    +QR  F +  + L   + C+++P+++L  W+E
Sbjct:  675 QNAFNRNELTDTLQTVDISGLLGGAQ----KQLDTCPEP------SQQCDANSPFRTLSGRCNNLRNPNWGKSLTTFSRLLPAQYEDGISAPRLTGVT------GTALPNPRTIST------TIHPDISNLHTRYSLMVMQFAQFVDHDLTLTPIHKGFHESIPSCRPCNSRQTVHPECNPFPVPAGDFYYPEVNVTSGERFCFPSMRSLP----GQQS-----LGPRDQINQNTHFLDGSMVYGETTCLSNKLRGFSG-----RMNSTQVRGKELLPLGPHPECKSR------NGLCFLGGDDRASEQPGLTAIHTAFLREHNRIVEGLRGVNPHWNGEQLFHHARKIVSAQVQHIVFNEFLPRILSWNAVNLYGLKLLPQGYYKDYNPSCSPIVFNEFAAAAFRIGHSLLRPHIPRLSVQHQPV-EPPLLLRDGFFRMDALLQPGIIDEILRGLVATPMETL--DQFITGEVTNHLFEDRKIPFSGIDLIALNIQRARDHGIPSYNNYRALCNLKRATNWNDLSREI-PTEVINRFQKIYASVDDIDLFPGAMTERPLQGGLVGPTLACIIGIQFRQLRKCDRFWYENQNPEVKFTEAQLAEVRKVTLAKIVCENLEITGDMQRAAFDLPSNFLNPRVPCASMPQIDLNAWRE 1283          

HSP 2 Score: 193.741 bits (491), Expect = 1.671e-49
Identity = 167/612 (27.29%), Postives = 264/612 (43.14%), Query Frame = 1
Query: 1783 LCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLR-AHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSP----CFPILTPPGDPRVQRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLG-------QYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAE------TFDDFSG-EIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESH---DQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKL-EFIDCSNIPRLNLIPWKECYDPSRLTPED 3549
            +C   KYR    +CNN+ + + G+    F RL+  +Y +G++ P      K  H    P A +V  +L R         +++AM+  WGQ L +DL    V+      S      ++ V D      CF +   P     +R   GF   +  C          + H R+Q+N  ++++DGS +Y S   E  +LR  TY  G ++V                    CQ+  A                      +H   +++HN + + L  +N  W+ + ++ E+R+I+ A +QHITYN +LP+VLG E   + G           Y+  V   I + FATAAM                          P   + + P+ + +      +L  + A+    V S    NAE   +L            AL + RGRDHG+ASY    + C  + A+      +FD  +    +  E    +R +Y +  ++DL  GA+LE+ V G L GPT+SCLL  QF++L+  DRFWYE+      F   QL  I+Q TL+ +LC  S  +S  Q   F +  + L   +DC  +P+ +L PW+       + PED
Sbjct:   63 VCPPSKYRQPTAECNNVSHRKWGARGDIFQRLLAADYADGVSQP---RTSKGTHAL--PDAEVVIEQLQRHVEGELRHAHITAMLPAWGQLLANDL----VEVGQLPISGKCCERDSAVKDPSELQHCF-VRAGPDCKEYKRSAPGFD--LEAC----------QKHTRQQMNIASAYIDGSGLYGSTRHEFDQLR--TYISGGVKVESCK---------------YCQVAGATG-------------------ALHRALLQQHNNIGERLSHINPDWSEEDVFLEARRIITATIQHITYNEFLPLVLGQETTAKEGLRLTAEKHSSNYSSSVRGGIYNEFATAAM--------------------------PAFWSMYPPEMLAKKMSAHELL-SIAALQKSLVPSQ--TNAEGWSEL------------ALAVHRGRDHGVASYVHALDLCERRFADQSAANVSFDTLAQVSNIPEEYITNLRDIYQNANDIDLLVGALLEEPVVGALFGPTISCLLSLQFEQLKQTDRFWYENEIPPSSFTLDQLKSIRQTTLSGLLC-GSHQVSTAQSKAFILEDNYLNSILDCDQLPKFDLKPWQ-------VNPED 567          
BLAST of Peroxidasin vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 412/992 (41.53%), Postives = 584/992 (58.87%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR---PCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSRLTPEDQVPGLS------------------PSRSRRSTNEFQDQNCKSKTNQCSSNISNLEERIKSLEDKM 3690
            +N++   +  P+F   PQD  V  G  + F C+     +  + W    +    +   +      L I  V    +G Y C A +  G+  A+  L I  +  P     P  ++ E GS V+  C A G P P ITW     + V++   GK+ +  +  +  +       GRY C A +  G +  S V+T+              ++P  ++  +  +   +++A   IN A   T  +L D    R+ +++ +LFR P     +E A+A +++E+ L  +   + +  +     TAY     +  L++P  L +I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+PF RL+KP Y+NG N P G T  + ++GY  P  RLVS+ ++    ITPD   + M+MQWGQFLDHDLD T V  S SRFSDG  C   C ND PCFPI+ PP DPR +R    C+ F RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   EA E+RDL    G LR G V  + K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W+REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITYN WLP +LG  G++ +G Y GYN  +++ I + FATAA RFGHTLINPILYRLDENF+ I +G++ LHKAFF+P R++ +GGIDP+LRGLF +  K   S Q++N EL E+LF+MAH VALDL A+NIQRGRDHG+ SYN +R FC +  A+TF+D   EI +  +REK++++YG P NVDLF   + E+ V G  +GPTL CLL  QFKRLRDGDRFWYE+   F PAQL+Q+KQ +L+R+LCDN DNI+R+Q + F +A     +  C+++P+++L  W++C +  R   + Q   LS                  PS +  S  +FQD             I++L ++IK LE ++
Sbjct:  413 ANAYIIVQARPQFTVTPQDQSVLEGQTVDFPCEASGFPQPVIAWTRGGSPLPNDRRHVVLSTGSLRISRVALHDQGQYECQAVSPVGTARAAVHLNILQSVTPVFTSAPRDLTVESGSDVQIPCSAQGEPTPIITW---SKDGVQITESGKFHINPDGYLEVHDVGLADGGRYECVARNSIGYSSSSMVLTV--------------QVPQVSREGDPFVSTSLEEAIRSINSAIDSTRRQLFD-GSPRTPAELLALFRYPRDPYTVEQARAGEIFEQTLLLIQRHVNQGLMVDTNGTAYR----YNDLVSPRFLDMIANLSGCTAHRRINNCSD-ICFHQKYRTHDGTCNNLQHPMWGASLTPFERLLKPVYDNGFNLPRG-TTERWHNGYPLPLPRLVSTTMIGTETITPDDRYTHMLMQWGQFLDHDLDSTVVSLSQSRFSDGQLCTSVCTNDPPCFPIMFPPNDPRQRRNGARCMFFVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSQHEAEEIRDLASHRGMLRQGIVQRTGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTAMHTVWLREHNRIASELLRLNPHWDGDTIYHEARKIVGAQMQHITYNQWLPKILGEAGMRIMGDYTGYNPNINAGILNAFATAAFRFGHTLINPILYRLDENFQPIQQGHISLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRMSTQLLNTELTERLFSMAHAVALDLAAMNIQRGRDHGIPSYNDYRVFCNLTSAQTFEDLKNEIQNPSVREKLQRLYGTPLNVDLFPALMAEELVPGSRLGPTLMCLLATQFKRLRDGDRFWYENPGSFSPAQLTQLKQTSLSRVLCDNGDNITRIQSDAFSVADLPHGYGSCADLPKIDLRMWQDCCEDCRT--KGQFNALSFHFRGRRSAEHSYAEEKKPSSTEPSAKDFQD-----FVTDMQKTITSLRKQIKRLEGRV 1373          

HSP 2 Score: 114.775 bits (286), Expect = 3.975e-25
Identity = 112/428 (26.17%), Postives = 186/428 (43.46%), Query Frame = 1
Query:  190 IIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSL---------PGN---------------SISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPI-SLEKLINVKRLELYGNMLYCGCELRYFAGNLRRI---GLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASA---KLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            I+FL S     VS+    C  +C C   TV C     + +P +   + T L L         PG+                I +I    F++ ++L ++ L  N+I  ++  A  G + LE LYL  N IE L  + FS      +L    NNR+  L + +   L ++KRL L  N L+C CEL + A  L++    G     + C  P  ++ + +  +  +EL C          P+    PQD  V  G+ + F C+ E   + ++ W    N      DT  N L   +  L I++  E  +G+Y C A N  G +  S    +   +P++  ++++ P +     G  V   C A G P P +T  W + +Q  L  + +  I     L I+NI +++  G+Y C+AS+   +   +A I +
Sbjct:   12 IVFLLSSGPYRVSS----CPSRCLCFRTTVRCMHLNLESVPAV-LPQTTILDLRFNKIKDLQPGSFKRLKNLNTLLLNNNHIRRIPRGAFEDLENLKYLYLYKNEIQAIDREAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLH-NNRISHLALGTFSHLQSMKRLRLDSNALHCDCELLWLADLLKQYAESGNAQAAATCDYPNRLQGRSVATLTAHELNCE--------VPRITSEPQDVDVTSGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDTRLNLL--EDGTLMIQDTRETDQGVYQCMAKNVAGEVKTSEVTLRYFRSPSRPSFVIQ-PQNTEVLVGESVTLECSATGQPQPRVT--WTRGDQSALPVDPRINITPSGGLFIQNIHQAD-GGQYTCFASNNVDTIHANAYIIV 419          

HSP 3 Score: 76.2554 bits (186), Expect = 2.351e-13
Identity = 58/207 (28.02%), Postives = 97/207 (46.86%), Query Frame = 1
Query:  763 EVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWR-----NQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIV-RKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRS 1365
            EVK +E+    F  S   P F+ +PQ+  V VG+ +   C      + +V W     D +   +  R     +  LFI+ +H+   G Y C ASNN  +I A+A + +    +P     P   S  +G  V+F C A G+P P I W    S    L  + +++V    +L I  +   + +G+Y C A S  G+A+ +  + +++S
Sbjct:  315 EVKTSEVTLRYFR-SPSRPSFVIQPQNTEVLVGESVTLECSATGQPQPRVTW--TRGDQSALPVDPRINITPSGGLFIQNIHQADGGQYTCFASNNVDTIHANAYIIV--QARPQFTVTPQDQSVLEGQTVDFPCEASGFPQPVIAWTRGGSP---LPNDRRHVVLSTGSLRISRVALHD-QGQYECQAVSPVGTARAAVHLNILQS 512          
BLAST of Peroxidasin vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 409/972 (42.08%), Postives = 577/972 (59.36%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR---PCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSRLTPEDQVPGLSPSRSRRSTNEFQDQNCKSKTNQCSSNISNLEERIKSLED 3684
            +N++   +  P+F   PQD  V  G  + F C+     +  + W    +    +   +      L I  V    +G Y C A +  G+  A+  L I  +  P     P  ++ E GS V+  C A G P P ITW     + V++   GK+ +  +  +  +       GRY C A +  G +  S V+T+              ++P  ++  +  +   +++A   IN A   T  +L D    R+ +++ +LFR P     +E A+A +++E+ L  +   + +  +     TAY     +  L++P  L +I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+PF RL+KP Y+NG N P G T  + ++GY  P  RLVS+ ++    ITPD   + M+MQWGQFLDHDLD T V  S SRFSDG  C   C ND PCFPI+ PP DPR +R    C+ F RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   EA E+RDL    G LR G V  + K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W+REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITYN WLP +LG  G++ +G Y GYN  +++ I + FATAA RFGHTLINPILYRLDENF+ I +G++ LHKAFF+P R++ +GGIDP+LRGLF +  K   S Q++N EL E+LF+MAH VALDL A+NIQRGRDHG+ SYN +R FC +  A+TF+D   EI +  +REK++++YG P NVDLF   + E+ V G  +GPTL CLL  QFKRLRDGDRFWYE+   F PAQL+Q+KQ +L+R+LCDN DNI+R+Q + F +A     +  C+++P+++L  W++C +  R   + Q   LS     R + E      K   N  + N S+ E   K  +D
Sbjct:  383 ANAYIIVQARPQFTVTPQDQSVLEGQTVDFPCEASGFPQPVIAWTRGGSPLPNDRRHVVLSTGSLRISRVALHDQGQYECQAVSPVGTARAAVHLNILQSVTPVFTSAPRDLTVESGSDVQIPCSAQGEPTPIITW---SKDGVQITESGKFHINPDGYLEVHDVGLADGGRYECVARNSIGYSSSSMVLTV--------------QVPQVSREGDPFVSTSLEEAIRSINSAIDSTRRQLFD-GSPRTPAELLALFRYPRDPYTVEQARAGEIFEQTLLLIQRHVNQGLMVDTNGTAYR----YNDLVSPRFLDMIANLSGCTAHRRINNCSD-ICFHQKYRTHDGTCNNLQHPMWGASLTPFERLLKPVYDNGFNLPRG-TTERWHNGYPLPLPRLVSTTMIGTETITPDDRYTHMLMQWGQFLDHDLDSTVVSLSQSRFSDGQLCTSVCTNDPPCFPIMFPPNDPRQRRNGARCMFFVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSQHEAEEIRDLASHRGMLRQGIVQRTGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTAMHTVWLREHNRIASELLRLNPHWDGDTIYHEARKIVGAQMQHITYNQWLPKILGEAGMRIMGDYTGYNPNINAGILNAFATAAFRFGHTLINPILYRLDENFQPIQQGHISLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRMSTQLLNTELTERLFSMAHAVALDLAAMNIQRGRDHGIPSYNDYRVFCNLTSAQTFEDLKNEIQNPSVREKLQRLYGTPLNVDLFPALMAEELVPGSRLGPTLMCLLATQFKRLRDGDRFWYENPGSFSPAQLTQLKQTSLSRVLCDNGDNITRIQSDAFSVADLPHGYGSCADLPKIDLRMWQDCCEDCRT--KGQFNALSFHFRGRRSAEHSYAEEKKPANNLTEN-SSTEPSAKDFQD 1327          

HSP 2 Score: 117.472 bits (293), Expect = 6.465e-26
Identity = 104/392 (26.53%), Postives = 173/392 (44.13%), Query Frame = 1
Query:  250 PQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSF--------NKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPI-SLEKLINVKRLELYGNMLYCGCELRYFAGNLRRI---GLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASA---KLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            P+C C   TV C     + +P +         LP  +I  +   +F + KDL    ++F        N+I  ++  A  G + LE LYL  N IE L  + FS      +L    NNR+  L + +   L ++KRL L  N L+C CEL + A  L++    G     + C  P  ++ + +  +  +EL C          P+    PQD  V  G+ + F C+ E   + ++ W    N      DT  N L   +  L I++  E  +G+Y C A N  G +  S    +   +P++  ++++ P +     G  V   C A G P P +T  W + +Q  L  + +  I     L I+NI +++  G+Y C+AS+   +   +A I +
Sbjct:   25 PRCLCFRTTVRCMHLNLESVPAV---------LPQTTILDL---RFNKIKDLQPASITFFHFEYLYKNEIQAIDREAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLH-NNRISHLALGTFSHLQSMKRLRLDSNALHCDCELLWLADLLKQYAESGNAQAAATCDYPNRLQGRSVATLTAHELNCE--------VPRITSEPQDVDVTSGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDTRLNLL--EDGTLMIQDTRETDQGVYQCMAKNVAGEVKTSEVTLRYFRSPSRPSFVIQ-PQNTEVLVGESVTLECSATGQPQPRVT--WTRGDQSALPVDPRINITPSGGLFIQNIHQAD-GGQYTCFASNNVDTIHANAYIIV 389          

HSP 3 Score: 76.2554 bits (186), Expect = 2.612e-13
Identity = 58/207 (28.02%), Postives = 97/207 (46.86%), Query Frame = 1
Query:  763 EVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWR-----NQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIV-RKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRS 1365
            EVK +E+    F  S   P F+ +PQ+  V VG+ +   C      + +V W     D +   +  R     +  LFI+ +H+   G Y C ASNN  +I A+A + +    +P     P   S  +G  V+F C A G+P P I W    S    L  + +++V    +L I  +   + +G+Y C A S  G+A+ +  + +++S
Sbjct:  285 EVKTSEVTLRYFR-SPSRPSFVIQPQNTEVLVGESVTLECSATGQPQPRVTW--TRGDQSALPVDPRINITPSGGLFIQNIHQADGGQYTCFASNNVDTIHANAYIIV--QARPQFTVTPQDQSVLEGQTVDFPCEASGFPQPVIAWTRGGSP---LPNDRRHVVLSTGSLRISRVALHD-QGQYECQAVSPVGTARAAVHLNILQS 482          
BLAST of Peroxidasin vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 406/961 (42.25%), Postives = 573/961 (59.63%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR---PCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSRLTPEDQVPGLSPSRSRRSTNEFQDQNCKSKTNQCSSNIS 3651
            +N++   +  P+F   PQD  V  G  + F C+     +  + W    +    +   +      L I  V    +G Y C A +  G+  A+  L I  +  P     P  ++ E GS V+  C A G P P ITW     + V++   GK+ +  +  +  +       GRY C A +  G +  S V+T+              ++P  ++  +  +   +++A   IN A   T  +L D    R+ +++ +LFR P     +E A+A +++E+ L  +   + +  +     TAY     +  L++P  L +I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+PF RL+KP Y+NG N P G T  + ++GY  P  RLVS+ ++    ITPD   + M+MQWGQFLDHDLD T V  S SRFSDG  C   C ND PCFPI+ PP DPR +R    C+ F RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   EA E+RDL    G LR G V  + K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W+REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITYN WLP +LG  G++ +G Y GYN  +++ I + FATAA RFGHTLINPILYRLDENF+ I +G++ LHKAFF+P R++ +GGIDP+LRGLF +  K   S Q++N EL E+LF+MAH VALDL A+NIQRGRDHG+ SYN +R FC +  A+TF+D   EI +  +REK++++YG P NVDLF   + E+ V G  +GPTL CLL  QFKRLRDGDRFWYE+   F PAQL+Q+KQ +L+R+LCDN DNI+R+Q + F +A     +  C+++P+++L  W++C +  R   + Q   LS     R + E      K   N  + NI+
Sbjct:  418 ANAYIIVQARPQFTVTPQDQSVLEGQTVDFPCEASGFPQPVIAWTRGGSPLPNDRRHVVLSTGSLRISRVALHDQGQYECQAVSPVGTARAAVHLNILQSVTPVFTSAPRDLTVESGSDVQIPCSAQGEPTPIITW---SKDGVQITESGKFHINPDGYLEVHDVGLADGGRYECVARNSIGYSSSSMVLTV--------------QVPQVSREGDPFVSTSLEEAIRSINSAIDSTRRQLFD-GSPRTPAELLALFRYPRDPYTVEQARAGEIFEQTLLLIQRHVNQGLMVDTNGTAYR----YNDLVSPRFLDMIANLSGCTAHRRINNCSD-ICFHQKYRTHDGTCNNLQHPMWGASLTPFERLLKPVYDNGFNLPRG-TTERWHNGYPLPLPRLVSTTMIGTETITPDDRYTHMLMQWGQFLDHDLDSTVVSLSQSRFSDGQLCTSVCTNDPPCFPIMFPPNDPRQRRNGARCMFFVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSQHEAEEIRDLASHRGMLRQGIVQRTGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTAMHTVWLREHNRIASELLRLNPHWDGDTIYHEARKIVGAQMQHITYNQWLPKILGEAGMRIMGDYTGYNPNINAGILNAFATAAFRFGHTLINPILYRLDENFQPIQQGHISLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRMSTQLLNTELTERLFSMAHAVALDLAAMNIQRGRDHGIPSYNDYRVFCNLTSAQTFEDLKNEIQNPSVREKLQRLYGTPLNVDLFPALMAEELVPGSRLGPTLMCLLATQFKRLRDGDRFWYENPGSFSPAQLTQLKQTSLSRVLCDNGDNITRIQSDAFSVADLPHGYGSCADLPKIDLRMWQDCCEDCRT--KGQFNALSFHFRGRRSAEHSYAEEKKPANNLTENIN 1352          

HSP 2 Score: 113.62 bits (283), Expect = 8.519e-25
Identity = 111/430 (25.81%), Postives = 187/430 (43.49%), Query Frame = 1
Query:  184 IVIIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSL---------PGN---------------SISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPI-SLEKLINVKRLELYGNMLYCGCELRYFAGNLRRI---GLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASA---KLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            ++ +FL S     VS+    C  +C C   TV C     + +P +   + T L L         PG+                I +I    F++ ++L ++ L  N+I  ++  A  G + LE LYL  N IE L  + FS      +L    NNR+  L + +   L ++KRL L  N L+C CEL + A  L++    G     + C  P  ++ + +  +  +EL C          P+    PQD  V  G+ + F C+ E   + ++ W    N      DT  N L   +  L I++  E  +G+Y C A N  G +  S    +   +P++  ++++ P +     G  V   C A G P P +T  W + +Q  L  + +  I     L I+NI +++  G+Y C+AS+   +   +A I +
Sbjct:   15 VLSVFLLSSGPYRVSS----CPSRCLCFRTTVRCMHLNLESVPAVL-PQTTILDLRFNKIKDLQPGSFKRLKNLNTLLLNNNHIRRIPRGAFEDLENLKYLYLYKNEIQAIDREAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLH-NNRISHLALGTFSHLQSMKRLRLDSNALHCDCELLWLADLLKQYAESGNAQAAATCDYPNRLQGRSVATLTAHELNCE--------VPRITSEPQDVDVTSGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDTRLNLL--EDGTLMIQDTRETDQGVYQCMAKNVAGEVKTSEVTLRYFRSPSRPSFVIQ-PQNTEVLVGESVTLECSATGQPQPRVT--WTRGDQSALPVDPRINITPSGGLFIQNIHQAD-GGQYTCFASNNVDTIHANAYIIV 424          

HSP 3 Score: 76.2554 bits (186), Expect = 2.612e-13
Identity = 58/207 (28.02%), Postives = 97/207 (46.86%), Query Frame = 1
Query:  763 EVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWR-----NQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIV-RKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRS 1365
            EVK +E+    F  S   P F+ +PQ+  V VG+ +   C      + +V W     D +   +  R     +  LFI+ +H+   G Y C ASNN  +I A+A + +    +P     P   S  +G  V+F C A G+P P I W    S    L  + +++V    +L I  +   + +G+Y C A S  G+A+ +  + +++S
Sbjct:  320 EVKTSEVTLRYFR-SPSRPSFVIQPQNTEVLVGESVTLECSATGQPQPRVTW--TRGDQSALPVDPRINITPSGGLFIQNIHQADGGQYTCFASNNVDTIHANAYIIV--QARPQFTVTPQDQSVLEGQTVDFPCEASGFPQPVIAWTRGGSP---LPNDRRHVVLSTGSLRISRVALHD-QGQYECQAVSPVGTARAAVHLNILQS 517          
BLAST of Peroxidasin vs. Ensembl Zebrafish
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 406/961 (42.25%), Postives = 573/961 (59.63%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR---PCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSRLTPEDQVPGLSPSRSRRSTNEFQDQNCKSKTNQCSSNIS 3651
            +N++   +  P+F   PQD  V  G  + F C+     +  + W    +    +   +      L I  V    +G Y C A +  G+  A+  L I  +  P     P  ++ E GS V+  C A G P P ITW     + V++   GK+ +  +  +  +       GRY C A +  G +  S V+T+              ++P  ++  +  +   +++A   IN A   T  +L D    R+ +++ +LFR P     +E A+A +++E+ L  +   + +  +     TAY     +  L++P  L +I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+PF RL+KP Y+NG N P G T  + ++GY  P  RLVS+ ++    ITPD   + M+MQWGQFLDHDLD T V  S SRFSDG  C   C ND PCFPI+ PP DPR +R    C+ F RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   EA E+RDL    G LR G V  + K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W+REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITYN WLP +LG  G++ +G Y GYN  +++ I + FATAA RFGHTLINPILYRLDENF+ I +G++ LHKAFF+P R++ +GGIDP+LRGLF +  K   S Q++N EL E+LF+MAH VALDL A+NIQRGRDHG+ SYN +R FC +  A+TF+D   EI +  +REK++++YG P NVDLF   + E+ V G  +GPTL CLL  QFKRLRDGDRFWYE+   F PAQL+Q+KQ +L+R+LCDN DNI+R+Q + F +A     +  C+++P+++L  W++C +  R   + Q   LS     R + E      K   N  + NI+
Sbjct:  415 ANAYIIVQARPQFTVTPQDQSVLEGQTVDFPCEASGFPQPVIAWTRGGSPLPNDRRHVVLSTGSLRISRVALHDQGQYECQAVSPVGTARAAVHLNILQSVTPVFTSAPRDLTVESGSDVQIPCSAQGEPTPIITW---SKDGVQITESGKFHINPDGYLEVHDVGLADGGRYECVARNSIGYSSSSMVLTV--------------QVPQVSREGDPFVSTSLEEAIRSINSAIDSTRRQLFD-GSPRTPAELLALFRYPRDPYTVEQARAGEIFEQTLLLIQRHVNQGLMVDTNGTAYR----YNDLVSPRFLDMIANLSGCTAHRRINNCSD-ICFHQKYRTHDGTCNNLQHPMWGASLTPFERLLKPVYDNGFNLPRG-TTERWHNGYPLPLPRLVSTTMIGTETITPDDRYTHMLMQWGQFLDHDLDSTVVSLSQSRFSDGQLCTSVCTNDPPCFPIMFPPNDPRQRRNGARCMFFVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSQHEAEEIRDLASHRGMLRQGIVQRTGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTAMHTVWLREHNRIASELLRLNPHWDGDTIYHEARKIVGAQMQHITYNQWLPKILGEAGMRIMGDYTGYNPNINAGILNAFATAAFRFGHTLINPILYRLDENFQPIQQGHISLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRMSTQLLNTELTERLFSMAHAVALDLAAMNIQRGRDHGIPSYNDYRVFCNLTSAQTFEDLKNEIQNPSVREKLQRLYGTPLNVDLFPALMAEELVPGSRLGPTLMCLLATQFKRLRDGDRFWYENPGSFSPAQLTQLKQTSLSRVLCDNGDNITRIQSDAFSVADLPHGYGSCADLPKIDLRMWQDCCEDCRT--KGQFNALSFHFRGRRSAEHSYAEEKKPANNLTENIN 1349          

HSP 2 Score: 114.005 bits (284), Expect = 6.942e-25
Identity = 106/408 (25.98%), Postives = 178/408 (43.63%), Query Frame = 1
Query:  250 PQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSL---------PGN---------------SISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPI-SLEKLINVKRLELYGNMLYCGCELRYFAGNLRRI---GLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASA---KLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            P+C C   TV C     + +P +   + T L L         PG+                I +I    F++ ++L ++ L  N+I  ++  A  G + LE LYL  N IE L  + FS      +L    NNR+  L + +   L ++KRL L  N L+C CEL + A  L++    G     + C  P  ++ + +  +  +EL C          P+    PQD  V  G+ + F C+ E   + ++ W    N      DT  N L   +  L I++  E  +G+Y C A N  G +  S    +   +P++  ++++ P +     G  V   C A G P P +T  W + +Q  L  + +  I     L I+NI +++  G+Y C+AS+   +   +A I +
Sbjct:   30 PRCLCFRTTVRCMHLNLESVPAVL-PQTTILDLRFNKIKDLQPGSFKRLKNLNTLLLNNNHIRRIPRGAFEDLENLKYLYLYKNEIQAIDREAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLH-NNRISHLALGTFSHLQSMKRLRLDSNALHCDCELLWLADLLKQYAESGNAQAAATCDYPNRLQGRSVATLTAHELNCE--------VPRITSEPQDVDVTSGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDTRLNLL--EDGTLMIQDTRETDQGVYQCMAKNVAGEVKTSEVTLRYFRSPSRPSFVIQ-PQNTEVLVGESVTLECSATGQPQPRVT--WTRGDQSALPVDPRINITPSGGLFIQNIHQAD-GGQYTCFASNNVDTIHANAYIIV 421          

HSP 3 Score: 76.2554 bits (186), Expect = 2.461e-13
Identity = 58/207 (28.02%), Postives = 97/207 (46.86%), Query Frame = 1
Query:  763 EVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWR-----NQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIV-RKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRS 1365
            EVK +E+    F  S   P F+ +PQ+  V VG+ +   C      + +V W     D +   +  R     +  LFI+ +H+   G Y C ASNN  +I A+A + +    +P     P   S  +G  V+F C A G+P P I W    S    L  + +++V    +L I  +   + +G+Y C A S  G+A+ +  + +++S
Sbjct:  317 EVKTSEVTLRYFR-SPSRPSFVIQPQNTEVLVGESVTLECSATGQPQPRVTW--TRGDQSALPVDPRINITPSGGLFIQNIHQADGGQYTCFASNNVDTIHANAYIIV--QARPQFTVTPQDQSVLEGQTVDFPCEASGFPQPVIAWTRGGSP---LPNDRRHVVLSTGSLRISRVALHD-QGQYECQAVSPVGTARAAVHLNILQS 514          
BLAST of Peroxidasin vs. Ensembl Zebrafish
Match: mpx (myeloid-specific peroxidase [Source:ZFIN;Acc:ZDB-GENE-030131-9460])

HSP 1 Score: 523.472 bits (1347), Expect = 1.113e-169
Identity = 285/717 (39.75%), Postives = 424/717 (59.14%), Query Frame = 1
Query: 1435 LYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDI------QSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHK--ITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP--CIGFSRSIATCGSGQSSIILGKL-HYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKR-LLPFNIRGQVDCQI------DPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKR-LGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPE-GNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYD 3525
            + + I++A+  ++ A+K +    RD +  R R D+        L +QP+    E  +A+D   + L     ++ E    +     ++ +++ T LLT ++L  I++++GC+  T    C      +K YR+  G CNN  NP  G++ +PF R +  +YE+ ++ P GW   KLY+G + P  RLVS+R+L      I  D + + M+  +GQ++DHDL FTP   S   FS+G+ C  +C    PCFPI  PPGD R+ RP  C+   RS  TCGSG ++ + G++ + REQ+N +T++LD   VY S+   A ELRDLT D G LRV      N R LLPF       C        D     VPCF AGD R NEN  L  +HT+++REHNRL+  L  LN  W+ + +Y E+RKIVGA  Q +    +LP+++G +   R LG YPGYN+ VD TI++VFATAA RF H  I P ++RLDEN++  P+  ++PL++AFF+P RV+ +GGIDP+LRGL    +K    D ++   L E+LFA    +ALDL +LN+QRGRDH +  YN+WR FCG+   +   + +  + ++E+  K+ ++YG P N+D++ G V E    GG VG   +CL+  QF+++RDGDR W+ES+  F   Q + +  V+LARI+CDN+  I +V R+ F   +S   F++C NIP  +L PWKE  D
Sbjct:   30 ILDSIEEAKKIVDAAYKYS----RDESLARVRKDVIKPSDKLRLLKQPARKTREAVRAADYMAQTLR----LISEKAHHV-----HKRSINATNLLTQDELQTITRMTGCEAQTRPPSCRTTPLINK-YRTASGVCNNRKNPLLGASNTPFARWLPAQYEDAVSQPKGWDPNKLYNGAALPMVRLVSNRILATADADIESDHDFTFMLTIFGQWVDHDLTFTPFSPSIRSFSNGIDCENSCERSEPCFPISAPPGDQRL-RPNTCLPVFRSAPTCGSGHTAYMFGEVPNVREQINTLTAYLDAGQVYGSEDGLAKELRDLTNDGGLLRVNNRFKDNGRELLPFTSVNTNLCATRQKILNDSTLTEVPCFIAGDARVNENPALNSLHTLFVREHNRLARALHVLNPTWSSETLYQEARKIVGAFNQILVIKEYLPLIVGPDAYNRHLGPYPGYNENVDPTIANVFATAAFRFAHLTIQPFIFRLDENYKNHPQFPSVPLYEAFFSPWRVIFEGGIDPVLRGLIGRPAKLNTQDHMLVNALRERLFAFTSHIALDLASLNMQRGRDHAIPGYNAWRRFCGLSAPQNEQELAVVMNNTELARKLIELYGTPENIDVWLGGVAEPFAPGGRVGSLFACLISRQFQKIRDGDRLWFESNGVFTTKQKTALASVSLARIICDNT-GILKVPRDPFRF-RSPANFVNCGNIPAFDLEPWKETGD 729          
BLAST of Peroxidasin vs. Ensembl Xenopus
Match: polr1e (polymerase (RNA) I polypeptide E [Source:Xenbase;Acc:XB-GENE-1003651])

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 391/922 (42.41%), Postives = 567/922 (61.50%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLY--WRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILREN-KVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR--PCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            S ++   +  P+F   PQD  V  G  + F C+ +   +  + W    N  + +  +    +  L I  V    +G Y C A N  GS S +A+L +     P     P  ++ E G+ V+  C + G P+P ITW     + +++   GK+ +  +  +         +GRY C A +  G + VS V++++              +P  ++  +  +   I +A + ++ A   T   L D +R RS  D+ +LFR P     +E A+A++++E+ L  +   ++    V LN T+ +     +  L++P+ L +I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+ F RL+K  YENG N P G  +G++Y+G+  P  RLVS+ L+  H ITPD   + M+MQWGQFLDHDLD T V  S +RFSDG  C+  C ND+PCFPI+ PP DPRV+    C+   RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   E+ E+RD     G L+ G V  S K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITY+ WLP + G  G+K LG+Y  Y+  V++ I + FATAA RFGHTLINPILYRLDE FE IP+G++PLH+AFF+P R++ +GGIDP+LRGL  + +K   + Q++N EL EKLF+MAH VALDL ALN+QRGRDHG+  Y+ +R FC +   +TFDD   EI + ++REK++++YG P N+DLF   ++E  + G  +GPTL CLL  QF+ +RDGDRFWYE+   F  AQL+QIKQ +LAR+LCDN DNI++VQ ++F +A+    ++ C NI +++L  W++C +  R
Sbjct:  416 STAYIIVQAVPQFTVVPQDRNVFEGHTVDFHCEAQGNPKPVIAWTKGGNQLSVDRRHQVLSSGTLRILRVALHDQGQYECQAVNIVGSKSTAAQLIVQTRVTPVFATVPNDMTVEVGTDVQIPCSSQGDPLPIITW---NKDGIQVTESGKFHISPHGYLAIRDAGLADQGRYECVARNPIGYSSVSMVLSVL--------------VPEVSRTGDPFVATSIIEAIATVDRAINSTRTHLFD-SRPRSPGDLLALFRYPRDPYTVEQARAAEIFERTLQLIQDHVQSGLMVDLNGTSYH-----YNDLVSPQYLNMIANLSGCATHRRINNCSN-MCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNLPRG-ISGRIYNGFPLPLPRLVSTTLIGTHTITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQDCSVVCTNDAPCFPIMVPPNDPRVRNNARCMSMVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSDHESNEIRDSASHRGLLKQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLRLNPHWDGDTIYHETRKIVGAQMQHITYSHWLPKIFGDVGMKMLGEYKSYDPNVNAGILNEFATAAFRFGHTLINPILYRLDEKFEPIPQGHVPLHRAFFSPFRIVNEGGIDPLLRGLIGVAAKMRVTSQLLNTELTEKLFSMAHAVALDLAALNVQRGRDHGIPPYHDFRVFCNLSTVQTFDDLRNEIKNPDVREKLKRLYGSPLNIDLFPALMVEDLIPGSRLGPTLMCLLTTQFRNIRDGDRFWYENPGVFTAAQLTQIKQTSLARVLCDNGDNITKVQHDLFRVAEFPHGYVSCKNIAKMDLRVWQDCCEDCR 1312          

HSP 2 Score: 106.301 bits (264), Expect = 2.330e-22
Identity = 99/427 (23.19%), Postives = 173/427 (40.52%), Query Frame = 1
Query:  190 IIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGN------------------------SISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLR---RIGLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSIS---ASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            +     L  +++      C  +C C   TV C     + +P +     T L L  N                         I +I +  FK+ ++L ++ L  N+I  ++  A  G   LE LYL  N IE L  + F+      +L    N     +P +  +L ++KRL L  N L+C CE+ + A  L+     G     + C+ P  ++ + +  +  +EL C          P+    PQD  V  G+ + F C+ E   + ++ W    N      D+  N L   +  L I+   E  +GIY C A N  G +     + +    P    ++++ P +     G  V   C A G P P +T  W + ++  L ++ +  I     L I+N+ + +  G Y C+A++   +   +A I +
Sbjct:   11 LYLTAGLLVVALPQLSHSCPSRCLCFRTTVRCMHLMLESVPAVP-PHTTILDLRFNRIKDIQTGAFKHLKNLNTLLLNNNQIKRIPSEAFKDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLEPESFNYLPKLERLFLHNNRITHLVPGTFSQLESMKRLRLDSNALHCDCEILWLADLLKIYSESGNAQAAATCEYPRRLQGRSVSTITPSELNCER--------PRITSEPQDVDVTFGNTVYFTCRAEGNPKPEIIWLRNNNELSMKDDSRLNLL--NDGTLMIQNTKETDQGIYQCMAKNVAGEVKTHEVTLRYYGTPATPTFVIQ-PQNTEVLVGESVTLECSATGQPHPRVT--WTRGDRTPLPSDPRINITPSGGLYIQNVNQDDA-GEYTCFATNSVETIHSTAYIIV 422          
BLAST of Peroxidasin vs. Ensembl Xenopus
Match: polr1e (polymerase (RNA) I polypeptide E [Source:Xenbase;Acc:XB-GENE-1003651])

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 391/922 (42.41%), Postives = 567/922 (61.50%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLY--WRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILREN-KVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR--PCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            S ++   +  P+F   PQD  V  G  + F C+ +   +  + W    N  + +  +    +  L I  V    +G Y C A N  GS S +A+L +     P     P  ++ E G+ V+  C + G P+P ITW     + +++   GK+ +  +  +         +GRY C A +  G + VS V++++              +P  ++  +  +   I +A + ++ A   T   L D +R RS  D+ +LFR P     +E A+A++++E+ L  +   ++    V LN T+ +     +  L++P+ L +I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+ F RL+K  YENG N P G  +G++Y+G+  P  RLVS+ L+  H ITPD   + M+MQWGQFLDHDLD T V  S +RFSDG  C+  C ND+PCFPI+ PP DPRV+    C+   RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   E+ E+RD     G L+ G V  S K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITY+ WLP + G  G+K LG+Y  Y+  V++ I + FATAA RFGHTLINPILYRLDE FE IP+G++PLH+AFF+P R++ +GGIDP+LRGL  + +K   + Q++N EL EKLF+MAH VALDL ALN+QRGRDHG+  Y+ +R FC +   +TFDD   EI + ++REK++++YG P N+DLF   ++E  + G  +GPTL CLL  QF+ +RDGDRFWYE+   F  AQL+QIKQ +LAR+LCDN DNI++VQ ++F +A+    ++ C NI +++L  W++C +  R
Sbjct:  392 STAYIIVQAVPQFTVVPQDRNVFEGHTVDFHCEAQGNPKPVIAWTKGGNQLSVDRRHQVLSSGTLRILRVALHDQGQYECQAVNIVGSKSTAAQLIVQTRVTPVFATVPNDMTVEVGTDVQIPCSSQGDPLPIITW---NKDGIQVTESGKFHISPHGYLAIRDAGLADQGRYECVARNPIGYSSVSMVLSVL--------------VPEVSRTGDPFVATSIIEAIATVDRAINSTRTHLFD-SRPRSPGDLLALFRYPRDPYTVEQARAAEIFERTLQLIQDHVQSGLMVDLNGTSYH-----YNDLVSPQYLNMIANLSGCATHRRINNCSN-MCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNLPRG-ISGRIYNGFPLPLPRLVSTTLIGTHTITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQDCSVVCTNDAPCFPIMVPPNDPRVRNNARCMSMVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSDHESNEIRDSASHRGLLKQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLRLNPHWDGDTIYHETRKIVGAQMQHITYSHWLPKIFGDVGMKMLGEYKSYDPNVNAGILNEFATAAFRFGHTLINPILYRLDEKFEPIPQGHVPLHRAFFSPFRIVNEGGIDPLLRGLIGVAAKMRVTSQLLNTELTEKLFSMAHAVALDLAALNVQRGRDHGIPPYHDFRVFCNLSTVQTFDDLRNEIKNPDVREKLKRLYGSPLNIDLFPALMVEDLIPGSRLGPTLMCLLTTQFRNIRDGDRFWYENPGVFTAAQLTQIKQTSLARVLCDNGDNITKVQHDLFRVAEFPHGYVSCKNIAKMDLRVWQDCCEDCR 1288          

HSP 2 Score: 102.449 bits (254), Expect = 3.015e-21
Identity = 98/403 (24.32%), Postives = 168/403 (41.69%), Query Frame = 1
Query:  190 IIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLR---RIGLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSIS---ASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            +     L  +++      C  +C C   TV C     + +P +     T L L  N I  I    FK  K+L  + L+ N+I  +   A      L+ LYL  N IE L  + F+      +L    N     +P +  +L ++KRL L  N L+C CE+ + A  L+     G     + C+ P  ++ + +  +  +EL C          P+    PQD  V  G+ + F C+ E   + ++ W    N      D+  N L   +  L I+   E  +GIY C A N  G +     + +    P    ++++ P +     G  V   C A G P P +T  W + ++  L ++ +  I     L I+N+ + +  G Y C+A++   +   +A I +
Sbjct:   11 LYLTAGLLVVALPQLSHSCPSRCLCFRTTVRCMHLMLESVPAVP-PHTTILDLRFNRIKDIQTGAFKHLKNLNTLLLNNNQIKRIPSEAFKDLENLKYLYLHFNQIETLEPESFNYLPKLERLFLHNNRITHLVPGTFSQLESMKRLRLDSNALHCDCEILWLADLLKIYSESGNAQAAATCEYPRRLQGRSVSTITPSELNCER--------PRITSEPQDVDVTFGNTVYFTCRAEGNPKPEIIWLRNNNELSMKDDSRLNLL--NDGTLMIQNTKETDQGIYQCMAKNVAGEVKTHEVTLRYYGTPATPTFVIQ-PQNTEVLVGESVTLECSATGQPHPRVT--WTRGDRTPLPSDPRINITPSGGLYIQNVNQDDA-GEYTCFATNSVETIHSTAYIIV 398          
BLAST of Peroxidasin vs. Ensembl Xenopus
Match: polr1e (polymerase (RNA) I polypeptide E [Source:Xenbase;Acc:XB-GENE-1003651])

HSP 1 Score: 766.533 bits (1978), Expect = 0.000e+0
Identity = 391/922 (42.41%), Postives = 567/922 (61.50%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLY--WRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILREN-KVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR--PCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            S ++   +  P+F   PQD  V  G  + F C+ +   +  + W    N  + +  +    +  L I  V    +G Y C A N  GS S +A+L +     P     P  ++ E G+ V+  C + G P+P ITW     + +++   GK+ +  +  +         +GRY C A +  G + VS V++++              +P  ++  +  +   I +A + ++ A   T   L D +R RS  D+ +LFR P     +E A+A++++E+ L  +   ++    V LN T+ +     +  L++P+ L +I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+ F RL+K  YENG N P G  +G++Y+G+  P  RLVS+ L+  H ITPD   + M+MQWGQFLDHDLD T V  S +RFSDG  C+  C ND+PCFPI+ PP DPRV+    C+   RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   E+ E+RD     G L+ G V  S K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITY+ WLP + G  G+K LG+Y  Y+  V++ I + FATAA RFGHTLINPILYRLDE FE IP+G++PLH+AFF+P R++ +GGIDP+LRGL  + +K   + Q++N EL EKLF+MAH VALDL ALN+QRGRDHG+  Y+ +R FC +   +TFDD   EI + ++REK++++YG P N+DLF   ++E  + G  +GPTL CLL  QF+ +RDGDRFWYE+   F  AQL+QIKQ +LAR+LCDN DNI++VQ ++F +A+    ++ C NI +++L  W++C +  R
Sbjct:  482 STAYIIVQAVPQFTVVPQDRNVFEGHTVDFHCEAQGNPKPVIAWTKGGNQLSVDRRHQVLSSGTLRILRVALHDQGQYECQAVNIVGSKSTAAQLIVQTRVTPVFATVPNDMTVEVGTDVQIPCSSQGDPLPIITW---NKDGIQVTESGKFHISPHGYLAIRDAGLADQGRYECVARNPIGYSSVSMVLSVL--------------VPEVSRTGDPFVATSIIEAIATVDRAINSTRTHLFD-SRPRSPGDLLALFRYPRDPYTVEQARAAEIFERTLQLIQDHVQSGLMVDLNGTSYH-----YNDLVSPQYLNMIANLSGCATHRRINNCSN-MCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNLPRG-ISGRIYNGFPLPLPRLVSTTLIGTHTITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQDCSVVCTNDAPCFPIMVPPNDPRVRNNARCMSMVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSDHESNEIRDSASHRGLLKQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLRLNPHWDGDTIYHETRKIVGAQMQHITYSHWLPKIFGDVGMKMLGEYKSYDPNVNAGILNEFATAAFRFGHTLINPILYRLDEKFEPIPQGHVPLHRAFFSPFRIVNEGGIDPLLRGLIGVAAKMRVTSQLLNTELTEKLFSMAHAVALDLAALNVQRGRDHGIPPYHDFRVFCNLSTVQTFDDLRNEIKNPDVREKLKRLYGSPLNIDLFPALMVEDLIPGSRLGPTLMCLLTTQFRNIRDGDRFWYENPGVFTAAQLTQIKQTSLARVLCDNGDNITKVQHDLFRVAEFPHGYVSCKNIAKMDLRVWQDCCEDCR 1378          

HSP 2 Score: 108.612 bits (270), Expect = 5.026e-23
Identity = 104/446 (23.32%), Postives = 180/446 (40.36%), Query Frame = 1
Query:  142 SPNCFQFD*IMNFFIV---IIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGN------------------------SISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLR---RIGLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSIS---ASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            SP CF +  +M        +     L  +++      C  +C C   TV C     + +P +     T L L  N                         I +I +  FK+ ++L ++ L  N+I  ++  A  G   LE LYL  N IE L  + F+      +L    N     +P +  +L ++KRL L  N L+C CE+ + A  L+     G     + C+ P  ++ + +  +  +EL C          P+    PQD  V  G+ + F C+ E   + ++ W    N      D+  N L   +  L I+   E  +GIY C A N  G +     + +    P    ++++ P +     G  V   C A G P P +T  W + ++  L ++ +  I     L I+N+ + +  G Y C+A++   +   +A I +
Sbjct:   58 SPECFPWLLMMMMAGAGSWLYLTAGLLVVALPQLSHSCPSRCLCFRTTVRCMHLMLESVPAVP-PHTTILDLRFNRIKDIQTGAFKHLKNLNTLLLNNNQIKRIPSEAFKDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLEPESFNYLPKLERLFLHNNRITHLVPGTFSQLESMKRLRLDSNALHCDCEILWLADLLKIYSESGNAQAAATCEYPRRLQGRSVSTITPSELNCER--------PRITSEPQDVDVTFGNTVYFTCRAEGNPKPEIIWLRNNNELSMKDDSRLNLL--NDGTLMIQNTKETDQGIYQCMAKNVAGEVKTHEVTLRYYGTPATPTFVIQ-PQNTEVLVGESVTLECSATGQPHPRVT--WTRGDRTPLPSDPRINITPSGGLYIQNVNQDDA-GEYTCFATNSVETIHSTAYIIV 488          
BLAST of Peroxidasin vs. Ensembl Xenopus
Match: polr1e (polymerase (RNA) I polypeptide E [Source:Xenbase;Acc:XB-GENE-1003651])

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 391/922 (42.41%), Postives = 567/922 (61.50%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLY--WRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILREN-KVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP--CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            S ++   +  P+F   PQD  V  G  + F C+ +   +  + W    N  + +  +    +  L I  V    +G Y C A N  GS S +A+L +     P     P  ++ E G+ V+  C + G P+P ITW     + +++   GK+ +  +  +         +GRY C A +  G + VS V++++              +P  ++  +  +   I +A + ++ A   T   L D +R RS  D+ +LFR P     +E A+A++++E+ L  +   ++    V LN T+ +     +  L++P+ L +I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+ F RL+K  YENG N P G  +G++Y+G+  P  RLVS+ L+  H ITPD   + M+MQWGQFLDHDLD T V  S +RFSDG  C+  C ND+PCFPI+ PP DPRV+    C+   RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   E+ E+RD     G L+ G V  S K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITY+ WLP + G  G+K LG+Y  Y+  V++ I + FATAA RFGHTLINPILYRLDE FE IP+G++PLH+AFF+P R++ +GGIDP+LRGL  + +K   + Q++N EL EKLF+MAH VALDL ALN+QRGRDHG+  Y+ +R FC +   +TFDD   EI + ++REK++++YG P N+DLF   ++E  + G  +GPTL CLL  QF+ +RDGDRFWYE+   F  AQL+QIKQ +LAR+LCDN DNI++VQ ++F +A+    ++ C NI +++L  W++C +  R
Sbjct:  249 STAYIIVQAVPQFTVVPQDRNVFEGHTVDFHCEAQGNPKPVIAWTKGGNQLSVDRRHQVLSSGTLRILRVALHDQGQYECQAVNIVGSKSTAAQLIVQTRVTPVFATVPNDMTVEVGTDVQIPCSSQGDPLPIITW---NKDGIQVTESGKFHISPHGYLAIRDAGLADQGRYECVARNPIGYSSVSMVLSVL--------------VPEVSRTGDPFVATSIIEAIATVDRAINSTRTHLFD-SRPRSPGDLLALFRYPRDPYTVEQARAAEIFERTLQLIQDHVQSGLMVDLNGTSYH-----YNDLVSPQYLNMIANLSGCATHRRINNCSN-MCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNLPRG-ISGRIYNGFPLPLPRLVSTTLIGTHTITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQDCSVVCTNDAPCFPIMVPPNDPRVRNNARCMSMVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSDHESNEIRDSASHRGLLKQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLRLNPHWDGDTIYHETRKIVGAQMQHITYSHWLPKIFGDVGMKMLGEYKSYDPNVNAGILNEFATAAFRFGHTLINPILYRLDEKFEPIPQGHVPLHRAFFSPFRIVNEGGIDPLLRGLIGVAAKMRVTSQLLNTELTEKLFSMAHAVALDLAALNVQRGRDHGIPPYHDFRVFCNLSTVQTFDDLRNEIKNPDVREKLKRLYGSPLNIDLFPALMVEDLIPGSRLGPTLMCLLTTQFRNIRDGDRFWYENPGVFTAAQLTQIKQTSLARVLCDNGDNITKVQHDLFRVAEFPHGYVSCKNIAKMDLRVWQDCCEDCR 1145          

HSP 2 Score: 73.1738 bits (178), Expect = 2.691e-12
Identity = 60/255 (23.53%), Postives = 108/255 (42.35%), Query Frame = 1
Query:  634 LYGNMLYCGCELRYFAGNLR---RIGLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISA---SAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            L  N L+C CE+ + A  L+     G     + C+ P  ++ + +  +  +EL C          P+    PQD  V  G+ + F C+ E   + ++ W    N      D+  N L   +  L I+   E  +GIY C A N  G +     + +    P    ++++ P +     G  V   C A G P P +T  W + ++  L ++ +  I     L I+N+ + +  G Y C+A++   +   +A I +
Sbjct:   15 LDSNALHCDCEILWLADLLKIYSESGNAQAAATCEYPRRLQGRSVSTITPSELNCER--------PRITSEPQDVDVTFGNTVYFTCRAEGNPKPEIIWLRNNNELSMKDDSRLNLL--NDGTLMIQNTKETDQGIYQCMAKNVAGEVKTHEVTLRYYGTPATPTFVIQ-PQNTEVLVGESVTLECSATGQPHPRVT--WTRGDRTPLPSDPRINITPSGGLYIQNVNQDDA-GEYTCFATNSVETIHSTAYIIV 255          
BLAST of Peroxidasin vs. Ensembl Xenopus
Match: polr1e (polymerase (RNA) I polypeptide E [Source:Xenbase;Acc:XB-GENE-1003651])

HSP 1 Score: 765.763 bits (1976), Expect = 0.000e+0
Identity = 391/922 (42.41%), Postives = 567/922 (61.50%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLY--WRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILREN-KVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR--PCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            S ++   +  P+F   PQD  V  G  + F C+ +   +  + W    N  + +  +    +  L I  V    +G Y C A N  GS S +A+L +     P     P  ++ E G+ V+  C + G P+P ITW     + +++   GK+ +  +  +         +GRY C A +  G + VS V++++              +P  ++  +  +   I +A + ++ A   T   L D +R RS  D+ +LFR P     +E A+A++++E+ L  +   ++    V LN T+ +     +  L++P+ L +I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+ F RL+K  YENG N P G  +G++Y+G+  P  RLVS+ L+  H ITPD   + M+MQWGQFLDHDLD T V  S +RFSDG  C+  C ND+PCFPI+ PP DPRV+    C+   RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   E+ E+RD     G L+ G V  S K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITY+ WLP + G  G+K LG+Y  Y+  V++ I + FATAA RFGHTLINPILYRLDE FE IP+G++PLH+AFF+P R++ +GGIDP+LRGL  + +K   + Q++N EL EKLF+MAH VALDL ALN+QRGRDHG+  Y+ +R FC +   +TFDD   EI + ++REK++++YG P N+DLF   ++E  + G  +GPTL CLL  QF+ +RDGDRFWYE+   F  AQL+QIKQ +LAR+LCDN DNI++VQ ++F +A+    ++ C NI +++L  W++C +  R
Sbjct:  421 STAYIIVQAVPQFTVVPQDRNVFEGHTVDFHCEAQGNPKPVIAWTKGGNQLSVDRRHQVLSSGTLRILRVALHDQGQYECQAVNIVGSKSTAAQLIVQTRVTPVFATVPNDMTVEVGTDVQIPCSSQGDPLPIITW---NKDGIQVTESGKFHISPHGYLAIRDAGLADQGRYECVARNPIGYSSVSMVLSVL--------------VPEVSRTGDPFVATSIIEAIATVDRAINSTRTHLFD-SRPRSPGDLLALFRYPRDPYTVEQARAAEIFERTLQLIQDHVQSGLMVDLNGTSYH-----YNDLVSPQYLNMIANLSGCATHRRINNCSN-MCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNLPRG-ISGRIYNGFPLPLPRLVSTTLIGTHTITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQDCSVVCTNDAPCFPIMVPPNDPRVRNNARCMSMVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSDHESNEIRDSASHRGLLKQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLRLNPHWDGDTIYHETRKIVGAQMQHITYSHWLPKIFGDVGMKMLGEYKSYDPNVNAGILNEFATAAFRFGHTLINPILYRLDEKFEPIPQGHVPLHRAFFSPFRIVNEGGIDPLLRGLIGVAAKMRVTSQLLNTELTEKLFSMAHAVALDLAALNVQRGRDHGIPPYHDFRVFCNLSTVQTFDDLRNEIKNPDVREKLKRLYGSPLNIDLFPALMVEDLIPGSRLGPTLMCLLTTQFRNIRDGDRFWYENPGVFTAAQLTQIKQTSLARVLCDNGDNITKVQHDLFRVAEFPHGYVSCKNIAKMDLRVWQDCCEDCR 1317          

HSP 2 Score: 105.916 bits (263), Expect = 2.695e-22
Identity = 99/427 (23.19%), Postives = 173/427 (40.52%), Query Frame = 1
Query:  190 IIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGN------------------------SISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLR---RIGLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSIS---ASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            +     L  +++      C  +C C   TV C     + +P +     T L L  N                         I +I +  FK+ ++L ++ L  N+I  ++  A  G   LE LYL  N IE L  + F+      +L    N     +P +  +L ++KRL L  N L+C CE+ + A  L+     G     + C+ P  ++ + +  +  +EL C          P+    PQD  V  G+ + F C+ E   + ++ W    N      D+  N L   +  L I+   E  +GIY C A N  G +     + +    P    ++++ P +     G  V   C A G P P +T  W + ++  L ++ +  I     L I+N+ + +  G Y C+A++   +   +A I +
Sbjct:   16 LYLTAGLLVVALPQLSHSCPSRCLCFRTTVRCMHLMLESVPAVP-PHTTILDLRFNRIKDIQTGAFKHLKNLNTLLLNNNQIKRIPSEAFKDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLEPESFNYLPKLERLFLHNNRITHLVPGTFSQLESMKRLRLDSNALHCDCEILWLADLLKIYSESGNAQAAATCEYPRRLQGRSVSTITPSELNCER--------PRITSEPQDVDVTFGNTVYFTCRAEGNPKPEIIWLRNNNELSMKDDSRLNLL--NDGTLMIQNTKETDQGIYQCMAKNVAGEVKTHEVTLRYYGTPATPTFVIQ-PQNTEVLVGESVTLECSATGQPHPRVT--WTRGDRTPLPSDPRINITPSGGLYIQNVNQDDA-GEYTCFATNSVETIHSTAYIIV 427          
BLAST of Peroxidasin vs. Ensembl Mouse
Match: Pxdn (peroxidasin [Source:MGI Symbol;Acc:MGI:1916925])

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 400/922 (43.38%), Postives = 561/922 (60.85%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILREN-KVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP--CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            + +F   +  P+F   PQ   V  G  + F C  +   +  + W    +  + +   L   +  L I  V    +G Y C A N  GS    A L + P   P     P+ ++ E G+ V+  C + G P P ITW     + V++   GK+ +     +  N   +   GRY C A +  G A VS V+++               +P  ++  +  +   I +A + ++ A   T   L D +R RS +D+ +LFR P     +  A+A +++E+ L  +   ++    V LN T+ +     +  L++P+ L++I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+ F RL+K  YENG NTP G  + + Y+G+  P  RLVS+ L+    ITPD   + M+MQWGQFLDHDLD T V  S +RFSDG  C+  C ND PCF ++ PP DPRV+    C+ F RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   EA  +RDL    G LR G V  S K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W REHNR++ EL  LN HW+GD +Y+E+RKIVGA +QHITY  WLP +LG  G+K LG+Y GY+  V++ I + FATAA RFGHTLINP+LYRLDENFE IP+G++PLHKAFF+P R++ +GGIDP+LRGLF +  K     Q++N EL E+LF+MAH VALDL A+NIQRGRDHG+  Y+ +R +C +  A TF+D   EI S  IREK++++YG   N+DLF   ++E  V G  +GPTL CLL  QF+RLRDGDR WYE+   F PAQL+Q+KQ +LARILCDNSDNI+RVQ++VF +A+    +  C +IPR++L  W++C +  R
Sbjct:  420 ATAFIIVQALPQFTVTPQSRVVIEGQTVDFQCAAKGHPQPVIAWTKGGSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDMTVEVGTNVQLPCSSQGEPEPAITW---NKDGVQVTESGKFHISPEGFLTINDVGTADAGRYECVARNTIGYASVSMVLSV--------------NVPDVSRNGDPYVATSIVEAIATVDRAINSTRTHLFD-SRPRSPNDLLALFRYPRDPYTVGQARAGEIFERTLQLIQEHVQHGLMVDLNGTSYH-----YNDLVSPQYLSLIANLSGCTAHRRVNNCSD-MCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKAVYENGFNTPRGINSQRQYNGHVLPMPRLVSTTLIGTEVITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQHCSSVCSNDPPCFSVMIPPNDPRVRSGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQLTSYIDASNVYGSTDHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIAAELLKLNPHWDGDTVYHETRKIVGAEIQHITYRHWLPKILGEVGMKMLGEYRGYDPSVNAGIFNAFATAAFRFGHTLINPLLYRLDENFEPIPQGHVPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRIPSQLLNTELTERLFSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAYTFEDLKNEIKSPVIREKLQRLYGSTLNIDLFPALMVEDLVPGSRLGPTLMCLLSTQFRRLRDGDRLWYENPGVFSPAQLTQLKQTSLARILCDNSDNITRVQQDVFRVAEFPHGYSSCEDIPRVDLRVWQDCCEDCR 1317          

HSP 2 Score: 118.242 bits (295), Expect = 4.006e-26
Identity = 108/415 (26.02%), Postives = 175/415 (42.17%), Query Frame = 1
Query:  223 VSTTGQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSL---------PG---------------NSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLR---RIGLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKG-SISASAKLK-IAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
             S  G  C  +C C   TV C     + +P +   + + L L         PG               N I KI    F++ ++L ++ L  N+I  ++  A  G   LE LYL  N IE L  + F       +L    N     +P +  +L ++KRL L  N L+C CE+ + A  L+   + G     + C+ P  ++ + +  +   EL C          P+    PQDA V  G+ + F C+ E   + ++ W    N      D+  N L   +  L I+   E  EG+Y C A N  G + +    L+ +    +P  V  P +     G  V   C A G+P+P+IT  W + ++  L  + +  I     L I+N+ +S+  G Y C+AS+   S   +A I +
Sbjct:   26 ASKQGAGCPSRCLCFRTTVRCMHLLLEAVPAVA-PQTSILDLRFNRIREIQPGAFRRLRSLNTLLLNNNQIKKIPNGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPESFQHLPKLERLFLHNNRITHLVPGTFSQLESMKRLRLDSNALHCDCEILWLADLLKTYAQSGNAQAAATCEYPRRIQGRSVATITPEELNCER--------PRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWLRNNNELSMKTDSRLNLL--DDGTLMIQNTQEADEGVYQCMAKNVAGEAKTQEVTLRYLGSPARPTFVIQPQNTEVLVGESVTLECSATGHPLPQIT--WTRGDRTPLPIDPRVNITPSGGLYIQNVAQSD-SGEYTCFASNSVDSIHATAFIIV 426          
BLAST of Peroxidasin vs. Ensembl Mouse
Match: Pxdn (peroxidasin [Source:MGI Symbol;Acc:MGI:1916925])

HSP 1 Score: 771.541 bits (1991), Expect = 0.000e+0
Identity = 400/922 (43.38%), Postives = 561/922 (60.85%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILREN-KVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP--CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            + +F   +  P+F   PQ   V  G  + F C  +   +  + W    +  + +   L   +  L I  V    +G Y C A N  GS    A L + P   P     P+ ++ E G+ V+  C + G P P ITW     + V++   GK+ +     +  N   +   GRY C A +  G A VS V+++               +P  ++  +  +   I +A + ++ A   T   L D +R RS +D+ +LFR P     +  A+A +++E+ L  +   ++    V LN T+ +     +  L++P+ L++I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+ F RL+K  YENG NTP G  + + Y+G+  P  RLVS+ L+    ITPD   + M+MQWGQFLDHDLD T V  S +RFSDG  C+  C ND PCF ++ PP DPRV+    C+ F RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   EA  +RDL    G LR G V  S K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W REHNR++ EL  LN HW+GD +Y+E+RKIVGA +QHITY  WLP +LG  G+K LG+Y GY+  V++ I + FATAA RFGHTLINP+LYRLDENFE IP+G++PLHKAFF+P R++ +GGIDP+LRGLF +  K     Q++N EL E+LF+MAH VALDL A+NIQRGRDHG+  Y+ +R +C +  A TF+D   EI S  IREK++++YG   N+DLF   ++E  V G  +GPTL CLL  QF+RLRDGDR WYE+   F PAQL+Q+KQ +LARILCDNSDNI+RVQ++VF +A+    +  C +IPR++L  W++C +  R
Sbjct:  240 ATAFIIVQALPQFTVTPQSRVVIEGQTVDFQCAAKGHPQPVIAWTKGGSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDMTVEVGTNVQLPCSSQGEPEPAITW---NKDGVQVTESGKFHISPEGFLTINDVGTADAGRYECVARNTIGYASVSMVLSV--------------NVPDVSRNGDPYVATSIVEAIATVDRAINSTRTHLFD-SRPRSPNDLLALFRYPRDPYTVGQARAGEIFERTLQLIQEHVQHGLMVDLNGTSYH-----YNDLVSPQYLSLIANLSGCTAHRRVNNCSD-MCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKAVYENGFNTPRGINSQRQYNGHVLPMPRLVSTTLIGTEVITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQHCSSVCSNDPPCFSVMIPPNDPRVRSGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQLTSYIDASNVYGSTDHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIAAELLKLNPHWDGDTVYHETRKIVGAEIQHITYRHWLPKILGEVGMKMLGEYRGYDPSVNAGIFNAFATAAFRFGHTLINPLLYRLDENFEPIPQGHVPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRIPSQLLNTELTERLFSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAYTFEDLKNEIKSPVIREKLQRLYGSTLNIDLFPALMVEDLVPGSRLGPTLMCLLSTQFRRLRDGDRLWYENPGVFSPAQLTQLKQTSLARILCDNSDNITRVQQDVFRVAEFPHGYSSCEDIPRVDLRVWQDCCEDCR 1137          

HSP 2 Score: 90.1225 bits (222), Expect = 1.533e-17
Identity = 70/259 (27.03%), Postives = 115/259 (44.40%), Query Frame = 1
Query:  619 VKRLELYGNMLYCGCELRYFAGNLR---RIGLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSI-SASAKLK-IAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            +KRL L  N L+C CE+ + A  L+   + G     + C+ P  ++ + +  +   EL C          P+    PQDA V  G+ + F C+ E   + ++ W    N      D+  N L   +  L I+   E  EG+Y C A N  G   +    L+ +    +P  V  P +     G  V   C A G+P+P+IT  W + ++  L  + +  I     L I+N+ +S+  G Y C+AS+   S   +A I +
Sbjct:    1 MKRLRLDSNALHCDCEILWLADLLKTYAQSGNAQAAATCEYPRRIQGRSVATITPEELNCER--------PRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWLRNNNELSMKTDSRLNLL--DDGTLMIQNTQEADEGVYQCMAKNVAGEAKTQEVTLRYLGSPARPTFVIQPQNTEVLVGESVTLECSATGHPLPQIT--WTRGDRTPLPIDPRVNITPSGGLYIQNVAQSD-SGEYTCFASNSVDSIHATAFIIV 246          
BLAST of Peroxidasin vs. Ensembl Mouse
Match: Epx (eosinophil peroxidase [Source:MGI Symbol;Acc:MGI:107569])

HSP 1 Score: 518.079 bits (1333), Expect = 3.471e-168
Identity = 291/737 (39.48%), Postives = 420/737 (56.99%), Query Frame = 1
Query: 1330 AKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRS--DIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLR--AHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRV--QRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKR-LLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKR-LGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFE-TIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWK 3513
            A V A+ TLI     L  + E +   S + ++   L + I +A+  ++ A+  T + +    R  S S  D+ + F+QP  A   + +A+D     L    G+L E      L        + T +LT  QL ++SQ SGC    +   CS       KYR+I G+CNN  +P  G++     R +  EYE+  + P GWT GK  +G+  P  R VS++++R  + K+T D   + M MQWGQF+DHDLDF+P   +   FS G+ C +TC    PCFPI  P  DPR+  QR CI F RS   C   ++ +       R Q+N +TSF+D S VY S+   A  LR+ T   G L        N R LLPF+   +  C +    A +PCF AGD R++E   L  +HT+++REHNRL+ ELR LN HW+GDK+Y E+RKIVGAM+Q ITY  +LP+VLG   I+R LG Y GY   VD  +++VF T A RFGHT++ P ++RLD  +  + P  ++PL   FFA  R++ +GGIDPILRGL A  +K  + D ++  EL +KLF     + LDL ALN+QR RDHGL  YN+WR FCG+ +       S  + + ++  K  ++Y  P N+D++ GA+ E  + G  VGP L+CL  +QF+R RDGDRFW++    F   Q   +++++L+RI+CDN+  I+ V R++F        F+ CS IP+LNL  W+
Sbjct:    7 ALVGALATLI-----LTQHAEGTAPASPSPVEISVLRDCIAEAKLLVDTAYNHTQKSIMQRLRSGSASPMDLLAYFKQPVAATRRVVQAADYMHVAL----GLLEER-----LQPRGSRPFNATDVLTEPQLRLLSQASGCALQDQAERCS------NKYRTITGRCNNKKHPWLGASNQALARWLPAEYEDHRSLPFGWTPGKRRNGFLLPLVRDVSNQIVRFPSKKLTSDRGRALMFMQWGQFIDHDLDFSPESPARVAFSMGVDCEKTCAQLPPCFPIKIPRNDPRIKNQRDCIPFFRSAPACPQNRNKV-------RNQINALTSFVDASMVYGSEVTLALRLRNRTNFLGLLATNQRFQDNGRALLPFDNLHEDPCLLTNRSARIPCFLAGDTRSSETPKLTALHTLFVREHNRLAAELRRLNPHWSGDKLYNEARKIVGAMVQIITYRDFLPLVLGRARIRRTLGPYRGYCSNVDPRVANVF-TLAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSVFFASWRIIHEGGIDPILRGLMATPAKLNRQDSMLVDELRDKLFQQVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLRLYKTPDNIDIWVGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKWGVFTKRQRKALRRISLSRIVCDNT-GITTVSRDIFRANIYPQGFVSCSRIPKLNLSAWR 714          
BLAST of Peroxidasin vs. Ensembl Mouse
Match: Mpo (myeloperoxidase [Source:MGI Symbol;Acc:MGI:97137])

HSP 1 Score: 517.309 bits (1331), Expect = 6.543e-168
Identity = 283/710 (39.86%), Postives = 410/710 (57.75%), Query Frame = 1
Query: 1417 KLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLF--RQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLR--AHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRV--QRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKR-LLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKR-LGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFE-TIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKS-KLEFIDCSNIPRLNLIPWKE 3516
            +++N  +   +++A+  ++ A+K+  E ++   +  S S  + LF  +QP        +A+D     LD L         K  L   +    + T +LTP QL ++S  SGC      + C      + KYR+I G CNN  +P  G++   F R +  EYE+G++ P GWT G   +G+  P AR VS+ ++R    ++T D   + M MQWGQFLDHD+  TP  A+   F  GL C  +C+   PCFP+  PP DPR+  Q+ CI F RS   C     +I       R Q+N +TSF+D S VY S+   A +LR+LT   G L +      N R L+PF+      C +    A +PCF AGD R++E   L  MHT+++REHNRL+ +L+ LN  WNG+K+Y E+RKIVGAM+Q ITY  +LP+VLG   +K+ L QY  YND VD  I++VF T A R+GHTLI P ++RL+  +  T P   +PL K FFA  RV+ +GGIDPILRGL A  +K  + +Q++  E+ E+LF     + LDL ALN+QR RDHGL  YN+WR FCG+ +  T  +    + + E+  K+   YG P N+D++ G V E     G VG  L+CL+  QF++LRDGDRFW+E+   F   Q   +  ++L RI+CDN+  I+ V +N  FM+ +   +F+ C+ +P+LNL  WKE
Sbjct:   30 EVENSVVLSCMEEAKQLVDRAYKERRESIKRSLQSGSASPTELLFYFKQPVAGTRTAVRAADYLHVALDLL---------KRKLQPLWPRPFNVTDVLTPAQLNLLSVSSGCAYQDVRVTCPP----NDKYRTITGHCNNRRSPTLGASNRAFVRWLPAEYEDGVSMPFGWTPGVNRNGFKVPLARQVSNAIVRFPNDQLTKDQERALMFMQWGQFLDHDITLTPEPATRFSFFTGLNCETSCLQQPPCFPLKIPPNDPRIKNQKDCIPFFRSCPACTRNNITI-------RNQINALTSFVDASGVYGSEDPLARKLRNLTNQLGLLAINTRFQDNGRALMPFDSLHDDPCLLTNRSARIPCFLAGDMRSSEMPELTSMHTLFVREHNRLATQLKRLNPRWNGEKLYQEARKIVGAMVQIITYRDYLPLVLGPAAMKKYLPQYRSYNDSVDPRIANVF-TNAFRYGHTLIQPFMFRLNNQYRPTGPNPRVPLSKVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIVVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQYGTPNNIDIWMGGVSEPLEPNGRVGQLLACLIGTQFRKLRDGDRFWWENPGVFSKQQRQALASISLPRIICDNT-GITTVSKNNIFMSNTYPRDFVSCNTLPKLNLTSWKE 717          
BLAST of Peroxidasin vs. Ensembl Mouse
Match: Mpo (myeloperoxidase [Source:MGI Symbol;Acc:MGI:97137])

HSP 1 Score: 517.309 bits (1331), Expect = 6.543e-168
Identity = 283/710 (39.86%), Postives = 410/710 (57.75%), Query Frame = 1
Query: 1417 KLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLF--RQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLR--AHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRV--QRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKR-LLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKR-LGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFE-TIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKS-KLEFIDCSNIPRLNLIPWKE 3516
            +++N  +   +++A+  ++ A+K+  E ++   +  S S  + LF  +QP        +A+D     LD L         K  L   +    + T +LTP QL ++S  SGC      + C      + KYR+I G CNN  +P  G++   F R +  EYE+G++ P GWT G   +G+  P AR VS+ ++R    ++T D   + M MQWGQFLDHD+  TP  A+   F  GL C  +C+   PCFP+  PP DPR+  Q+ CI F RS   C     +I       R Q+N +TSF+D S VY S+   A +LR+LT   G L +      N R L+PF+      C +    A +PCF AGD R++E   L  MHT+++REHNRL+ +L+ LN  WNG+K+Y E+RKIVGAM+Q ITY  +LP+VLG   +K+ L QY  YND VD  I++VF T A R+GHTLI P ++RL+  +  T P   +PL K FFA  RV+ +GGIDPILRGL A  +K  + +Q++  E+ E+LF     + LDL ALN+QR RDHGL  YN+WR FCG+ +  T  +    + + E+  K+   YG P N+D++ G V E     G VG  L+CL+  QF++LRDGDRFW+E+   F   Q   +  ++L RI+CDN+  I+ V +N  FM+ +   +F+ C+ +P+LNL  WKE
Sbjct:   30 EVENSVVLSCMEEAKQLVDRAYKERRESIKRSLQSGSASPTELLFYFKQPVAGTRTAVRAADYLHVALDLL---------KRKLQPLWPRPFNVTDVLTPAQLNLLSVSSGCAYQDVRVTCPP----NDKYRTITGHCNNRRSPTLGASNRAFVRWLPAEYEDGVSMPFGWTPGVNRNGFKVPLARQVSNAIVRFPNDQLTKDQERALMFMQWGQFLDHDITLTPEPATRFSFFTGLNCETSCLQQPPCFPLKIPPNDPRIKNQKDCIPFFRSCPACTRNNITI-------RNQINALTSFVDASGVYGSEDPLARKLRNLTNQLGLLAINTRFQDNGRALMPFDSLHDDPCLLTNRSARIPCFLAGDMRSSEMPELTSMHTLFVREHNRLATQLKRLNPRWNGEKLYQEARKIVGAMVQIITYRDYLPLVLGPAAMKKYLPQYRSYNDSVDPRIANVF-TNAFRYGHTLIQPFMFRLNNQYRPTGPNPRVPLSKVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIVVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPSTVGELGTVLKNLELARKLMAQYGTPNNIDIWMGGVSEPLEPNGRVGQLLACLIGTQFRKLRDGDRFWWENPGVFSKQQRQALASISLPRIICDNT-GITTVSKNNIFMSNTYPRDFVSCNTLPKLNLTSWKE 717          
BLAST of Peroxidasin vs. UniProt/SwissProt
Match: sp|Q3UQ28|PXDN_MOUSE (Peroxidasin homolog OS=Mus musculus OX=10090 GN=Pxdn PE=1 SV=2)

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 400/922 (43.38%), Postives = 561/922 (60.85%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILREN-KVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP--CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            + +F   +  P+F   PQ   V  G  + F C  +   +  + W    +  + +   L   +  L I  V    +G Y C A N  GS    A L + P   P     P+ ++ E G+ V+  C + G P P ITW     + V++   GK+ +     +  N   +   GRY C A +  G A VS V+++               +P  ++  +  +   I +A + ++ A   T   L D +R RS +D+ +LFR P     +  A+A +++E+ L  +   ++    V LN T+ +     +  L++P+ L++I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+ F RL+K  YENG NTP G  + + Y+G+  P  RLVS+ L+    ITPD   + M+MQWGQFLDHDLD T V  S +RFSDG  C+  C ND PCF ++ PP DPRV+    C+ F RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   EA  +RDL    G LR G V  S K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W REHNR++ EL  LN HW+GD +Y+E+RKIVGA +QHITY  WLP +LG  G+K LG+Y GY+  V++ I + FATAA RFGHTLINP+LYRLDENFE IP+G++PLHKAFF+P R++ +GGIDP+LRGLF +  K     Q++N EL E+LF+MAH VALDL A+NIQRGRDHG+  Y+ +R +C +  A TF+D   EI S  IREK++++YG   N+DLF   ++E  V G  +GPTL CLL  QF+RLRDGDR WYE+   F PAQL+Q+KQ +LARILCDNSDNI+RVQ++VF +A+    +  C +IPR++L  W++C +  R
Sbjct:  420 ATAFIIVQALPQFTVTPQSRVVIEGQTVDFQCAAKGHPQPVIAWTKGGSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDMTVEVGTNVQLPCSSQGEPEPAITW---NKDGVQVTESGKFHISPEGFLTINDVGTADAGRYECVARNTIGYASVSMVLSV--------------NVPDVSRNGDPYVATSIVEAIATVDRAINSTRTHLFD-SRPRSPNDLLALFRYPRDPYTVGQARAGEIFERTLQLIQEHVQHGLMVDLNGTSYH-----YNDLVSPQYLSLIANLSGCTAHRRVNNCSD-MCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKAVYENGFNTPRGINSQRQYNGHVLPMPRLVSTTLIGTEVITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQHCSSVCSNDPPCFSVMIPPNDPRVRSGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQLTSYIDASNVYGSTDHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIAAELLKLNPHWDGDTVYHETRKIVGAEIQHITYRHWLPKILGEVGMKMLGEYRGYDPSVNAGIFNAFATAAFRFGHTLINPLLYRLDENFEPIPQGHVPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRIPSQLLNTELTERLFSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAYTFEDLKNEIKSPVIREKLQRLYGSTLNIDLFPALMVEDLVPGSRLGPTLMCLLSTQFRRLRDGDRLWYENPGVFSPAQLTQLKQTSLARILCDNSDNITRVQQDVFRVAEFPHGYSSCEDIPRVDLRVWQDCCEDCR 1317          

HSP 2 Score: 118.242 bits (295), Expect = 2.802e-25
Identity = 108/415 (26.02%), Postives = 175/415 (42.17%), Query Frame = 1
Query:  223 VSTTGQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSL---------PG---------------NSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLR---RIGLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKG-SISASAKLK-IAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
             S  G  C  +C C   TV C     + +P +   + + L L         PG               N I KI    F++ ++L ++ L  N+I  ++  A  G   LE LYL  N IE L  + F       +L    N     +P +  +L ++KRL L  N L+C CE+ + A  L+   + G     + C+ P  ++ + +  +   EL C          P+    PQDA V  G+ + F C+ E   + ++ W    N      D+  N L   +  L I+   E  EG+Y C A N  G + +    L+ +    +P  V  P +     G  V   C A G+P+P+IT  W + ++  L  + +  I     L I+N+ +S+  G Y C+AS+   S   +A I +
Sbjct:   26 ASKQGAGCPSRCLCFRTTVRCMHLLLEAVPAVA-PQTSILDLRFNRIREIQPGAFRRLRSLNTLLLNNNQIKKIPNGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPESFQHLPKLERLFLHNNRITHLVPGTFSQLESMKRLRLDSNALHCDCEILWLADLLKTYAQSGNAQAAATCEYPRRIQGRSVATITPEELNCER--------PRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWLRNNNELSMKTDSRLNLL--DDGTLMIQNTQEADEGVYQCMAKNVAGEAKTQEVTLRYLGSPARPTFVIQPQNTEVLVGESVTLECSATGHPLPQIT--WTRGDRTPLPIDPRVNITPSGGLYIQNVAQSD-SGEYTCFASNSVDSIHATAFIIV 426          
BLAST of Peroxidasin vs. UniProt/SwissProt
Match: sp|Q92626|PXDN_HUMAN (Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2)

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 400/922 (43.38%), Postives = 557/922 (60.41%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILREN-KVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP--CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            + +F   +  P+F   PQD  V  G  + F C+ +      + W    +  + +   L   +  L I  V    +G Y C A N  GS    A L + P   P     P+  + E G+ V+  C + G P P ITW     + V++   GK+ +     +  N       GRY C A +  GSA VS V+++               +P  ++  +  +   I +A + ++ A   T   L D +R RS +D+ +LFR P     +E A+A +++E+ L  +   ++    V LN T+ +     +  L++P+ L +I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+ F RL+K  YENG NTP G    +LY+G++ P  RLVS+ L+    +TPD   + M+MQWGQFLDHDLD T V  S +RFSDG  C+  C ND PCF ++ PP D R +    C+ F RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   EA  +RDL    G LR G V  S K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W REHNR++ EL  LN HW+GD IYYE+RKIVGA +QHITY  WLP +LG  G++ LG+Y GY+  +++ I + FATAA RFGHTL+NP+LYRLDENF+ I + +LPLHKAFF+P R++ +GGIDP+LRGLF +  K     Q++N EL E+LF+MAH VALDL A+NIQRGRDHG+  Y+ +R +C +  A TF+D   EI + EIREK++++YG   N+DLF   V+E  V G  +GPTL CLL  QFKRLRDGDR WYE+   F PAQL+QIKQ +LARILCDN+DNI+RVQ +VF +A+    +  C  IPR++L  W++C +  R
Sbjct:  423 ATAFIIVQALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTKGGSQLSVDRRHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDTTVEVGANVQLPCSSQGEPEPAITW---NKDGVQVTESGKFHISPEGFLTINDVGPADAGRYECVARNTIGSASVSMVLSV--------------NVPDVSRNGDPFVATSIVEAIATVDRAINSTRTHLFD-SRPRSPNDLLALFRYPRDPYTVEQARAGEIFERTLQLIQEHVQHGLMVDLNGTSYH-----YNDLVSPQYLNLIANLSGCTAHRRVNNCSD-MCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNTPRGINPHRLYNGHALPMPRLVSTTLIGTETVTPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQHCSNVCSNDPPCFSVMIPPNDSRARSGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQLTSYIDASNVYGSTEHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLKLNPHWDGDTIYYETRKIVGAEIQHITYQHWLPKILGEVGMRTLGEYHGYDPGINAGIFNAFATAAFRFGHTLVNPLLYRLDENFQPIAQDHLPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRVPSQLLNTELTERLFSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAHTFEDLKNEIKNPEIREKLKRLYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQFKRLRDGDRLWYENPGVFSPAQLTQIKQTSLARILCDNADNITRVQSDVFRVAEFPHGYGSCDEIPRVDLRVWQDCCEDCR 1320          

HSP 2 Score: 107.842 bits (268), Expect = 3.887e-22
Identity = 101/409 (24.69%), Postives = 166/409 (40.59%), Query Frame = 1
Query:  235 GQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSL---------PG---------------NSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLRRI---GLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQW----LFIKEVHEFHEGIYICTASNNKGSI-SASAKLK-IAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            G  C  +C C   TV C     + +P +   + + L L         PG               N I +I +  F++ ++L ++ L  N+I  ++  A  G   LE LYL  N IE L    F       +L    N     +P +   L ++KRL L  N L+C CE+ + A  L+     G     + C+ P  ++ + +  +   EL C          P+    PQDA V  G+ + F C+ E   + ++ W    N+ +  +    N      L I+   E  +GIY C A N  G + +    L+      +P  V  P +     G  V   C A G+P P I+  W + ++  L  + +  I     L I+N+ + +  G Y C A++   S   +A I +
Sbjct:   33 GAGCPSRCLCFRTTVRCMHLLLEAVPAVA-PQTSILDLRFNRIREIQPGAFRRLRNLNTLLLNNNQIKRIPSGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKLERLFLHNNRITHLVPGTFNHLESMKRLRLDSNTLHCDCEILWLADLLKTYAESGNAQAAAICEYPRRIQGRSVATITPEELNCER--------PRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWLRNNNELSMKTDSRLNLLDDGTLMIQNTQETDQGIYQCMAKNVAGEVKTQEVTLRYFGSPARPTFVIQPQNTEVLVGESVTLECSATGHPPPRIS--WTRGDRTPLPVDPRVNITPSGGLYIQNVVQGD-SGEYACSATNNIDSVHATAFIIV 429          
BLAST of Peroxidasin vs. UniProt/SwissProt
Match: sp|A4IGL7|PXDN_XENTR (Peroxidasin OS=Xenopus tropicalis OX=8364 GN=pxdn PE=2 SV=1)

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 391/922 (42.41%), Postives = 567/922 (61.50%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLY--WRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILREN-KVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR--PCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            S ++   +  P+F   PQD  V  G  + F C+ +   +  + W    N  + +  +    +  L I  V    +G Y C A N  GS S +A+L +     P     P  ++ E G+ V+  C + G P+P ITW     + +++   GK+ +  +  +         +GRY C A +  G + VS V++++              +P  ++  +  +   I +A + ++ A   T   L D +R RS  D+ +LFR P     +E A+A++++E+ L  +   ++    V LN T+ +     +  L++P+ L +I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+ F RL+K  YENG N P G  +G++Y+G+  P  RLVS+ L+  H ITPD   + M+MQWGQFLDHDLD T V  S +RFSDG  C+  C ND+PCFPI+ PP DPRV+    C+   RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   E+ E+RD     G L+ G V  S K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITY+ WLP + G  G+K LG+Y  Y+  V++ I + FATAA RFGHTLINPILYRLDE FE IP+G++PLH+AFF+P R++ +GGIDP+LRGL  + +K   + Q++N EL EKLF+MAH VALDL ALN+QRGRDHG+  Y+ +R FC +   +TFDD   EI + ++REK++++YG P N+DLF   ++E  + G  +GPTL CLL  QF+ +RDGDRFWYE+   F  AQL+QIKQ +LAR+LCDN DNI++VQ ++F +A+    ++ C NI +++L  W++C +  R
Sbjct:  413 STAYIIVQAVPQFTVVPQDRNVFEGHTVDFHCEAQGNPKPVIAWTKGGNQLSVDRRHQVLSSGTLRILRVALHDQGQYECQAVNIVGSKSTAAQLIVQTRVTPVFATVPNDMTVEVGTDVQIPCSSQGDPLPIITW---NKDGIQVTESGKFHISPHGYLAIRDAGLADQGRYECVARNPIGYSSVSMVLSVL--------------VPEVSRTGDPFVATSIIEAIATVDRAINSTRTHLFD-SRPRSPGDLLALFRYPRDPYTVEQARAAEIFERTLQLIQDHVQSGLMVDLNGTSYH-----YNDLVSPQYLNMIANLSGCATHRRINNCSN-MCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNLPRG-ISGRIYNGFPLPLPRLVSTTLIGTHTITPDEQFTHMLMQWGQFLDHDLDSTVVALSQARFSDGQDCSVVCTNDAPCFPIMVPPNDPRVRNNARCMSMVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSDHESNEIRDSASHRGLLKQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLRLNPHWDGDTIYHETRKIVGAQMQHITYSHWLPKIFGDVGMKMLGEYKSYDPNVNAGILNEFATAAFRFGHTLINPILYRLDEKFEPIPQGHVPLHRAFFSPFRIVNEGGIDPLLRGLIGVAAKMRVTSQLLNTELTEKLFSMAHAVALDLAALNVQRGRDHGIPPYHDFRVFCNLSTVQTFDDLRNEIKNPDVREKLKRLYGSPLNIDLFPALMVEDLIPGSRLGPTLMCLLTTQFRNIRDGDRFWYENPGVFTAAQLTQIKQTSLARVLCDNGDNITKVQHDLFRVAEFPHGYVSCKNIAKMDLRVWQDCCEDCR 1309          

HSP 2 Score: 106.301 bits (264), Expect = 1.123e-21
Identity = 99/427 (23.19%), Postives = 173/427 (40.52%), Query Frame = 1
Query:  190 IIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGN------------------------SISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLR---RIGLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSIS---ASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            +     L  +++      C  +C C   TV C     + +P +     T L L  N                         I +I +  FK+ ++L ++ L  N+I  ++  A  G   LE LYL  N IE L  + F+      +L    N     +P +  +L ++KRL L  N L+C CE+ + A  L+     G     + C+ P  ++ + +  +  +EL C          P+    PQD  V  G+ + F C+ E   + ++ W    N      D+  N L   +  L I+   E  +GIY C A N  G +     + +    P    ++++ P +     G  V   C A G P P +T  W + ++  L ++ +  I     L I+N+ + +  G Y C+A++   +   +A I +
Sbjct:    8 LYLTAGLLVVALPQLSHSCPSRCLCFRTTVRCMHLMLESVPAVP-PHTTILDLRFNRIKDIQTGAFKHLKNLNTLLLNNNQIKRIPSEAFKDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLHFNQIETLEPESFNYLPKLERLFLHNNRITHLVPGTFSQLESMKRLRLDSNALHCDCEILWLADLLKIYSESGNAQAAATCEYPRRLQGRSVSTITPSELNCER--------PRITSEPQDVDVTFGNTVYFTCRAEGNPKPEIIWLRNNNELSMKDDSRLNLL--NDGTLMIQNTKETDQGIYQCMAKNVAGEVKTHEVTLRYYGTPATPTFVIQ-PQNTEVLVGESVTLECSATGQPHPRVT--WTRGDRTPLPSDPRINITPSGGLYIQNVNQDDA-GEYTCFATNSVETIHSTAYIIV 419          
BLAST of Peroxidasin vs. UniProt/SwissProt
Match: sp|Q9VZZ4|PXDN_DROME (Peroxidasin OS=Drosophila melanogaster OX=7227 GN=Pxn PE=1 SV=1)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 404/985 (41.02%), Postives = 591/985 (60.00%), Query Frame = 1
Query:  796 FEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNS----LYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKP-YIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQV---RLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKL---RDPNRQRSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQ-RPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNI-RGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKE---CYDPSRLTPEDQVPGLSPSRSRRSTNEFQDQNCKSKTNQC-SSNISNL----EERIKSLED 3684
             E  EL P+ +  PQ   + +G      C  +      ++W         N+    L   N  L +    + H G+Y CTA N  G  S  A +K+  +Q P  +   P+++ A  G+ +E  C+A   P   +   W    ++    ++   KY I    +L ++N+T  +  GRY C   +  G A  SA++T IR+  +L   +   ++                +A  +I++A   T + L   R      +  ++  +FR P+  A +LA+A+++YE+ L ++   ++E     NLT   EE  +F  LL+ E L ++++LSGC    E  +C+  +CFH +YRSIDG CNNL +P  G++L+ F RL  P YENG + P+GWT G LY G++KPSARLVS+ L+   +ITPD  ++ MVMQWGQFLDHDLD   + + +S   DG+ C ++C    PC+PI  PP DPRV+ R CI   RS A CGSG +S+    + +REQ+NQ+TS++D S VY      A ELR+LT  EG LRVG   P  K +LPF   +  +DC+ +  +  + CF +GD R NE +GLL MHTIWMREHNR++ +L+ +N+HW+GD +Y E+RKIVGA MQHIT+  WLP+++G  G++ +G+Y GYN  ++ +I++ FATAA+RFGHT+INPIL+RL+E F+ IP+G+L LHKAFFAP R+  +GG+DP++RG  A+ +K    DQ +N EL EKLF  AH VALDL A+NIQRGRDHG+  YN +R+ C +  A+ F+D +GEI S+EIR+KM+++YGHP NVD++ G +LE +V GG VGP   CLL++QF+RLRDGDR +YE+   F P QL+QIKQ    R+LCD  DN  +V  NVF +AK +  +  C +I  +NL  W+E   C  P  +  +  +P     RS R   +   +N +  T +   S + +L    EER+  LE+
Sbjct:  452 IELKEL-PEILTAPQSQTIKLGKAFVLECDADGNPLPTIDWQLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSVEATIKVERSQSPPQLAIEPSNLVAITGTTIELPCQAD-QPEDGLQISWRHDGRLIDPNVQLAEKYQISGAGSLFVKNVTIPD-GGRYECQLKNQFGRASASALVT-IRNNVDLAPGDRYVRI-------------AFAEAAKEIDLAINNTLDMLFSNRSDKAPPNYGELLRVFRFPTGEARQLARAAEIYERTLVNIRKHVQEGD---NLTMKSEE-YEFRDLLSREHLHLVAELSGCMEHREMPNCTD-MCFHSRYRSIDGTCNNLQHPTWGASLTAFRRLAPPIYENGFSMPVGWTKGMLYSGHAKPSARLVSTSLVATKEITPDARITHMVMQWGQFLDHDLDHA-IPSVSSESWDGIDCKKSCEMAPPCYPIEVPPNDPRVRNRRCIDVVRSSAICGSGMTSLFFDSVQHREQINQLTSYIDASQVYGYSTAFAQELRNLTSQEGLLRVGVHFPRQKDMLPFAAPQDGMDCRRNLDENTMSCFVSGDIRVNEQVGLLAMHTIWMREHNRIASKLKQINSHWDGDTLYQEARKIVGAQMQHITFKQWLPLIIGESGMEMMGEYQGYNPQLNPSIANEFATAALRFGHTIINPILHRLNETFQPIPQGHLLLHKAFFAPWRLAYEGGVDPLMRGFLAVPAKLKTPDQNLNTELTEKLFQTAHAVALDLAAINIQRGRDHGMPGYNVYRKLCNLTVAQDFEDLAGEISSAEIRQKMKELYGHPDNVDVWLGGILEDQVEGGKVGPLFQCLLVEQFRRLRDGDRLYYENPGVFSPEQLTQIKQANFGRVLCDVGDNFDQVTENVFILAKHQGGYKKCEDIIGINLYLWQECGRCNSPPAIF-DSYIPQTYTKRSNRQKRDLGKENDEVATAESYDSPLESLYDVNEERVSGLEE 1412          

HSP 2 Score: 110.923 bits (276), Expect = 4.987e-23
Identity = 109/443 (24.60%), Postives = 175/443 (39.50%), Query Frame = 1
Query:  244 CLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXX-----------------------XXXXANNRLKTLPI-SLEKLINVKRLELYGNMLYCGCELRYFAGNLRRIGLDFQKS------QCQSPMNVKNQFLEEVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTF----NSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPAS-------------------------------------ISAEKGS-RVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            C   C C E+TV C R     +P++     T L L  N I ++ AN F     L  + L+ N+++ +++ AL G   L  +YL NN +  LP  IF                                L + NN+L  LP+    +L N+KRL L GN + C C +       RR  LD Q+        C +P  ++NQ      F+ L  + F+ ++  P+F+  PQDA VA G+++  +C+V  +   ++ W     +        +    +  L I+       GIY C A N  G++  S  +++  N   + ++ P                                       I A  GS  V   C A G+P P+I W +V   Q+   T    +    +L++    +    G Y C A +  GS + +A I L
Sbjct:   26 CPAGCTCLERTVRCIRAKLSAVPKLPQDTQT-LDLRFNHIEELPANAFSGLAQLTTLFLNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIFQRMPRLEAIFLENNDIWQLPAGLFDNLPRLNRLIMYNNKLTQLPVDGFNRLNNLKRLRLDGNAIDCNCGVYSL---WRRWHLDVQRQLVSISLTCAAPQMLQNQ-----GFSSLGEHHFKCAK--PQFLVAPQDAQVAAGEQVELSCEVTGLPRPQITWMHNTQELGLEEQAQAEILPSGSLLIRSADTSDMGIYQCIARNEMGALR-SQPVRLVVNGGNHPLDSPIDARSNQVWADAGTPMHGATPLPSPLPSPPHFTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQW-FVNGRQLLQSTPSLQLQANGSLILLQPNQLSA-GTYRCEARNSLGSVQATARIEL 454          

HSP 3 Score: 64.6994 bits (156), Expect = 5.976e-9
Identity = 52/201 (25.87%), Postives = 86/201 (42.79%), Query Frame = 1
Query:  823 FIERPQDAYVAV--GDKIRFACQVENINETKVEWHF---QFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRL--ETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKL 1404
            F  +P D  VA+     +   C      +  ++W     Q   +T +     N  L + + ++   G Y C A N+ GS+ A+A++++   + P I+  P S + + G      C A G P+P I W   + N V L   T    +  +N  ++      E  G Y C A + +G   V A I + RS++   L  E S L
Sbjct:  367 FTHQPHDQIVALHGSGHVLLDCAASGWPQPDIQWFVNGRQLLQSTPSLQLQANGSLILLQPNQLSAGTYRCEARNSLGSVQATARIEL--KELPEILTAPQSQTIKLGKAFVLECDADGNPLPTIDW---QLNGVPLPGNTPDLQLENENTELVVGAARQEHAGVYRCTAHNENGETSVEATIKVERSQSPPQLAIEPSNL 562          
BLAST of Peroxidasin vs. UniProt/SwissProt
Match: sp|A8WQH2|PXDN1_CAEBR (Peroxidasin homolog OS=Caenorhabditis briggsae OX=6238 GN=pxn-1 PE=3 SV=1)

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 378/922 (41.00%), Postives = 555/922 (60.20%), Query Frame = 1
Query:  814 APKFIERPQDAYVAVGDKIRFACQVENINETKVEWH---FQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNN--LVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFR-QPSLAALELAKASDVYEKVLDDLTGILRENKVK---LNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRV-----QRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAH-VPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGI--KRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVF-FMAKSKLEFIDCSNIPRLNLIPWKECYD 3525
            AP+F  +P+D     G +++  C+V    +  + W+    +F  +    L   N  L I    E   G Y C A N+ G +S +  L +  +  P I EGP S+S   G  V F C+A G P P+ TW +  S    ++  G+++V  +   L I NI E + EG Y C A +  G+    A +T+I  +         ++  S  ++  E L  I + A+  +  A +KT ++L + ++  + +D++ LFR      A+EL+KA ++YE+ +     ++RE+  K   LN+   +   + + ++L    +  +  LSGC     +  C+   CFH KYRS DG+CNN   P  G +L P  RL+KP YENG NTP+GW  GKLY+GY  P+ R VS +L+    ITP   LS+MVMQWGQF+DHDL  T    S   ++ G  CN TC N  PCF I   P DPRV     + PCI F RS A CGSG++S++  ++ YREQ+N +TSFLD SNVY S+ ++A ELRD   + G+LR    + + K  LPF     +DC+ + ++ + + CF AGD R NE L L   HTI++REHNR++ +L+ +N +W+G+ IY+E+RKI+GAMMQHIT+  WLP+V G +    K +G+Y GY+  +DS++++ FATAA RFGHT+INP L+RL  +F +I +G++ LHKAFF P+ V+ +GGIDP+LRGLFA   K     Q++N ELIEKLF   HEV+LDL  +NIQR RDHGL SY  +R+FC +     ++D  G I    I +K+R +YG P N+DL+ G ++E+K+  GL GPT +C++ +QF+++RDGDRFWYE    F P Q+ +IK+VTLAR+LCDN D I R+Q++VF +  K K  +  C +   ++L  W +C D
Sbjct:  313 APQFTYKPRDNSYREGSEVKVNCEVMGTPKPSITWYHNGVRFASSRKKQLGLSNNVLRIYPFLEEDSGRYTCEAVNSLGKVSHTFSLDLISSIPPNIYEGPQSVSQNIGGEVVFVCKAKGNPTPDYTWSFDGSTIGHIK--GRFMVSDDGTELXISNI-EKKDEGYYSCMAGNPVGAMSADAKLTVIGGE---------TRKSSTPQIDEELLRAIAQKARQNVESAVEKTRKQL-NQDKITNTNDLKRLFRFSTPKQAVELSKAREIYEESVR----LVREHVEKGLILNVDELHPNNVSYESVLHVTHVQALMGLSGCHTGQFKNPCTDT-CFHNKYRSFDGQCNNKNKPMNGVSLMPLRRLLKPVYENGFNTPVGWEKGKLYNGYPMPNVREVSRQLVATETITPHRKLSSMVMQWGQFVDHDLTHTVTALSRHSYATGAFCNRTCDNLDPCFNIPLSPSDPRVISESAKYPCIEFERSAAVCGSGETSLVFNRVTYREQMNALTSFLDASNVYGSNEVQAQELRDTYNNNGQLRYDITSAAGKEYLPFEKDSNMDCRRNFSEENPIRCFLAGDLRANEQLALAATHTIFVREHNRIAKKLKKMNGNWDGEVIYHETRKIIGAMMQHITFKHWLPVVFGGQEQMDKFVGKYQGYDPAIDSSVTNAFATAAFRFGHTIINPTLFRLGNDFMSIKQGHIALHKAFFTPELVLTEGGIDPLLRGLFASPLKHPMPTQLLNMELIEKLFMKGHEVSLDLAVMNIQRSRDHGLPSYTEYRQFCNLPVPARWEDMKGYIKDDMIIQKLRGLYGVPQNIDLWVGGIVEEKLENGLFGPTFACIIGEQFRKMRDGDRFWYEKDGVFTPEQMKEIKKVTLARLLCDNGDEIDRIQKDVFMYPGKEKENYGRCEDTEMMDLKAWSKCCD 1216          

HSP 2 Score: 90.1225 bits (222), Expect = 8.876e-17
Identity = 99/413 (23.97%), Postives = 168/413 (40.68%), Query Frame = 1
Query:  244 CLPQCRCTEK--TVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENAL-----------------YGPIF------LETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISL-EKLINVKRLELYGNMLYCGCELRYFAGNLRRIGLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQK-----------PYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRL-ETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRS 1365
            C  +C C +K  TV C   G   IP+  +  +  L L  N I  +I +  + F  L  + L+ NKI +VEEN L                 Y P        L +L LK N I+++ E+    +   L  + L++NR+++L   L E L ++    L+ N   C C +      LR++  + +K+ C +P+ +++Q ++EV+ + L C+   E S                 GD+ +  C     +   V W ++  +   +SL          + +E H+ +       N   ++ +   +  P+ +           P     P   S  +GS V+ +C   G P P ITW     N VR   +  K +   NN++       E  GRY C A +  G    +  + LI S
Sbjct:   21 CPAKCTCDKKGFTVDCSNAGLTRIPKGISSNVRSLVLRNNRIHTLIKSDLEGFPLLESLVLTHNKIKVVEENILDHLPELKRLSLSHNLLVYIPPLASESRPLASLNLKRNHIQFIDERWLLQYFPELVQIDLSHNRIQSLRTKLFENLPSLTHAHLHANPWNCDCRVTKVKALLRKVEWE-RKAYCTNPVELRHQAIDEVEESLLKCAKPEEES---------------WTGDEFKLVCTKNASSSRPVVWLYENAEVDSSSL----------DGYEIHDSVITVPRKTNVNQMTCTYDYEHVPHHRRLRQSHHSNGAPQFTYKPRDNSYREGSEVKVNCEVMGTPKPSITWY---HNGVRFASSRKKQLGLSNNVLRIYPFLEEDSGRYTCEAVNSLGKVSHTFSLDLISS 404          
BLAST of Peroxidasin vs. TrEMBL
Match: A0A068Y4S0 (Peroxidasin OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000733600 PE=4 SV=1)

HSP 1 Score: 1054.66 bits (2726), Expect = 0.000e+0
Identity = 557/1280 (43.52%), Postives = 753/1280 (58.83%), Query Frame = 1
Query:  184 IVIIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEI-------GNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLRRIGLDFQKSQCQSPMNVKNQ---------------------------FLEEVKFNELCS-----------------------NSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASIS--AEKGSRVEFSCRAHGYPVPEITWLWVKSNQV-RLETEGKYIVRKN---------------------------------NLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSR------------NKLKNEQLYE-IIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGIL---RENKVKLNLTTAYEETLDFT--------TLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLL----------------------------RAHKITP---------------DPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLG--QYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWR-EFCGMKKA---ETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVT--LARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKEC 3519
            +  I+LG L     ST    C   C C  +++ CRR    +IP+I           L Y ++    +S++    F    D++ +DLS N+I ++E  A      L  L L+ N +  LP+ IF       +L   + N+L  +P SL++++ +K L L GN L+CGC +  FA  L        +  C +P  V  +                           F EE+   +L                         +S   S  AP+ IE P    VA G+++ F CQ   +   K+ W    N++    L+ + + L ++EVH +HEG Y C A N  G +S S  L++    KP I + P++ +   E G  +E +C A G P P + WL+  ++   RL T+G+Y+VR +                                  L I N+TE + EGRY CYA++ +GS +V++++TL R  +  + N    K  SR            +K  +E L + +I+ A+ +I+ A +KTA+ LRDP  +R+ SDI SLFRQPS AA+ELA+A++VYE  +D++T IL   R      +    Y   +DF           LT EQLAII+QLSGC +S     C +QLCFH +YRSIDG CNNL  P+ G+ALSPFYRL+ P YENG+N P+GW   KLY GY KPSARLVS RLL                            R+H  +                D + S M+MQWGQFLDHDLDFTPVDAS SRFSDGLGCNETC+ND PCFPILTPPGDPR+++ CIGF+RS ATCGSG +SI+LG+  +REQ+NQI+++LD SNVY S+  E ++LRD  YDEG LR G  TP+ K+LLPFNIRGQVDCQ DP +  VPCFKAGDHR+NENLGLL MHTIWMREHNR++DELR LN HW+GD++Y+E+RKIVGA+MQ ITY  WLP VLG  G++ +G   YPGY+  V+ TIS+ FATAA RFGHT++ PI +RL+EN+ETIPEG+L LHKAFFAPD+++ DGG+DPILRGL   G + +     +N EL E+LFAMAH++ALDL +LNIQRGRDHGL  Y S+  + CG+  +   ++F+D +  I    IRE+MR VYGHPGN+DLF G VLE  + G  +GPT +C++ DQFKRLR GDR WYES   F  AQL++I+     L+R++C+N DNI+ V  + F   K++ + + CS +P+LNL  WKEC
Sbjct:    8 VAFIWLGLLTLFCTSTCQDACPGNCVCFSQSIVCRRSTETVIPKIPAFLDGPQGGALQYFAITNTKLSRVPTEAFVGLLDIMSIDLSNNEIEVIEGGAFQDLPILAHLLLRQNQLTQLPDNIFDTLPSLEELDL-SFNQLTAIPSSLQRMVGLKSLSLRGNPLHCGCGIVDFAQLLPYWESSLDRVTCATPAQVAGKSIKELGRQYFQAFEGTRHLGYWPDEYAFPEEISRKQLIRTRTPWPLPHCPVKDLGGEVVDNVDSSNGSYEAPQIIEAPVPVMVAEGERVFFVCQATGVPRPKISWMLPTNNSQHVHLWDKRKILELREVHAYHEGTYTCIAKNRVGQVSHSVMLQLVDIVKPQITDAPSTKATVGEPGGDIELTCTARGRPRPTVDWLYTHTSSAKRLSTQGRYVVRSSAKLSTRTIQDLTYRDPLAQTDESLRLEGEEESVTLTIRNVTELDTEGRYTCYAANRAGSTRVTSLVTLKRWTDMASDNGGEDKDASRGKRVESDSAEISDKESDEDLVKRVIEKARRRIDAAIQKTADNLRDPKNRRTASDIASLFRQPSKAAVELARAAEVYEAAIDEVTQILQRQRNQSFGKDTEGPYRSDVDFDEQKRQAMGVQLTAEQLAIIAQLSGCAQSQRVEPCDRQLCFHMRYRSIDGSCNNLKYPKWGAALSPFYRLLPPVYENGVNQPVGWNPEKLYFGYPKPSARLVSYRLLADATKLQVHTQKLETFNQRIKMSLKFNNRSHDTSSLFDFPLYEKEELFDEDDSSSGMLMQWGQFLDHDLDFTPVDASTSRFSDGLGCNETCINDPPCFPILTPPGDPRIRQRCIGFARSSATCGSGSTSILLGRPQHREQLNQISAYLDASNVYGSEDFENSQLRDTLYDEGHLRGGMPTPAGKQLLPFNIRGQVDCQADPQQDFVPCFKAGDHRSNENLGLLSMHTIWMREHNRIADELRSLNPHWSGDRLYHEARKIVGALMQSITYRVWLPKVLGPRGMEMMGGETYPGYDSSVNPTISNEFATAAFRFGHTMVPPIYFRLNENWETIPEGHLLLHKAFFAPDKMLTDGGMDPILRGLLFHGIRDIIRRPSLNPELTERLFAMAHQLALDLASLNIQRGRDHGLQHYTSYAYKICGLGSSAAPDSFEDLADRIHDPAIREEMRAVYGHPGNIDLFVGGVLEDVLPGARMGPTFACIIADQFKRLRAGDRLWYESPGLFTTAQLAEIRDAGSYLSRVICENGDNITEVPLDAFIRPKNRKDLVSCSQVPKLNLALWKEC 1286          
BLAST of Peroxidasin vs. TrEMBL
Match: A0A0R3X4X0 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8465 PE=4 SV=1)

HSP 1 Score: 1051.2 bits (2717), Expect = 0.000e+0
Identity = 559/1284 (43.54%), Postives = 760/1284 (59.19%), Query Frame = 1
Query:  184 IVIIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEI----GNKR---LTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLRRIGLDFQKSQCQSPMNVKNQ---------------------------FLEEVKFNEL-----------------------CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPAS--ISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQV-RLETEGKYIVRKNN---------------------------------LVIENITESEVEGRYVCYASSLSGSAKVSAVITLIR-----------SKNEL-NLNEESSKLPSRNKLKNEQLYE-IIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENK---VKLNLTTAYEETLDFTTL--------LTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLL----------------------------RAHKITP---------------DPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLG--QYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWR-EFCGMKKA---ETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVT--LARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPS 3531
            +  I+ G L     +T    C   C C  ++V CRR     IP +    G+ +   L Y ++    +S+++   F    D++++DLS N+I ++EE A      L  L L+ N +E LP+ IF       +L    N+ L  +P SL++L+ +K L L GN L+CGC +  FA  L        ++ CQ+P+ V  +                           F EEV    L                          S EA E +P+ ++ P     A G+++ F+CQ     + K+ W    NDT +  L+ + + L ++EVH FH G Y C A N  G +S S  L+I    KP I + P++   S   G  +E +C A G P P + WL+  ++   RL T+ +Y VR +                                  L I N+T+ + EGRY CYA++ +GS +V++++TL++            K+E  + +EES  L    K  +E L + +I+ A+ +I+ A +KTA+ LRDP  +R+ SDI SLFRQP+ AA+ELA+A++VYE  +D++T IL++ +      +    Y   +DF           LT EQLAII+QLSGC +S     C +QLCFH +YRSIDG CNNL  P+ G+ALSPFYRL+ P YENG+N P+GW   KLY GY KPSARLVS RLL                            R+H  +                D   S M+MQWGQFLDHDLDFTPVDAS SRFSDGLGCNETC+ND PCFPI+TPPGDPR+++ C+GF+RS ATCGSG +SI+LG+  +REQ+NQI+++LD SNVY S+  E ++LRD  YDEG LR G  TP+ K+LLPFNIRGQVDCQ DP +  VPCFKAGDHR+NENLGLL MHTIWMREHNR++DELR LN HW+GD++YYE+RKIVGA+MQ ITY  WLP VLG  G++ +G   YPGY+  V+ TIS+ FATAA RFGHT++ PI +RL+EN+ETIPEG+L LHKAFFAPD+++ DGG+DP+LRGL   G + +     +N EL E+LFAMAH++ALDL +LNIQRGRDHGL  Y S+    C +  +   ++FDD +  I     REK+R VYGHPGN+DLF G VLE  + G  +GPT +C++ DQFKRLR GDR WYES   F  AQL++I+     L+R++C+N DNI+ V  + F   KS+ + + CS +P+LNL+ WKEC  PS
Sbjct:    8 VAFIWFGLLTSFHFATCQDVCPRNCVCFSQSVVCRRATMATIPRLPAFLGDSQGGALQYFAMTNTKLSRVLNESFVGLLDIMNIDLSDNEIEVIEEGAFQNLPLLAHLLLRQNRLEQLPDNIFDTLPSLEELDLSFNH-LTNIPPSLQRLVALKSLSLRGNPLHCGCGIVDFAQLLPYWESSLDRATCQTPLEVAGRSIRELGRRYLQAFEGTRHLGYWPDEYVFPEEVNRKRLIRTSTPWPLPHCLVKDLGGVVDAVETSVEAYE-SPQIVDPPIPVMAAEGERVFFSCQAIGEPKPKISWMLPTNDTQYVRLWDKRRILELREVHAFHAGTYTCIAENEAGQVSHSVVLQIVDIVKPQITDAPSTQATSGVLGGDIELTCTARGRPRPTVDWLYTHTSSAKRLSTQDRYTVRSSTKLSTHTIQDLIYRDPSAQTDESLRFEGEEESVTLTIRNVTQLDTEGRYTCYAANRAGSTRVTSLVTLVKMPSMGGDNGGEGKDETGHKSEESDDLEVSPKESDEDLVKWVIEKARRRIDAAIQKTADNLRDPKNRRTASDIASLFRQPNKAAIELARAAEVYEAAIDEVTQILQQQRNQSFGKDTEGPYRSDVDFDAQKRQAMGVQLTAEQLAIIAQLSGCAQSQRVEPCDRQLCFHMRYRSIDGSCNNLKYPKWGAALSPFYRLLPPVYENGVNQPVGWNPEKLYFGYPKPSARLVSYRLLADATKLQAHTRKLETFNQRIKMSLRFDNRSHDTSSPFDFPLYEKETLFDEDDTSSGMLMQWGQFLDHDLDFTPVDASTSRFSDGLGCNETCINDPPCFPIITPPGDPRIRQRCMGFARSSATCGSGSTSILLGRPQHREQLNQISAYLDASNVYGSEEFENSQLRDTLYDEGHLRGGIPTPAGKQLLPFNIRGQVDCQADPQQDFVPCFKAGDHRSNENLGLLSMHTIWMREHNRIADELRSLNPHWSGDRLYYEARKIVGALMQSITYRVWLPKVLGPRGMEMMGGETYPGYDSSVNPTISNEFATAAFRFGHTMVPPISFRLNENWETIPEGHLLLHKAFFAPDKLLTDGGMDPVLRGLLFHGVRDIIRRPSLNPELTERLFAMAHQLALDLASLNIQRGRDHGLQHYTSYAYTICNLGSSAAPDSFDDLADRIRDPATREKLRAVYGHPGNIDLFVGGVLEDVLPGARMGPTFACIIADQFKRLRAGDRLWYESPGLFTTAQLAEIRDAGSYLSRVICENGDNITEVPLDAFLRPKSRKDLVPCSQVPKLNLVLWKECPSPS 1289          
BLAST of Peroxidasin vs. TrEMBL
Match: A0A158R893 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5025 PE=4 SV=1)

HSP 1 Score: 1045.03 bits (2701), Expect = 0.000e+0
Identity = 565/1338 (42.23%), Postives = 781/1338 (58.37%), Query Frame = 1
Query:  184 IVIIFLGSLNFLSVSTTGQECLPQ-CRCTEKTVTCRRGGFQMIPEIG-------NKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLRRIGLDFQKSQCQSPMNVKNQ---------------------------FLEEVKFNELC-----------------------SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEK--GSRVEFSCRAHGYPVPEITWLWVKSNQV-RLETEGKYIVRKNN---------------------------------LVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKL------------KNEQLYE-IIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGIL---RENKVKLNLTTAYEETLDFT--------TLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLL----------------------------RAHKITP---------------DPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLG--QYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWR-EFCGMKKA---ETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVT--LARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSRLTPEDQVPGLS-----PSRSRRSTNEFQDQNCKSKTNQCSSNISNLEERIKS 3675
            +  I+L  L     S+TGQ+  P+ C C  +++ CRR     IP+I           L Y ++    ++++    F    D++++DLS N+I ++EE A      L  L L+ N +  LP+ IF       +L   + N+L T+P+SL++L+ +K L L GN L+CGC +  FA  L        ++ C +P  V  +                           F EE+   +L                        +++   S  AP+ +E P    VA G+++ F CQ   + + K+ W    N++ +  L+ + + L ++EVH FHEG Y C A N  G +S S  L+I    KP I + P++ +     G  +E +C A G P P + WL+  ++   RL T+G+Y+VR +                                  L I N+TE + EGRY CYA++ +GS +V++++TL +  +  + N +  K  S +K              +E L + +I+ A+ +I+ A +KTA+ LRDP  +R+ SDI SLFRQPS AA+ELA+A++VYE  +D++T IL   R      +    Y   +DF           LT EQLAII+QLSGC +S     C +QLCFH +YRSIDG CNNL  P+ G+ALSPFYRL+ P YENG+N P+GW   +LY GY KPSARL S RLL                              H  +                D   S M+MQWGQFLDHDLDFTPVDAS SRFSDGLGCNETC+ND PCFPILTPPGDPR+++ CIGF+RS ATCGSG +SI+LG+  +REQ+NQI+++LD SNVY S+  E ++LRD  YDEG LR G  TP+ K+LLPFNIRGQVDCQ DP +  VPCFKAGDHR+NENLGLL MHTIWMREHNR++DELR LN HW+GD++Y+E+RKIVGA+MQ ITY  WLP VLG  G++ +G   YPGY+  V+ +IS+ FATAA RFGHT++ PI +RL+EN+E IPEG+L LHKAFFAPD+++ DGG+DPILRGL   G + V     +N EL E+LFAMAH++ALDL +LNIQRGRDHGL  Y S+    CG   +   ++FDD +  I    IRE++R VYGHPGN+DLF G VLE  + G  +GPT +C++ DQFKRLR GDR WYES   F  AQL++++     L+R++C+N DNI+ V  + F   KS+ + + CS +P+LNL  WKEC  PS  TP      +      P   RR +   +D +C++K     S ++ +E+ +++
Sbjct:    8 VAFIWLSLLTLFH-SSTGQDACPRNCVCFSQSIVCRRSTETTIPKISAFLDDPQGGALQYFAMTNTKLTRVPTEAFVGLLDVMNIDLSDNEIEVIEEGAFQDLPLLAHLLLRQNRLPQLPDNIFDTLPGLEELDL-SFNQLTTIPLSLQRLVGLKSLSLRGNPLHCGCGIVDFAQLLPYWESSLDRATCTTPAEVAGKSIKELGRQYHQAFEGTRHLGYWPDQYAFPEEISGKQLIRTRTPWPLPHCPMKDLGGEFVDETDTSMGSFEAPQIVEAPVPVMVAEGERVFFVCQATGVPKPKISWMLPTNNSQYVRLWDKRRILELREVHAFHEGTYTCIAENRVGQVSHSVMLQIVDIVKPQITDAPSTQATAGVLGGDIELTCTARGRPRPTVDWLYTHTSSAKRLSTQGRYVVRSSTKLSARTIHDLIYRDPSAQSDESLRLEGEEESLTLTIRNVTEIDTEGRYTCYAANRAGSTRVTSLVTLKKRPSMGDGNGDGDKNASDDKRGESDDPEIASKESDEDLVKWVIEKARRRIDAAIQKTADNLRDPKNRRTASDIASLFRQPSKAAIELARAAEVYEAAIDEVTQILQRQRNQSFGKDTEGPYRGDVDFDEQKRQAMGVQLTAEQLAIIAQLSGCAQSQRVEPCDRQLCFHMRYRSIDGSCNNLKYPKWGAALSPFYRLLPPVYENGVNQPVGWNPERLYFGYPKPSARLASYRLLADATKLQVHTRKLETFNQRIKMSLRFGNSTHDTSSPFDFPMNEKEALFDEDDRSSGMLMQWGQFLDHDLDFTPVDASTSRFSDGLGCNETCINDPPCFPILTPPGDPRIRQRCIGFARSSATCGSGSTSILLGRPQHREQLNQISAYLDASNVYGSEDFENSQLRDTLYDEGHLRGGMPTPAGKQLLPFNIRGQVDCQADPQQDFVPCFKAGDHRSNENLGLLSMHTIWMREHNRIADELRSLNPHWSGDRLYHEARKIVGALMQSITYRVWLPKVLGPRGMEMMGGETYPGYDSSVNPSISNEFATAAFRFGHTMVPPISFRLNENWEAIPEGHLLLHKAFFAPDKMLTDGGMDPILRGLLFHGVRDVIRRPSLNPELTERLFAMAHQLALDLASLNIQRGRDHGLQHYTSYAYTICGFGSSAAPDSFDDLADRIRDPAIREELRAVYGHPGNIDLFVGGVLEDVLPGARMGPTFACIIADQFKRLRAGDRLWYESPGLFTTAQLAELRDAGSYLSRVICENGDNITEVPLDAFLRPKSRKDLVPCSQVPKLNLALWKECPSPSG-TPFGSYSDIGVYFDQPLNRRRRSVPSED-SCEAKPPDALSFMAEVEQELEA 1341          
BLAST of Peroxidasin vs. TrEMBL
Match: A0A068WWK6 (Peroxidasin OS=Echinococcus granulosus OX=6210 GN=EgrG_000733600 PE=4 SV=1)

HSP 1 Score: 1038.48 bits (2684), Expect = 0.000e+0
Identity = 550/1270 (43.31%), Postives = 747/1270 (58.82%), Query Frame = 1
Query:  184 IVIIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEI-------GNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLRRIGLDFQKSQCQSPMNVKNQ---------------------------FLEEVKFNELCS-----------------------NSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASIS--AEKGSRVEFSCRAHGYPVPEITWLWVKSNQV-RLETEGKYIVRKN---------------------------------NLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEE---SSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGIL-RENKVKLNLTT--AYEETLDFT--------TLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLL----------------------------RAHKITPDPNL---------------SAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLG--QYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWR-EFCGMKKA---ETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVT--LARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKEC 3519
            +  I+LG L     ST    C   C C  +++ CRR    +IP+I           L Y ++    +S++    F    D++ +DLS N+I ++EE A      L  L L+ N +  LP+ IF       +L   + N+L T+P SL++++ +K L L GN L+CGC +  FA  L        +  C +P  V  +                           F EE+   +L                         +S   S  AP+ IE P    VA G+++ F CQ   +   K+ W    N++    L+ + + L ++EVH +HEG Y C A N  G +S S  L++    KP I + P++ +   E G  +E +C A G P P + WL+  ++   RL T+G+Y+VR +                                  L I N+TE + EGRY CYA++ +GS +V++ + L   K   +++++     K PSR K        +I+ A+ +I+ A +KTA+ LRDP  +R+ SDI SLFRQPS AA+ELA+A++VYE  +D++T IL R+  +     T   Y    DF           LT EQLAII+QLSGC +S       +QLCFH +YRSIDG CNNL  P+ G+ALSP YRL+ P YENG+N P+GW   KL+ GY KPSARLVS RLL                            R+H  +   +                S M+MQWGQFLDHDLDFTPVDAS SRFSDGLGCN TC+ND PCFPILTPPGDPR+++ CIGF+RS ATCGSG +SI+LG+  +REQ+NQI+++LD SNVY S+  E ++LRD  YDEG LR G  TP+ K+LLPFNIRGQVDCQ DP +  VPCFKAGDHR+NENLGLL MHTIWMREHNR++DELR LN HW+GD++Y+E+RKIVGA+MQ ITY  WLP VLG  G++ +G   YPGY+  V+ TIS+ FATAA RFGHT++ PI +RL+EN+ETIPEG+L LHKAFFAPD+++ DGG+DPILRGL   G + +     +N EL E+LFAMAH++ALDL +LNIQRGRDHGL  Y S+  + CG+  +   ++F+D +  I    IRE++R +YGHPGN+DLF G VLE  + G  +GPT +C++ DQFKRLR GDR WYES   F  AQL++I+     L+R++C+N DNI+ V  + F   K+  + + CS +P+LNL  WKEC
Sbjct:    8 VAFIWLGLLTLFCTSTCQDACPGNCVCFSQSIVCRRSTETIIPKIPAFLDGPQGGALQYFAITNTKLSRVPTEAFVGLLDIMSIDLSNNEIEVIEEGAFQDLPILAHLLLRQNRLTQLPDNIFDTLPSLEELDL-SFNQLTTIPSSLQRMVGLKSLSLRGNPLHCGCGIVDFAQLLPYWESSLDRVTCATPAQVAGKSIKELGRQYFQAFEGTRHLGHWPDEYAFPEEISRKQLIRTRTPWPLPHCPVKDLGGEVVDNVDSSTGSYEAPQIIEAPVPVMVAEGERVFFVCQATGVPRPKISWILPTNNSQHVHLWDKRKILELREVHAYHEGTYTCVAKNQVGQVSHSVMLQLVDIVKPQITDAPSTKATVGEPGGDIELTCTARGRPRPTVDWLYTHTSSAKRLSTQGRYVVRSSAKLSTRTIQDLTYRDFLAQTDESLRLEGEEESVTLTIRNVTELDTEGRYTCYAANRAGSTRVTSQVAL---KTWTDMDDDYGGEDKDPSRVK-------RVIEKARRRIDAAIQKTADNLRDPKNRRTASDIASLFRQPSKAAVELARAAEVYEAAIDEVTQILQRQRNLSFGKDTEGPYRSDADFDEQKRQAMGVQLTAEQLAIIAQLSGCAQSQRVEPRDRQLCFHMQYRSIDGSCNNLKYPKWGAALSPLYRLLPPVYENGVNQPVGWNPEKLFSGYPKPSARLVSYRLLADATKLQVHTRKLETFNQRIKMSLKFNNRSHDTSSPFDFPLYEKEELFDEGDSSSGMLMQWGQFLDHDLDFTPVDASTSRFSDGLGCNGTCINDPPCFPILTPPGDPRIRQRCIGFARSSATCGSGSTSILLGRPQHREQLNQISAYLDASNVYGSEDFENSQLRDTLYDEGHLRGGMPTPAGKQLLPFNIRGQVDCQADPQQDFVPCFKAGDHRSNENLGLLSMHTIWMREHNRIADELRSLNPHWSGDRLYHEARKIVGALMQSITYRVWLPKVLGPRGMEMMGGETYPGYDSSVNPTISNEFATAAFRFGHTMVPPIYFRLNENWETIPEGHLLLHKAFFAPDKMLTDGGMDPILRGLLFHGIRDIIRRPSLNPELTERLFAMAHQLALDLASLNIQRGRDHGLQHYTSYAYKICGLGSSAAPDSFEDLADRIRDPAIREELRAIYGHPGNIDLFVGGVLEDVLPGARMGPTFACIIADQFKRLRAGDRLWYESPGLFTTAQLAEIRDAGSYLSRVICENGDNITEVPLDAFIRPKNHKDLVSCSQVPKLNLALWKEC 1266          
BLAST of Peroxidasin vs. TrEMBL
Match: A0A5K3FIH8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 1035.79 bits (2677), Expect = 0.000e+0
Identity = 555/1254 (44.26%), Postives = 756/1254 (60.29%), Query Frame = 1
Query:  244 CLPQCRCTEKTVTCRRGGFQMIPEI-------GNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGC-------ELRYFAGNL-RRIGLDFQKSQCQSPMNVKNQF------------------------------------LEEVKFNELCSNSFEAS------ELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPA--SISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQV-RLETEGKYIVRKN---------------------------------NLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGIL---RENKVKLNLTTAYEETLDFT--------TLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLL-RAHKI--------------------------TPDP-------------------NLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLG--QYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWR-EFCGMKKA---ETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQV--TLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPS 3531
            C   C C  ++V CRR     +P +           L Y +L  + +S++ A  F    DL+++DLS N++  VEE A      L  L L+ N + +LP+ +F       +L   + N+L T+P SLE+LI +K L L GN ++C C       +L+++ G++ R +     +   +S  ++  Q+                                    L + +  +L   + + +      ++AP+F+E P+ A VA G+++ F CQ   +   K+ W    N++ F  L+ + + L I+EVH +H G Y C A N  G I  S  L+I    KP I + P+  +++   GS VE  C A G P P I WL+  +    RL T+G+Y V                                     L I N++E + EGRY CYA++ +GS +V++V++L ++++E     ESS+  S   L    +  +I+ A+ +I+ A +KTA+ LRDP+ +R+ SDI SLFRQPS AA+ELA+A++VYE  +D++T IL   R   +  +   AY+   DF           LT EQLAII+QLSGC +      C +QLCFH +YRSIDG CNNL  P+ GSALSPFYRL+ P YENG+N P+GW   +LY GY KPSARLVS RLL  A K+                          T +P                     S M+MQWGQFLDHDLDFTPVDAS SRFSDGLGCNETC+ND PCFPI+TPPGDPR+++ CIGF+RS ATCGSG +SI+LGK  +REQ+NQIT+F+D SNVY S+  E ++LR+  YDEG+LR G  TPS K+LLPFNIRGQVDCQ DP +  VPCFKAGDHR+NENLGLL MHTIWMREHNR++DELR LN HW+GD+IY+E+RKIVGA+MQ ITY  WLP VLG  G++ +G   Y GY+  V+ TIS+ FATAA RFGHTL+ PI +RL+EN+E IPEG+L LHKAFFAPDR++ DGG+DPILRGL   G + +     +N EL E+LFAMAH++ALDL +LN+QRGRDHGL  Y ++  + CG+  +   ++FDD +  I    IRE++R VYGHPGN+DLF G VLE  + G  +GPT +C++ DQFKRLR GDR WYES   F  AQL++I++    L+R++C+N DNI+ V  + F   KS+ + + CS +P+LNL  WKEC  PS
Sbjct:   26 CPQGCVCFSQSVVCRRVQGNTLPTLPSYLPDPNGGALQYFALTLSKLSRLPAGAFVGLLDLMNIDLSNNELESVEEGAFQELPALVQLSLRQNRLTHLPDNLFDTVPSLEELDL-SYNQLTTVPASLERLIGLKTLILRGNPIHCSCGIVDFALKLQFWEGSVGRTVCASPNEVAGKSVSDLGRQYVQAFEGTRHLGYWPDEYVYPEEANRRPLVRTRTAWPLPQCREGDLGGETSDTTRRPLGPDVAPRFVETPEPAMVAEGERVFFTCQAAGVPTPKILWTLPTNNSQFIHLWNKRKILEIREVHGYHAGTYTCIAKNRLGEIGHSVSLQILDIVKPQITDAPSAQTMAGYAGSDVELVCTARGRPRPTIDWLYTHATSAKRLSTQGRYTVHSAKKLSTHTIQDLVSRDPLAQNDEVTRAEGEEESVTLTIRNVSEHDTEGRYTCYAANRAGSTRVTSVVSLKKARDE----AESSEGESDEDL----VKRVIEKARRRIDAAIQKTADNLRDPSNRRTASDIASLFRQPSKAAIELARAAEVYEAAIDEVTQILQRQRNKSLGKDEEGAYKGDEDFDEHKRLAMGVQLTTEQLAIIAQLSGCAQPQRVEPCDRQLCFHMRYRSIDGSCNNLKFPKWGSALSPFYRLLPPVYENGVNQPVGWNPERLYFGYPKPSARLVSYRLLGDATKLQVHTRKLQTFNERIKMSLKFNNRTYGTSNPFDVPRIGEEEKEDFFDEDDTSSGMLMQWGQFLDHDLDFTPVDASTSRFSDGLGCNETCINDPPCFPIITPPGDPRIRQRCIGFARSSATCGSGSTSILLGKPQHREQLNQITAFIDASNVYGSEEFENSQLRNTLYDEGQLRGGMPTPSGKKLLPFNIRGQVDCQADPQQDFVPCFKAGDHRSNENLGLLSMHTIWMREHNRIADELRSLNPHWSGDRIYHEARKIVGALMQSITYRVWLPKVLGPRGMEMMGGDTYTGYDSSVNPTISNEFATAAFRFGHTLVPPISFRLNENWEAIPEGHLLLHKAFFAPDRMLTDGGMDPILRGLLFHGVRDIVRRPSLNPELTERLFAMAHQLALDLASLNVQRGRDHGLQHYTAYAYKVCGLGSSAAPDSFDDLADRIRDPAIREELRAVYGHPGNIDLFVGGVLEDVMPGARMGPTFACIIADQFKRLRSGDRLWYESPGLFTVAQLAEIREAGSLLSRVVCENGDNITEVPLDAFLRPKSRKDLVPCSQVPKLNLALWKECPSPS 1270          
BLAST of Peroxidasin vs. Ensembl Cavefish
Match: pxdn (peroxidasin [Source:NCBI gene;Acc:103028918])

HSP 1 Score: 762.681 bits (1968), Expect = 0.000e+0
Identity = 391/913 (42.83%), Postives = 550/913 (60.24%), Query Frame = 1
Query:  817 PKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEET-LDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP---CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            P+F   PQD  V  G  + F C+     +  + W    +    +   +      L I  V    +G Y C A +  G++ A+ +L I     P     P  +  E G+ V+  C A G P P ITW     + V++   GK+ +     ++ N   +   GRY C A +  G +  S V+T+              ++P  ++  +  +   +++A   I+ A   T   L D    R+  ++ +LFR P     +E A+A +++E+ L     +L +  V   L      T   +  L++P  L +I+ LSGC       +CS  +CFH+KYRS DG CNNL +P  G++L+ F RL+K  Y+NG N P G T  + + G++ P  RLVS+ ++    ITPD   + M+MQWGQFLDHDLD T V  S SRFSDG  C   C ND PCFPI+ PP DPR +R    C+ F RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   EA E+RDL    G+L+ G V  + K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITY+ WLP +LG  G+K +G Y GY+  V++ I + FATAA RFGHTLINPILYRLDENF+ I +G++ LHKAFF+P R++ +GGIDP+LRGLF +  K   + Q++N EL E+LF+MAH VALDL A+N+QRGRDHG+  YN +R FC +  A+TFDD   EI +  +REK++++YG P N+DLF   ++E  V G  +GPTL CLL  QFKR+RDGDRFWYE+   F PAQL+Q+KQ +L R+LCDN DNI+R+Q +VF +A+    F  C ++P+++L  W++C +  R
Sbjct:  405 PQFTVSPQDQSVLEGHTVDFPCEATGYPQPVIAWTRGGSPLPGDRRHVVLSTGTLRISRVAPHDQGQYECQAVSPVGTVRAAVQLNIQQRVTPVFTSAPRDLEVESGTDVQIPCSAQGEPTPVITW---NKDGVQVTESGKFHINPEGYLVVNDVGTADGGRYECVARNSIGYSSASMVLTV--------------QVPQVSREGDSYVSTSLEEAIRSIDRAIDSTRRHLFD-GSPRTPGELLALFRYPRDPYTVEQARAGEIFEQTL-----LLIQRHVNHGLMVDTNGTAFRYNDLVSPRFLDMIANLSGCTAHRRINNCSD-ICFHQKYRSHDGTCNNLQHPMWGASLTAFERLLKSVYDNGFNLPRGAT-DRRHSGFALPLPRLVSTTMIGTETITPDERYTHMLMQWGQFLDHDLDSTVVSLSQSRFSDGQLCTSVCTNDPPCFPIMFPPNDPRQRRGGARCMFFVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSRHEADEIRDLAGHRGQLKQGIVQRTGKPLLPFASGPPTECMRDENESPIPCFLAGDHRANEQLGLTAMHTVWFREHNRIAAELLRLNPHWDGDTIYHEARKIVGAQMQHITYSHWLPKILGEAGMKIMGDYHGYDPNVNAGIFNAFATAAFRFGHTLINPILYRLDENFQPIQQGHISLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRVTTQLLNTELTERLFSMAHAVALDLAAMNVQRGRDHGIPPYNDYRVFCNLTSAQTFDDLRNEIRNPTVREKLQRLYGTPMNIDLFPALMVEDIVPGSRLGPTLMCLLATQFKRVRDGDRFWYENAGVFSPAQLTQLKQASLTRVLCDNGDNITRIQSDVFSVAEFPHGFGSCDDVPKIDLRMWQDCCEDCR 1292          

HSP 2 Score: 101.293 bits (251), Expect = 4.170e-21
Identity = 100/385 (25.97%), Postives = 165/385 (42.86%), Query Frame = 1
Query:  244 CLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPI-SLEKLINVKRLELYGNMLYCGCELRYFAGNLRRI---GLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSI-SASAKLK-IAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            C  +C C   TV C     + +P + + + T L L  N I  +    F+  K+L  + L+ N I  +   A      L+ LYL  N IE L  + F+      +L    NNR+  L + +   L  +KRL L  N L C CEL + A  L++    G     + C+ P  ++ + +  +   EL C          P+    PQD  V  G+ + F C+ E   + ++ W    N      DT  N L   +  L I++  E  +G+Y C A N  G + +    L+      +P  V  P +     G  V   C A G P P ++  W + ++  L  + +  I     L I+N+ +++  G+Y C+AS+   +   +A I +
Sbjct:   32 CPSRCLCFRTTVRCMHLNLETVPAV-SPQTTILDLRFNKIKDLQLGSFRRLKNLNTLLLNNNHIRRIPRAAFEDLENLKYLYLHFNNIEALEPESFTHLPKLERLFLH-NNRITHLTLGTFSHLQAMKRLRLDSNTLNCDCELLWLADLLKQYAESGNAQAAATCEFPSRLQGRSVATLTAEELNCE--------VPRITSEPQDVDVTSGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDTRLNLL--EDGTLMIQDTRETDQGVYQCMAKNVAGEVKTGEVTLRYFGTPSRPSFVIQPQNTEVLVGQSVTLECSAAGQPQPRVS--WTRGDRSPLPNDARINITPSGGLYIQNVNQAD-GGQYTCFASNNVDTIHATAYIIV 401          
BLAST of Peroxidasin vs. Ensembl Cavefish
Match: pxdn (peroxidasin [Source:NCBI gene;Acc:103028918])

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 391/913 (42.83%), Postives = 550/913 (60.24%), Query Frame = 1
Query:  817 PKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEET-LDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP---CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            P+F   PQD  V  G  + F C+     +  + W    +    +   +      L I  V    +G Y C A +  G++ A+ +L I     P     P  +  E G+ V+  C A G P P ITW     + V++   GK+ +     ++ N   +   GRY C A +  G +  S V+T+              ++P  ++  +  +   +++A   I+ A   T   L D    R+  ++ +LFR P     +E A+A +++E+ L     +L +  V   L      T   +  L++P  L +I+ LSGC       +CS  +CFH+KYRS DG CNNL +P  G++L+ F RL+K  Y+NG N P G T  + + G++ P  RLVS+ ++    ITPD   + M+MQWGQFLDHDLD T V  S SRFSDG  C   C ND PCFPI+ PP DPR +R    C+ F RS   CGSG +S+++  ++ REQ+NQ+TS++D SNVY S   EA E+RDL    G+L+ G V  + K LLPF      +C  D  ++ +PCF AGDHR NE LGL  MHT+W REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITY+ WLP +LG  G+K +G Y GY+  V++ I + FATAA RFGHTLINPILYRLDENF+ I +G++ LHKAFF+P R++ +GGIDP+LRGLF +  K   + Q++N EL E+LF+MAH VALDL A+N+QRGRDHG+  YN +R FC +  A+TFDD   EI +  +REK++++YG P N+DLF   ++E  V G  +GPTL CLL  QFKR+RDGDRFWYE+   F PAQL+Q+KQ +L R+LCDN DNI+R+Q +VF +A+    F  C ++P+++L  W++C +  R
Sbjct:  429 PQFTVSPQDQSVLEGHTVDFPCEATGYPQPVIAWTRGGSPLPGDRRHVVLSTGTLRISRVAPHDQGQYECQAVSPVGTVRAAVQLNIQQRVTPVFTSAPRDLEVESGTDVQIPCSAQGEPTPVITW---NKDGVQVTESGKFHINPEGYLVVNDVGTADGGRYECVARNSIGYSSASMVLTV--------------QVPQVSREGDSYVSTSLEEAIRSIDRAIDSTRRHLFD-GSPRTPGELLALFRYPRDPYTVEQARAGEIFEQTL-----LLIQRHVNHGLMVDTNGTAFRYNDLVSPRFLDMIANLSGCTAHRRINNCSD-ICFHQKYRSHDGTCNNLQHPMWGASLTAFERLLKSVYDNGFNLPRGAT-DRRHSGFALPLPRLVSTTMIGTETITPDERYTHMLMQWGQFLDHDLDSTVVSLSQSRFSDGQLCTSVCTNDPPCFPIMFPPNDPRQRRGGARCMFFVRSSPVCGSGMTSLLMNSVYPREQMNQLTSYIDASNVYGSSRHEADEIRDLAGHRGQLKQGIVQRTGKPLLPFASGPPTECMRDENESPIPCFLAGDHRANEQLGLTAMHTVWFREHNRIAAELLRLNPHWDGDTIYHEARKIVGAQMQHITYSHWLPKILGEAGMKIMGDYHGYDPNVNAGIFNAFATAAFRFGHTLINPILYRLDENFQPIQQGHISLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRVTTQLLNTELTERLFSMAHAVALDLAAMNVQRGRDHGIPPYNDYRVFCNLTSAQTFDDLRNEIRNPTVREKLQRLYGTPMNIDLFPALMVEDIVPGSRLGPTLMCLLATQFKRVRDGDRFWYENAGVFSPAQLTQLKQASLTRVLCDNGDNITRIQSDVFSVAEFPHGFGSCDDVPKIDLRMWQDCCEDCR 1316          

HSP 2 Score: 107.457 bits (267), Expect = 6.119e-23
Identity = 102/409 (24.94%), Postives = 171/409 (41.81%), Query Frame = 1
Query:  244 CLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSIS------------------------KIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPI-SLEKLINVKRLELYGNMLYCGCELRYFAGNLRRI---GLDFQKSQCQSPMNVKNQFLEEVKFNEL-CSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSI-SASAKLK-IAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            C  +C C   TV C     + +P + + + T L L  N I                         +I    F++ ++L ++ L  N+I  ++  A  G + LE LYL  N IE L  + F+      +L    NNR+  L + +   L  +KRL L  N L C CEL + A  L++    G     + C+ P  ++ + +  +   EL C          P+    PQD  V  G+ + F C+ E   + ++ W    N      DT  N L   +  L I++  E  +G+Y C A N  G + +    L+      +P  V  P +     G  V   C A G P P ++  W + ++  L  + +  I     L I+N+ +++  G+Y C+AS+   +   +A I +
Sbjct:   32 CPSRCLCFRTTVRCMHLNLETVPAV-SPQTTILDLRFNKIKDLQLGSFRRLKNLNTLLLNNNHIRRIPRAAFEDLENLKYLYLYKNEIQSIDRQAFKGLVSLEQLYLHFNNIEALEPESFTHLPKLERLFLH-NNRITHLTLGTFSHLQAMKRLRLDSNTLNCDCELLWLADLLKQYAESGNAQAAATCEFPSRLQGRSVATLTAEELNCE--------VPRITSEPQDVDVTSGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDTRLNLL--EDGTLMIQDTRETDQGVYQCMAKNVAGEVKTGEVTLRYFGTPSRPSFVIQPQNTEVLVGQSVTLECSAAGQPQPRVS--WTRGDRSPLPNDARINITPSGGLYIQNVNQAD-GGQYTCFASNNVDTIHATAYIIV 425          
BLAST of Peroxidasin vs. Ensembl Cavefish
Match: mpx (myeloid-specific peroxidase [Source:ZFIN;Acc:ZDB-GENE-030131-9460])

HSP 1 Score: 505.753 bits (1301), Expect = 2.579e-163
Identity = 268/673 (39.82%), Postives = 399/673 (59.29%), Query Frame = 1
Query: 1531 SDIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITP--DPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR-PCIGFSRSIATCGSGQSSIILGKL-HYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKR-LLPFNIRGQVDCQI------DPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRL-GQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPE-GNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPW 3510
            SD   L +QPS       +A+D  E+ L  +    R          A++ +++ T L++P +L +I +L+GC    +   C      +K YR+ +  CNN  NP  G+A +P    +   YE+GI+ P+GW  G+L++G S P  RLVS+++L         D   + +V  +GQ+ DHDL FTP   S   FS G+ C+ +C    PCFPI  P GDPR+ R  CI   RS  TCGSG ++ + G   + R+Q+N +T+FLD   +Y SD   A ELRDL+ D+G+L V      N R LLPF       C              VPCF AGD R +EN+ L  +HT++MREHNRL+D LR LN HW+ + +Y E+RKI+GA  Q I    +LP ++G + IK+L G YPGYN  +D +I++VFATAA RF H  I P+++R+DENFE  P+  ++PL++AFF+P RV+ +GGIDP++RGL +  +K  + + ++   L E+LFA    +ALDL +LN+QR RDHGL  Y +WR+FC + +     + +  + ++++  ++ + Y  P N+D++   + E  V GG VGP  SCL+  QF+++R GDR W+E    F   Q + +  V+LARI+CDN+  + RV  N F  + SK  F+DC+ IP+++L PW
Sbjct:   69 SDKLRLLKQPSRKTRSAVRAADYLEQTLRIIADKTRH---------AHKRSINATELISPNELRMIERLTGCAAQVQPPSCRTTPNVNK-YRTANSVCNNRKNPLLGAANTPLASWLPTIYEDGISQPVGWNPGRLHNGVSLPLVRLVSNQILSMQDADAKGDSEYTHLVTFFGQWNDHDLSFTPFSPSIRSFSSGIDCDASCEQSEPCFPIRIPNGDPRISRNSCIPVFRSAPTCGSGNTAFMFGGTPNVRQQINSLTAFLDVGQLYGSDQGLARELRDLSNDKGRLLVNDRFQDNGRDLLPFTKVASNMCSTRNRILNTTGLPEVPCFIAGDVRVDENIALTSLHTLFMREHNRLADILRVLNPHWSSETLYQEARKIMGAYHQIIVIRDYLPHIVGPDAIKKLLGPYPGYNPNIDPSIANVFATAAYRFAHVTIQPLVFRVDENFENHPKFPSVPLYEAFFSPWRVVFEGGIDPLIRGLISRPAKLNQQNHMLVNALRERLFAFTSHIALDLASLNMQRSRDHGLQGYTAWRKFCNLSEPRNQAELATVLNNTDLARRLLEHYKTPANIDVWLAGIAEPFVPGGRVGPLFSCLIGTQFQKIRLGDRLWWEKPGVFTRTQRASLASVSLARIICDNT-GVKRVPANPFRFSSSK-NFVDCNEIPQIDLTPW 729          
BLAST of Peroxidasin vs. Ensembl Cavefish
Match: mpx (myeloid-specific peroxidase [Source:ZFIN;Acc:ZDB-GENE-030131-9460])

HSP 1 Score: 499.204 bits (1284), Expect = 1.352e-155
Identity = 263/673 (39.08%), Postives = 398/673 (59.14%), Query Frame = 1
Query: 1531 SDIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITP--DPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR-PCIGFSRSIATCGSGQSSIILGKL-HYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKR-LLPFNIRGQVDCQI------DPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRL-GQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPE-GNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPW 3510
            SD   L +QPS       +A+D  E+ L  +    R          A++ +++ T L++P +L +I +L+GC    +   C      +K YR+ +  CNN  NP  G+A +P    +   YE+GI+ P+GW  G+L++G S P  RLVS+++L         D   + +V  +GQ+ DHDL FTP   S   FS G+ C+ +C    PCFPI  P GDPR+ R  CI   RS  TCGSG ++ + G   + R+Q+N +T+FLD   +Y SD   A ELRDL+ D+G+L V      N R LLPF       C              VPCF AGD R +EN+ L  +HT++MREHNRL+D LR LN HW+ + +Y E+RKI+GA  Q I    +LP ++G + IK+L G YPGYN  +D +I++VFATAA RF H  I P+++R+DENFE  P+  ++PL++AFF+P RV+ +GGIDP++RGL +  +K  + + ++   L E+LFA    +ALDL +LN+QR RDHGL  Y +WR+FC + +     + +  + ++++  ++ + Y  P N+D++   + E  V GG VGP  SCL+  QF+++R GDR W+E+   F   Q   +  ++LARI+CDN+  + +V  + F +  +K EF++CS+I  ++  PW
Sbjct:   21 SDKLRLLKQPSRKTRSAVRAADYLEQTLRIIADKTRH---------AHKRSINATELISPNELRMIERLTGCAAQVQPPSCRTTPNVNK-YRTANSVCNNRKNPLLGAANTPLASWLPTIYEDGISQPVGWNPGRLHNGVSLPLVRLVSNQILSMQDADAKGDSEYTHLVTFFGQWNDHDLSFTPFSPSIRSFSSGIDCDASCEQSEPCFPIRIPNGDPRISRNSCIPVFRSAPTCGSGNTAFMFGGTPNVRQQINSLTAFLDVGQLYGSDQGLARELRDLSNDKGRLLVNDRFQDNGRDLLPFTKVASNMCSTRNRILNTTGLPEVPCFIAGDVRVDENIALTSLHTLFMREHNRLADILRVLNPHWSSETLYQEARKIMGAYHQIIVIRDYLPHIVGPDAIKKLLGPYPGYNPNIDPSIANVFATAAYRFAHVTIQPLVFRVDENFENHPKFPSVPLYEAFFSPWRVVFEGGIDPLIRGLISRPAKLNQQNHMLVNALRERLFAFTSHIALDLASLNMQRSRDHGLQGYTAWRKFCNLSEPRNQAELATVLNNTDLARRLLEHYKTPANIDVWLAGIAEPFVPGGRVGPLFSCLIGTQFQKIRLGDRLWWENRGVFTKRQRDSLITMSLARIICDNT-GLKKVPADPFRLKANKAEFVECSSIAEIDFTPW 682          
BLAST of Peroxidasin vs. Ensembl Cavefish
Match: mpx (myeloid-specific peroxidase [Source:ZFIN;Acc:ZDB-GENE-030131-9460])

HSP 1 Score: 499.975 bits (1286), Expect = 2.267e-155
Identity = 263/673 (39.08%), Postives = 398/673 (59.14%), Query Frame = 1
Query: 1531 SDIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITP--DPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR-PCIGFSRSIATCGSGQSSIILGKL-HYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKR-LLPFNIRGQVDCQI------DPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRL-GQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPE-GNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPW 3510
            SD   L +QPS       +A+D  E+ L  +    R          A++ +++ T L++P +L +I +L+GC    +   C      +K YR+ +  CNN  NP  G+A +P    +   YE+GI+ P+GW  G+L++G S P  RLVS+++L         D   + +V  +GQ+ DHDL FTP   S   FS G+ C+ +C    PCFPI  P GDPR+ R  CI   RS  TCGSG ++ + G   + R+Q+N +T+FLD   +Y SD   A ELRDL+ D+G+L V      N R LLPF       C              VPCF AGD R +EN+ L  +HT++MREHNRL+D LR LN HW+ + +Y E+RKI+GA  Q I    +LP ++G + IK+L G YPGYN  +D +I++VFATAA RF H  I P+++R+DENFE  P+  ++PL++AFF+P RV+ +GGIDP++RGL +  +K  + + ++   L E+LFA    +ALDL +LN+QR RDHGL  Y +WR+FC + +     + +  + ++++  ++ + Y  P N+D++   + E  V GG VGP  SCL+  QF+++R GDR W+E+   F   Q   +  ++LARI+CDN+  + +V  + F +  +K EF++CS+I  ++  PW
Sbjct:   69 SDKLRLLKQPSRKTRSAVRAADYLEQTLRIIADKTRH---------AHKRSINATELISPNELRMIERLTGCAAQVQPPSCRTTPNVNK-YRTANSVCNNRKNPLLGAANTPLASWLPTIYEDGISQPVGWNPGRLHNGVSLPLVRLVSNQILSMQDADAKGDSEYTHLVTFFGQWNDHDLSFTPFSPSIRSFSSGIDCDASCEQSEPCFPIRIPNGDPRISRNSCIPVFRSAPTCGSGNTAFMFGGTPNVRQQINSLTAFLDVGQLYGSDQGLARELRDLSNDKGRLLVNDRFQDNGRDLLPFTKVASNMCSTRNRILNTTGLPEVPCFIAGDVRVDENIALTSLHTLFMREHNRLADILRVLNPHWSSETLYQEARKIMGAYHQIIVIRDYLPHIVGPDAIKKLLGPYPGYNPNIDPSIANVFATAAYRFAHVTIQPLVFRVDENFENHPKFPSVPLYEAFFSPWRVVFEGGIDPLIRGLISRPAKLNQQNHMLVNALRERLFAFTSHIALDLASLNMQRSRDHGLQGYTAWRKFCNLSEPRNQAELATVLNNTDLARRLLEHYKTPANIDVWLAGIAEPFVPGGRVGPLFSCLIGTQFQKIRLGDRLWWENRGVFTKRQRDSLITMSLARIICDNT-GLKKVPADPFRLKANKAEFVECSSIAEIDFTPW 730          
BLAST of Peroxidasin vs. Ensembl Sea Lamprey
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 749.584 bits (1934), Expect = 0.000e+0
Identity = 390/914 (42.67%), Postives = 549/914 (60.07%), Query Frame = 1
Query:  814 APKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNS--LYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKL--RDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLD-FTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP-CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            AP+FI  P+D  V  G  +   C+ +      + W    +    +       +  L I  V    +G + C A N  G   A+ +L + P   P     P+ I+ + G  V  +C A G P P + W     + V +   GK+ V     +         +GRY C A +  G A  S ++++            ++ +  R++  +  +   ++ A   ++ A   T   L  R P+   S SD+ +LFR P     +E A+A +++E+ L      L +  V   LT     T + +  L++P  L +I+ LSGC       +CS  +CFH+KYR+ DG CNNL +P  G++L+PF RL+KP YENG+N P G+T     +G+  P  RLVS+ ++    +TPD   + ++MQWGQFLDHDLD T    S SRFSDG  C   C ND PCFPI  PP D R +   C+ F+RS   CGSG +S+++  +H REQ+NQ+TS++D SNVY S   E+ +LRDL    G LR G V  S K LLPF      +C  D  ++ VPCF AGD R+NE LGL  MHT+W REHNR++ EL  LN HW+GD +Y+E+RK+VGA++QH+TY  WLP +LG  G KRLG Y GY+  V+  I + FATAA RFGHTLINP+LYRLD++F+ IP+GNLPLH+AFF+P R++ +GGIDP+LRG+FA+  K     +++N EL E+LF MAH VALDL A NIQRGRDHG+  YN +R FC +  A  F+D   EI +  IREK+R++YG P N+DLF   ++E+ V G  +GPTL CLL+ QF+RLRDGDRFWYE+   F PAQL+Q++Q +LAR+LCDN D+I RVQR+VF +A+    ++ C +IPR++L  W++C +  R
Sbjct:  369 APQFILAPEDQVVTEGHTVDLHCEAQGRPLPVIAWTKAGSQLPSDRRLTVLSSGTLRIARVALHDQGQFECQAVNVVGVRRAATQLTVLPRVTPVFSVTPSDITTDSGRDVRIACSAQGEPQPSLMW---AKDGVHITESGKFHVSAEGYLEIRDAGPADQGRYECIARNSIGHASTSMLLSVTAFTRR-----AAAPVAERSRSGDSFVERSVQQAIHSVDSAINSTRRALFGRQPH---SPSDLLALFRYPRDPYTVEQARAGEIFERTLQ-----LIQEHVGNGLTVDANGTSEWYNDLVSPRYLNLIANLSGCTAHRRSDNCSD-ICFHQKYRTHDGTCNNLQHPMWGASLTPFERLLKPVYENGLNRPRGFTPEAPVNGFPLPQPRLVSTAMIGTESVTPDDRYTHILMQWGQFLDHDLDLTVAALSQSRFSDGRPCGAVCTNDPPCFPIAIPPDDRRARDARCMFFARSSPVCGSGMTSLLMNSVHPREQINQLTSYIDASNVYGSSERESRDLRDLAGRRGSLRRGLVQRSGKALLPFATGPPTECMRDENESPVPCFLAGDQRSNEQLGLTAMHTLWFREHNRVAAELLRLNPHWDGDAVYHEARKVVGALVQHVTYAHWLPKILGEVGTKRLGDYRGYDPNVNVGIFNAFATAAFRFGHTLINPVLYRLDDSFQPIPQGNLPLHRAFFSPYRIVNEGGIDPLLRGMFAVPGKMRVPSELLNTELTERLFFMAHTVALDLAATNIQRGRDHGIPPYNDYRVFCNLTSARDFEDLRNEIRNPHIREKLRRLYGTPQNIDLFPALMVEELVPGTRLGPTLLCLLLTQFQRLRDGDRFWYENPGVFTPAQLTQLRQASLARVLCDNGDSIERVQRDVFAVAEFPHGYVGCQDIPRVDLRLWQDCCEDCR 1265          

HSP 2 Score: 83.5741 bits (205), Expect = 2.450e-16
Identity = 93/388 (23.97%), Postives = 149/388 (38.40%), Query Frame = 1
Query:  334 TYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXX-----------------------ANNRLKTLPI-SLEKLINVKRLELYGNMLYCGCELRYFAGNLRRI---GLDFQKSQCQSPMNVKNQFLEEVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQW----LFIKEVHEFHEGIYICTASNNKGSISASA---KLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEE 1392
            +Y  L  N I +I    FK+ K+L  + L+ N I  +   A      L+ LYL  N I+ +    F       +L                           NNRL  +   +  +L +++RL L  N L C CEL + A  LR     G     + C+ P  ++ + +  +   E    S       P+    P D  V  G+ +   C+ E   +  + W    N+        RN      L I++     +G Y C A N  G + A     +    P    ++++ P       G  V   C A G+P P ++W    S Q  L  + ++ +     L +E     + EGRY C+AS+   S + SA I L++S  +  L  E
Sbjct:    2 SYRDLRFNRIREIPPGAFKKLKNLNTLLLNNNHIKRIPRRAFEDLESLKYLYLYKNEIQSIDRHAFKGLVSLEQLYIHFNHIEVLEPNTFVDLPKLERLFLHNNRLSRIATGTFTQLSSLRRLRLDSNRLVCDCELVWLAELLRAFAGSGGTLAAATCEHPRRLQGRSVSSITAQEFHCES-------PRITSEPHDVDVTPGNTVYLRCRAEGNPKPAIIWLHNSNEIAMAEDERRNLLQDGTLMIRDTRHTDQGTYQCMARNVAGEVKAPEVVLRYFDVPAPPTFVIQ-PHDTEVLVGESVTLECSAGGHPAPRVSWTRDDSEQ--LPADPRFSVTASGGLHVERAGPGD-EGRYTCHASNNQDSIRASATI-LLKSAPQFILAPE 377          
BLAST of Peroxidasin vs. Ensembl Sea Lamprey
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 368/868 (42.40%), Postives = 520/868 (59.91%), Query Frame = 1
Query: 1087 PYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILREN-KVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQ---RPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARI-LCDNSDNIS----RVQRNVFFMAKSKLEFIDCSNIPRLN-LIPWKECYDPSRLTPEDQVPGLSPS-RSRRSTNEF---QDQNCKSKTNQCSS 3642
            P     P  +++  G  V+  C A G P P ITW     + V+L   GK+ +  +  L I ++  ++ +GRY C A +  G A  + ++++               +P  N+  +  +   I++A   ++ A   T  +L D N  R+ +D+ +LFR P     +E A+A +++E+ L  +   +R   KV +N  TAY     +  L++P  L +I+ LSGC       +CS  +CFH++YR+ DG CNNL +P  G++L+ F RL+KP YENG + P G     L++G+  P  R++S+ L+    +TPD   S ++MQWGQFLDHD+D T    S +RFSDG  C+E C +D PCFPI  PP DPRV+     C+ F RS   CGSG +S+++  +  REQ+NQ+TS++D SNVY S   E+ E+RDL    G L+ G +  S K LLPF      +C  D  ++ +PCF AGD R NE + L  +HT+W+REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITY  WLP +LG  G+KR+G Y GY+  V+  I + FATAA RFGHTLINP+L+RL+ENF+ IPEG+L L +AFF+P RV+ +GGIDP+LRGLF +  K     +++N EL EKLF MAH VALDL A+NIQRGRDH +  YN +R FC +  A  F+    EI + ++REK+R++YG P N+DL+   + E  +    VGP+L CL + QF RLRDGDRFWYES   F PAQL+QIKQ +LAR+ LC    NI      + R + F+  + L      ++P +N    WK      R     Q   +S   R+RRST EF   +DQ  + K  + SS
Sbjct:    3 PVFTTSPTDVASVAGRDVQILCSAQGEPTPIITW---SKDGVQLTESGKFHLTSEGFLTIRDVGPAD-QGRYECIARNSIGHASTNMLLSV--------------HVPEGNRTGDSFVESSIQEAIFSVDSAINSTRRELFDRN-PRTPNDLLALFRYPRDPFTVERARAGEIFERTLQIIQEHVRGGLKVDMN-GTAYN--YHYNNLVSPYYLDLIANLSGCTAHRHVPNCSD-ICFHRRYRTQDGTCNNLQHPMWGASLTAFERLLKPVYENGFSAPRGLGGAALHNGHQLPLPRVISTTLVGTETVTPDDRYSHLLMQWGQFLDHDMDLTVAALSQARFSDGRPCSEACTDDPPCFPIAVPPDDPRVRGGGARCMFFIRSSPVCGSGMTSLLMNSVFPREQINQLTSYIDASNVYGSTERESAEVRDLASQRGLLKQGVIQRSGKSLLPFATGPPTECMRDERESPIPCFLAGDQRANEQVALTALHTLWLREHNRIATELLRLNPHWDGDTIYHEARKIVGAQMQHITYAHWLPKILGDVGMKRMGDYRGYDPNVNGGIFNSFATAAFRFGHTLINPVLHRLNENFQPIPEGHLSLRQAFFSPYRVVNEGGIDPLLRGLFGVAGKMRVPAELLNLELTEKLFHMAHTVALDLAAMNIQRGRDHAIPPYNDFRVFCNLTAAADFEHLRNEIKNPDVREKLRRLYGTPLNIDLWPALIAEDIIPSTRVGPSLMCLFLTQFSRLRDGDRFWYESPGVFTPAQLTQIKQASLARVLLCGKMKNIGINTKSLSRLINFIHGNFLH----PHMPPVNPAATWKSWVSDCRT--RGQFRAISGHFRTRRST-EFSFPEDQPSRRKQKRASS 840          
BLAST of Peroxidasin vs. Ensembl Sea Lamprey
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 544.273 bits (1401), Expect = 9.004e-180
Identity = 294/650 (45.23%), Postives = 398/650 (61.23%), Query Frame = 1
Query: 1690 FTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHG---YSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP----------------CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVG-PVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGL----LVMHTIWMREHNRLSD----------ELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIK-RLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQ----VYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDR-FWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKEC 3519
            +  L++P  L +I+ LSGC        CS   CFH++YR++DG CNNL +P  G++L+ F RL++P YENG N P G  A         +  P+ R VS+ L+   KITPD   + M+MQWGQFLDHD+D T V  S +RFSDG  C   C +D PCFPI   P DPR  R                 C+ F RS   CGSG +S+++  +  REQ+NQ+TS++DGSNVY S   EA ++RD +   G LR G  V  + K LLPF      +   D  ++ +PCFK GD R+NE LGL    +  H +  R+H  +S            LR LN HW+ D IY+ESRKIVGA MQHITY  WLP VLG++ ++  L  Y GY+  V+S I + FATAA RFGHTLINP+L RL+E+F+ IPEG+LPLH+AFF+P R++ +GGIDP+LRGLFA  +K     +++N EL EKLF MAH VALDL ++N+QRGR+HGL SY ++REFC +  A  F+  SGEI    +REK+R+    ++  P N     GA+    +     G     L  +QF+RLRDGDR FWYE+   F PAQL+QI Q +L+R+LCDN D I+ V  + F ++     ++ C  +P ++L  W++C
Sbjct:    3 YNDLVSPRYLELIANLSGCTAHRRAPSCSDA-CFHQRYRTVDGSCNNLQHPMWGASLTAFARLVEPAYENGFNEPRGGGASGRGRPRRGFPLPTPRRVSAELVGTEKITPDERHTHMLMQWGQFLDHDMDLTVVSPSQARFSDGEPCARACTDDPPCFPIELLPDDPRGGRRGGGGGGAAAAAAAAGRCMFFVRSSPVCGSGATSLLMSSVLPREQINQLTSYIDGSNVYGSSEREAADVRDRSSRRGLLRRGIAVGAAGKHLLPFATGPPTEHMRDERESPIPCFKKGDQRSNEQLGLTSPRVSSHPLVRRDHALVSSPPPPPASTLVRLRQLNPHWDSDTIYHESRKIVGAQMQHITYAHWLPKVLGADAMRSELRPYAGYDPSVNSAIFNSFATAAFRFGHTLINPVLLRLNESFQPIPEGHLPLHRAFFSPFRLVNEGGIDPLLRGLFATPAKKRVPSELLNLELTEKLFHMAHSVALDLASMNVQRGREHGLPSYAAYREFCNLTAAGDFEGLSGEIRDPVVREKLRKCTHGLFFLPENEKCAGGAIARWPIGSTSWGAGRQXLFTEQFRRLRDGDRLFWYENPGVFSPAQLTQIHQSSLSRVLCDNGDAITLVPPDAFAVSTYPQGYVACGTLPHVDLRMWQDC 651          
BLAST of Peroxidasin vs. Ensembl Sea Lamprey
Match: duox (dual oxidase [Source:ZFIN;Acc:ZDB-GENE-091117-14])

HSP 1 Score: 186.422 bits (472), Expect = 7.381e-48
Identity = 159/565 (28.14%), Postives = 269/565 (47.61%), Query Frame = 1
Query: 1813 DGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDP-NLSAMVMQWGQ-FLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRV---GPVTPSNKRLLPFNIRGQVDCQIDPAKA----HVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKA------FFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSS--EIREKMRQVY-GHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHD--QFEPAQLSQIKQVTLARIL-CDNSDNISRVQRNVFF 3444
            DG  NNL N   GS  S   RL    + +G+         +++   + P+AR +SS ++R     P   N + + + +GQ  +D  +D   V       +  +  N+T  ++SP + +L        QR     S+   + GS  ++        R  VN++TS+LDGS +Y         LR  T+D G L+    G +   + R L       +D      KA    H   ++ G+ R NE+  L  + T+W+R HN L++++R  N   +  +++  +RK V A+ Q+I    WLP +LG    K + +Y GY   V+ +IS  F  AAMRFGHT++ P +Y+ D++    P      + A      ++  +       +D  + G+      A + D V+  +L++ ++       LDL A+NIQRGRDHGL SY + R+   +     ++D +  +     E+  +   VY G    ++L+ G +LE +   G  GP  S +L+DQF+R+RDGDRFW+E+ +   F  + +  +++   + +L      N   +Q  VFF
Sbjct:   36 DGWYNNLDNIHWGSTGSKLLRLAPASFADGVY--------QMWDNPTVPNARRLSSSVMRGESGLPSALNRTVLAVFFGQHIVDEIVDTRQVGCPAEFLNIPIPWNDTAFSNSP-YHVLP------FQR-----SQWYKSTGSAPNNP-------RMPVNKVTSWLDGSAIYGCSRSWCHALR--TFDRGMLKSSENGSLPAVSDRSLRL-----IDAPSPSYKAGSSGHSNLYEFGNSRGNESPFLKAIGTVWLRYHNHLAEKMRQENPEMSDKELFINARKWVVAVYQNIVLYEWLPAMLG----KNMAEYKGYKPHVNPSISVEFQAAAMRFGHTMVPPGVYKRDDSCNFKPSDPKSQYNASRMCNNYWTKEVFRSGHEVDEFVLGM--ASQIAEQEDHVIVEDLLDSMYGPMKASRLDLMAINIQRGRDHGLPSYVNMRKAMNLDPITKWEDINPTLSQKNPEMESRSALVYNGDISRLELWPGGLLECQ---GGPGPLFSRILVDQFERIRDGDRFWFENTNNGMFTKSDVEAVRRTKFSSVLQAVMRVNNRTIQDEVFF 557          
BLAST of Peroxidasin vs. Ensembl Sea Lamprey
Match: duox (dual oxidase [Source:ZFIN;Acc:ZDB-GENE-091117-14])

HSP 1 Score: 176.022 bits (445), Expect = 1.019e-44
Identity = 157/563 (27.89%), Postives = 265/563 (47.07%), Query Frame = 1
Query: 1813 DGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDP-NLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP---CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAG---------DHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDE--NFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHP-GNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQ--FEPAQLSQIKQVTLARILCDNSD-NISRVQRNVFF 3444
            DG  NNL+N   GSA S   RL    + +G+         +++   + P+AR +SS ++R     P   N + + + +GQ   H +D    +  ++R +   GC       +  F I  P  DP         + F RS     +G S+      + R  VN++TS+LDGS +Y         LR  T+D G +R      S++  LP  + G     ID   A  P ++ G         + R NEN  L  + T+W+R HN  + ++   ++ W+ + ++  +RK V  + Q+I    WLP +L     + + +Y GY   V   I+  F +AAM+F  T++ P +Y  +   +F  +    L  H     P +   D  +D I+ G+ +    A + D ++  +L++K++        DL AL IQ+GRDHG  +YN  R    M     ++DF+      +I++  R V+     ++D++ G +LE +   G  GP  S +L+DQF+R+RDGDRFW+E+ +   F   ++  +     + +L    D + S +Q  VFF
Sbjct:   13 DGWYNNLLNIDWGSAGSKLLRLAPASFADGVY--------QMWDEPAVPNARRLSSSVMRGESGLPSALNRTVLAVFFGQ---HIMD----EIMDTRRA---GC------PAEFFNIPIPAEDPAFSNSPYKVLPFQRSQWDKTTGASTN-----NPRTPVNKVTSWLDGSAIYGPSRSWCQALR--TFDRGMMR-----SSDEESLP-PVSGHSLQLID---APSPSYETGSSTNKTVYGNPRGNENPFLKALGTVWLRYHNFWAAKIHSEHSDWSDEDVFLNARKWVIGVYQNIVLYEWLPAMLNGSTFQ-VSEYKGYKPHVHPGIAVEFESAAMKFHQTMMPPGVYSRNATCSFNQVNASRLCNHFWTNMPFKSGRD--VDEIIMGMSS--QIAEREDHIIVEDLLDKMYGPLKATRSDLMALTIQQGRDHGAPTYNDMRRALHMTPIAEWEDFNHTNAQVKIQKGERAVHDKALSSIDVYVGGLLECQ---GGPGPLFSRILVDQFERIRDGDRFWFENTNNGIFTEDEVRDVLATRFSHVLQTVMDIDNSSIQGEVFF 527          
BLAST of Peroxidasin vs. Ensembl Nematostella
Match: EDO39424 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA38])

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 334/610 (54.75%), Postives = 431/610 (70.66%), Query Frame = 1
Query: 1690 FTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP-CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRV-GPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVK-SDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPW 3510
            F  LL+P  + +I+ LSGC       +CS  LCFH  YRS DG CNNL +P  G +L+P  RL++P YENG N PIGW      +  ++PSARLVS+ L+ A  +T D   + M+MQWGQFLDHD+DFT    S SRFSDG  C  TC N SPCFPI  P GDPR++R  C+ F+RS + CG+G +S+   K+  REQ+NQIT+F+D SN+Y S   +A  LRDL   +G L+   P+ P+ K LLP +    V+C + P  + VPCF AGDHR NE +GLL MHT+WMREHNR++ EL  LN HW G+KIY+E+RKIVGA +QHITY+AW+P ++G +G+ RLG YPGYN   D TI + FATAA RFGH LI PI+ RL+ +F  IPEGN+PLHKAFF+P R++ +GGIDP+LRGLFA  SK+ + SD+++N EL E+LF MAH VALDLGALNIQRGRDH L  YNSWR+ C +  AE+FDD   EI S++IR ++ ++Y  P NVDL+   +LE    GG VG   SC+L++QFKRLRDGDRFWYE+   FEPAQL+QI+  +LAR+LCDN DNI  VQR+VF  A++   ++ C  IPR++L  W
Sbjct:   16 FFDLLSPAYIKMIANLSGCSAHRRMNNCSD-LCFHLNYRSADGTCNNLQHPMWGGSLTPLKRLLRPIYENGFNAPIGWI-----NKNARPSARLVSTELVAAANVTDDKKHTHMLMQWGQFLDHDMDFTVTSLSFSRFSDGADCTATCENQSPCFPIQIPDGDPRIRRARCMQFTRSSSVCGTGTTSVFFSKVTPREQMNQITAFIDASNIYGSSDEDARNLRDLR-SKGLLKTSAPIEPNGKPLLPPHRDTPVEC-LQPHDSPVPCFLAGDHRANEQIGLLSMHTLWMREHNRIASELSRLNPHWTGEKIYHEARKIVGAQLQHITYSAWIPKIVGPKGMARLGPYPGYNPNTDPTIINAFATAAFRFGHGLIKPIINRLNSSFLPIPEGNIPLHKAFFSPYRIVNEGGIDPVLRGLFAEASKSRENSDELVNTELTERLFEMAHAVALDLGALNIQRGRDHALPGYNSWRKLCNLSVAESFDDLKNEISSADIRARLEKLYKDPSNVDLWLAGLLEDLEPGGQVGKVFSCILVEQFKRLRDGDRFWYENPSTFEPAQLTQIRMSSLARVLCDNGDNIQLVQRDVFLRAETHGGYVSCEAIPRMDLRMW 617          
BLAST of Peroxidasin vs. Ensembl Nematostella
Match: EDO42052 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J2])

HSP 1 Score: 395.586 bits (1015), Expect = 2.181e-124
Identity = 235/579 (40.59%), Postives = 333/579 (57.51%), Query Frame = 1
Query: 1801 YRSIDGKCNNLINPRRGSALSPFYRLMKPEY--ENGINTPIGWTAGKLYHGYSKPSARLVSSRL-LRAHKITP-DPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVN-DSPCFPILTPPGDPRVQRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAH-EVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVY-GHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKE 3516
            YR++DG CNNL NP  GSA  PF R+  P Y  +N ++ P+G+         S PS   +S    + + +  P +   S M+MQWGQFLDHD+ FT  ++  ++      C+ +  + +SPCFPI+ P GD      C  F+RS A C +   ++       REQ+N +TSF+DGS +Y S       LR+    +G LR      S+  LLP+ I+  +   ++  +    CF AGD R NE + L  MHT+W+REHNR++ +L  LN HW+ D IY E+RKIVGA +QHITY  +LP +LG + I    QY GY + V+ TI +VFATAA RFGH+ + P   RL+ NF+ I   ++PL  AFF  +++++  GI+P L GL A  S+ V  D+ + A L + LF     +   DL ALNIQRGRDHGL  Y  WR  C +  AE F++   EI     R+ + +VY G     DL+   + E  V G  VGPT  C+L  QF+RLRDGDRFWYE++  F   QL +IK+++L+R++CDN   I  VQR+ F    S    + C+ I  ++L  WK+
Sbjct:    2 YRTMDGTCNNLDNPLWGSAPVPFSRMSDPVYYDDNRLSDPVGFPDQPF--APSLPSPHFISKEFFIHSRRAKPGESGYSHMLMQWGQFLDHDITFT-AESEGAQKCFLPNCDGSSEDYESPCFPIMYPNGDG-----CTMFTRSAAACQNDDKNV-----RPREQLNTVTSFIDGSQIYGSSLATMVNLRNYISKKGYLRT-----SSPDLLPY-IKTTLKPPLNLCQIFGGCFDAGDFRVNEQVALSSMHTMWVREHNRIARQLYELNRHWDDDTIYQEARKIVGAELQHITYTEFLPKILGPDAIP---QYTGYRN-VNPTIMNVFATAAFRFGHSTVRPSFSRLNANFDPIGP-DVPLIDAFFN-NKLVQSTGIEPFLLGLLANFSQDV--DRELAAGLTKHLFQQPESQHGFDLAALNIQRGRDHGLPGYGVWRRECNLTHAEIFEETRDEIRDPVTRQILDRVYNGSVEFADLWVSGLAENPVKGASVGPTFLCILRSQFRRLRDGDRFWYENNGVFGKEQLEEIKKISLSRVMCDNLPGIVSVQRDAFRAPSSSDLRVACARISGIDLTKWKD 553          
BLAST of Peroxidasin vs. Ensembl Nematostella
Match: EDO30120 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1P5])

HSP 1 Score: 360.918 bits (925), Expect = 1.573e-111
Identity = 221/582 (37.97%), Postives = 317/582 (54.47%), Query Frame = 1
Query: 1801 YRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP---CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSE-----GIKRLGQ--YPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYE--SHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPW 3510
            YR+I G CNNL     G+A +PF R+ +P Y + ++ P     G         +AR VS  L +  K  P   +S M M WGQF+DHD+               + C   C     CF I  P  DP        CI   R++      Q  ++      R+QVN  +SF+DGS VY  DP++  +LRD +     LR+        +LLP   +G+  C+    K   PCF AGD R NEN GL  MHTI+ REHNR++ EL+ LN HW+ DK++ E+RKIVGA +QHITYN +LP++          +K L    Y  Y+  V  +I + FA AA RFGH++I  +  R  E ++ I   N+      F P  +    G+D ++RGL    ++ V  D   +  + E+L  +  +  +DL +LNIQRGR+HGL  YN++R+ C +++A +F  F  EI SS I +K+R+VY H  +VDLFAG ++E  V GG +GPT +CL+ +QF RLR GDRFWYE      F   QL  I++++LARI+CDN DN+ ++Q     +   + +   CS I R++L PW
Sbjct:    4 YRTITGVCNNLRYKNWGAANTPFTRVARPAYADMMSKPRAAVGGG-----QLTNARKVSFTLFQ-DKDRPSKRMSHMAMIWGQFIDHDITHGA--------QPNINCENKCGLQGECFGIAVPKDDPHFWAKGVRCIQLKRNVPINIRKQGKLV------RQQVNTKSSFIDGSMVYDDDPVKFEKLRDPS-KRWLLRLKDSPAGGAKLLPPAAKGEF-CRSSDVKRR-PCFMAGDGRVNENPGLSSMHTIFAREHNRIATELKKLNRHWSPDKVFQEARKIVGAQIQHITYNEFLPLIFNETTLIDFDLKLLKPHFYNRYHGRVHPSIFNSFAGAAFRFGHSMIRNVAARFKELYQPINSVNM---NRTFDPLPLYAKKGVDAMMRGLATDPAQQV--DAHFSKFVQEQL--VLPDGMVDLVSLNIQRGREHGLPGYNTFRKLCRLRRASSFLHFRREISSSNI-QKLRKVYKHVDDVDLFAGGIMEIPVKGGSLGPTFTCLVANQFARLRRGDRFWYERPGRTGFTWRQLQSIRKISLARIICDNGDNVRQIQPRALNLRDKRNKLNPCSKISRMSLNPW 554          
BLAST of Peroxidasin vs. Ensembl Nematostella
Match: EDO41978 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2S8])

HSP 1 Score: 306.99 bits (785), Expect = 8.955e-93
Identity = 197/514 (38.33%), Postives = 273/514 (53.11%), Query Frame = 1
Query: 1798 KYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQR---PCIGFSRSIATC-GSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEG-------IKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLR 3306
            +YRSI G CNN  N   G+A SPF R+    Y +G++ P     G        P+AR VS  + +     P   +S M + +GQFLDHD+       S+    D + C  TC     C  I  P  DP        CI   R +     SG  S        REQ+N  +SF+DGS +Y   P   +++R     E  L+V P     K LLP    G   C+  P    +PCF +GD R NEN GLL MHTI++REHNR+S EL+ LN HW  DK+Y E+RKIV A +QHITYN +LP +L +         +++ G Y  YN  V+ +I + FA+AA RFGH+L+  I +R      TI      L    + P  +   GG+D ILRGL    S+  ++D      + E+L     ++A DL A+NIQRGR+HG+  YN++RE CG++   +F +   EI +S I   +R VY H  ++DLF G ++E+ + GG++GPT SCLL  QF  LR
Sbjct:    1 RYRSISGICNNFFNKYWGAAFSPFARVANAAYADGMSAPRAAVGGG-----DLPNARKVSFTVFKEED-RPSTKVSYMSVAFGQFLDHDI-------SHGGQPD-INCTGTCGLQGECIGIPIPADDPHFPTKNVTCIEMRRDLPFIEPSGAVS------PQREQLNIKSSFIDGSQIYGDKPESFSDVR-YPGKEWLLQVQPNPTGGKCLLPPQHGGF--CR-SPHVQSMPCFLSGDMRTNENPGLLSMHTIFLREHNRISSELKKLNQHWTTDKLYLETRKIVIAELQHITYNEFLPTILDTRTRSRYGLVLRKRGFYKNYNAAVNPSIINAFASAAYRFGHSLVRNIAHRFGAENGTI------LMNRTWDPTPIYGKGGVDAILRGLSTDASQ--QADAFFAKAVHEQLVRHTGDLA-DLAAINIQRGREHGIPGYNTYREICGLRNVRSFSELLSEIPNSHI-VNLRNVYEHVDDIDLFVGGMMERPLPGGVLGPTFSCLLGKQFSNLR 480          
BLAST of Peroxidasin vs. Ensembl Nematostella
Match: EDO44810 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUU2])

HSP 1 Score: 277.33 bits (708), Expect = 8.772e-82
Identity = 188/529 (35.54%), Postives = 272/529 (51.42%), Query Frame = 1
Query: 1795 KKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAH-KITPDPNLSAMVMQWGQFLDHDLDF-TPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRPCIG-----FSRSIATCGSGQSSIILGKLHY--REQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGP-VTPSNKRLLPFNI-RGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGL---FAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHD 3339
            +++  ID   NN+ +P  G  + P  RL KP Y +G   P          G ++P  R +S+ +      +     L+   M +GQ + HD DF TP   +N   S+  G            PI  P GDP       G     F RS     +G       KLH   REQVN+IT+FLD S +Y S       LR + + + K + G  +TP+ K++   N+  G  D  +           +GD+R N   GL+ +HT+W REHN + DE+R      + + ++  +R +  A  Q I +  +LP V+GSE   RLG+Y GYN  +   I + F+TAA RFGH+ I   ++RL+EN+E   +G+L L  A+F P RV+++GGI+P++RG+   FA       +D V N      LF   + + LDL +L IQRGRDHGLA YN+ RE  G+ +  +F     EI   E   K  +VY    +VDL+ G + E+ V GG VG T + ++  QFK LRDGDRFWYE+ D
Sbjct:    3 QRFPRIDAVGNNVHHPNLGKPMMPLLRLAKPAYADGFEEP---------SGQARPGPRAISNAIFDQRVDVFSKEGLNEFHMHFGQLVAHDTDFATPY--ANFLTSENFGI-----------PI--PAGDPWFDPHGTGTQMMRFRRSAKLQTTG-------KLHGKPREQVNKITAFLDLSFLYGSQAERTQMLRSMKHGKLKHQEGEMITPNTKQVPNLNLLNGPRDKML----------VSGDNRVNVQPGLIALHTLWSREHNHICDEIRARTPDMDDETLFQHARALTRAKWQKIVWEEYLPTVIGSEEFARLGKYQGYNSSIHVGIFNEFSTAAFRFGHSQIGNTMHRLNENWEMAEQGHLSLRDAYFNPGRVIQEGGIEPLIRGMLKQFAQNVDTKFTDAVRNF-----LFG-TNTMGLDLVSLGIQRGRDHGLADYNAVREAIGLPRRASF----AEITPDENTLKKFEVYPSVDDVDLWVGGLAEEHVEGGCVGETFARIIAMQFKVLRDGDRFWYENPD 480          
BLAST of Peroxidasin vs. Ensembl Medaka
Match: pxdn (peroxidasin [Source:NCBI gene;Acc:101162089])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 391/923 (42.36%), Postives = 550/923 (59.59%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEET-LDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP---CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            + +F   +  P+F   PQD  V     + F C+        + W    +    +   +   +  L I  V    EG Y C A +  G++ AS +L++     P     P  ++ E G  V+  CRA G P P +TW+    + V++   GK+ +     +      +   GRY C A +  G      V+T+               +P+ ++  +  +   I+ A   ++ A + T  +L D  + R+  ++ +LFR P     +E A+A +++E+ L     +L +N V   L      T   +  L++P  L +I+ LSGC       +CS  +CFH+KYRS DG CNNL +P  G++L+ F RL+K  Y+NG N P G T  +L +GY  P  RLVS+ ++    ITPD   + M+MQWGQFLDHDLD T V  S SRFSDG  C + C ND PCFPI  PP D R  R    C+ F RS   CGSG +S+++  ++ REQ+NQITS++D SNVY S   E+ E+RDL    G LR G +  + K LLPF+     +C  D  ++ +PCF AGDHR NE L L  MHT+W REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITY+ WLP +LG  G+K LG Y  Y+  V++ I + FATAA RFGHTLINPILYRL+E+F+ IP+G++ LHKAFF+P R++ +GGIDP+LRGLF +  K   S Q++N EL E+LF+MAH VALDL A+N+QRGRDHG+  YN +R FC +  A+TFDD   EI +  IREK++++YG P N+DLF   + E  + G  +GPTL CLL  QFK +R+GDRFWYE+   F P+QL+Q+KQ +LAR+LCDN DNI+RVQ +VF +A+    F  C +IP ++L  W++C +  R
Sbjct:  421 ATAFIIVQATPQFTVTPQDQTVLESHTVEFPCEASGYPPPVIAWTRGGSALPLDRRHVVLSSGMLRITRVAAHDEGQYECQAVSPVGTVHASVQLRVEQRVTPVFTNAPRDLTVESGQDVQIPCRAQGQPPPVLTWI---KDGVQVTESGKFHISPEGFLEVRDAGTADAGRYECTARNPIGYQVAGMVLTVT--------------VPAVSREGDTFVSTSIEQAIRDVDSAIESTRRRLFD-GQPRTPGELLALFRYPRDPYTVEQARAGEIFEQTL-----LLIQNHVNRGLMVDTNGTAFRYNDLVSPRFLDMIANLSGCTAHRRINNCSD-ICFHQKYRSHDGTCNNLQHPMWGASLTAFERLLKSVYDNGFNLPRGAT-DRLQNGYRLPLPRLVSTTMIGTETITPDDRYTHMLMQWGQFLDHDLDSTVVALSQSRFSDGQLCAQVCTNDPPCFPIQFPPNDQRQLRTGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQITSYIDASNVYGSSRHESEEIRDLASQRGLLRQGIIQRTGKPLLPFSPGPPTECMRDENESPIPCFLAGDHRANEQLALTAMHTVWFREHNRIATELLRLNPHWDGDTIYHEARKIVGAQMQHITYSHWLPKILGEVGMKMLGPYKSYDPNVNAGIFNAFATAAFRFGHTLINPILYRLNEHFQPIPQGHISLHKAFFSPFRIVNEGGIDPLLRGLFGVPGKMRVSTQLLNTELTERLFSMAHAVALDLAAMNVQRGRDHGIPPYNDYRTFCNLSSAQTFDDLKNEIKNPIIREKLQRLYGTPQNIDLFPALMAEDIIPGSRLGPTLMCLLTTQFKLVRNGDRFWYENPGVFTPSQLTQLKQASLARVLCDNGDNITRVQSDVFMVAELPHGFGSCDDIPHIDLRMWQDCCEDCR 1318          

HSP 2 Score: 109.768 bits (273), Expect = 1.176e-23
Identity = 102/408 (25.00%), Postives = 172/408 (42.16%), Query Frame = 1
Query:  244 CLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSIS------------------------KIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLR---RIGLDFQKSQCQSPMNVKNQFLEEVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISAS-AKLKI--APNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            C  +C C   TV C     + +P + +   T L L  N I                         +I    F++ ++L ++ L  N+I  ++  A  G + LE LYL  N IE L  + FS      +L    N   + +P +   L  +KRL L  N L C CE+ + A  L+     G     + C  P  ++ + +  +   EL        EL P+    PQD  V +G+ + F C+ E   + ++ W    N      D+  N L   +  L I++  E  +G+Y C A N  G +  S   L+   AP +  ++++ P +     G  V   C A G P P ++  W K ++  L  + +  I     L I+N+ +++  G+Y C+AS+   +   +A I +
Sbjct:   34 CPSRCLCFRTTVRCMHLNLEAVPAV-SPLTTILDLRFNKIKDLQPASFSRLKNLNTLLLNNNQIRRISRGAFEDLENLKYLYLYKNEIQSIDRQAFKGLVSLEQLYLHFNNIESLEPESFSHLPKLERLFLHNNRITQLVPGTFSHLSAMKRLRLDSNALNCNCEVLWLADLLKLYAESGNAQAAATCDHPSRLQGRSVATLTAEEL------NCEL-PRITSEPQDVDVTLGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDSRLNLL--EDGTLMIQDTRETDQGVYQCMAKNVAGEVKTSQVTLRYFGAPTRPSFVIQ-PQNTEVLVGESVTLECSATGQPQPRVS--WTKGDRTPLPNDPRITITTSGGLYIQNVQQAD-GGQYTCFASNNVDTIHATAFIIV 427          
BLAST of Peroxidasin vs. Ensembl Medaka
Match: pxdn (peroxidasin [Source:NCBI gene;Acc:101162089])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 391/923 (42.36%), Postives = 550/923 (59.59%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEET-LDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP---CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            + +F   +  P+F   PQD  V     + F C+        + W    +    +   +   +  L I  V    EG Y C A +  G++ AS +L++     P     P  ++ E G  V+  CRA G P P +TW+    + V++   GK+ +     +      +   GRY C A +  G      V+T+               +P+ ++  +  +   I+ A   ++ A + T  +L D  + R+  ++ +LFR P     +E A+A +++E+ L     +L +N V   L      T   +  L++P  L +I+ LSGC       +CS  +CFH+KYRS DG CNNL +P  G++L+ F RL+K  Y+NG N P G T  +L +GY  P  RLVS+ ++    ITPD   + M+MQWGQFLDHDLD T V  S SRFSDG  C + C ND PCFPI  PP D R  R    C+ F RS   CGSG +S+++  ++ REQ+NQITS++D SNVY S   E+ E+RDL    G LR G +  + K LLPF+     +C  D  ++ +PCF AGDHR NE L L  MHT+W REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITY+ WLP +LG  G+K LG Y  Y+  V++ I + FATAA RFGHTLINPILYRL+E+F+ IP+G++ LHKAFF+P R++ +GGIDP+LRGLF +  K   S Q++N EL E+LF+MAH VALDL A+N+QRGRDHG+  YN +R FC +  A+TFDD   EI +  IREK++++YG P N+DLF   + E  + G  +GPTL CLL  QFK +R+GDRFWYE+   F P+QL+Q+KQ +LAR+LCDN DNI+RVQ +VF +A+    F  C +IP ++L  W++C +  R
Sbjct:  373 ATAFIIVQATPQFTVTPQDQTVLESHTVEFPCEASGYPPPVIAWTRGGSALPLDRRHVVLSSGMLRITRVAAHDEGQYECQAVSPVGTVHASVQLRVEQRVTPVFTNAPRDLTVESGQDVQIPCRAQGQPPPVLTWI---KDGVQVTESGKFHISPEGFLEVRDAGTADAGRYECTARNPIGYQVAGMVLTVT--------------VPAVSREGDTFVSTSIEQAIRDVDSAIESTRRRLFD-GQPRTPGELLALFRYPRDPYTVEQARAGEIFEQTL-----LLIQNHVNRGLMVDTNGTAFRYNDLVSPRFLDMIANLSGCTAHRRINNCSD-ICFHQKYRSHDGTCNNLQHPMWGASLTAFERLLKSVYDNGFNLPRGAT-DRLQNGYRLPLPRLVSTTMIGTETITPDDRYTHMLMQWGQFLDHDLDSTVVALSQSRFSDGQLCAQVCTNDPPCFPIQFPPNDQRQLRTGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQITSYIDASNVYGSSRHESEEIRDLASQRGLLRQGIIQRTGKPLLPFSPGPPTECMRDENESPIPCFLAGDHRANEQLALTAMHTVWFREHNRIATELLRLNPHWDGDTIYHEARKIVGAQMQHITYSHWLPKILGEVGMKMLGPYKSYDPNVNAGIFNAFATAAFRFGHTLINPILYRLNEHFQPIPQGHISLHKAFFSPFRIVNEGGIDPLLRGLFGVPGKMRVSTQLLNTELTERLFSMAHAVALDLAAMNVQRGRDHGIPPYNDYRTFCNLSSAQTFDDLKNEIKNPIIREKLQRLYGTPQNIDLFPALMAEDIIPGSRLGPTLMCLLTTQFKLVRNGDRFWYENPGVFTPSQLTQLKQASLARVLCDNGDNITRVQSDVFMVAELPHGFGSCDDIPHIDLRMWQDCCEDCR 1270          

HSP 2 Score: 95.5153 bits (236), Expect = 2.574e-19
Identity = 95/384 (24.74%), Postives = 159/384 (41.41%), Query Frame = 1
Query:  244 CLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLR---RIGLDFQKSQCQSPMNVKNQFLEEVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISAS-AKLKI--APNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            C  +C C   TV C     + +P + +   T L L  N I  +    F   K+L  + L+ N+I  +   A      L+ L+L NN I  L                        +P +   L  +KRL L  N L C CE+ + A  L+     G     + C  P  ++ + +  +   EL        EL P+    PQD  V +G+ + F C+ E   + ++ W    N      D+  N L   +  L I++  E  +G+Y C A N  G +  S   L+   AP +  ++++ P +     G  V   C A G P P ++  W K ++  L  + +  I     L I+N+ +++  G+Y C+AS+   +   +A I +
Sbjct:   34 CPSRCLCFRTTVRCMHLNLEAVPAV-SPLTTILDLRFNKIKDLQPASFSRLKNLNTLLLNNNQIRRISRGAFEDLENLKYLFLHNNRITQL------------------------VPGTFSHLSAMKRLRLDSNALNCNCEVLWLADLLKLYAESGNAQAAATCDHPSRLQGRSVATLTAEEL------NCEL-PRITSEPQDVDVTLGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDSRLNLL--EDGTLMIQDTRETDQGVYQCMAKNVAGEVKTSQVTLRYFGAPTRPSFVIQ-PQNTEVLVGESVTLECSATGQPQPRVS--WTKGDRTPLPNDPRITITTSGGLYIQNVQQAD-GGQYTCFASNNVDTIHATAFIIV 379          
BLAST of Peroxidasin vs. Ensembl Medaka
Match: pxdn (peroxidasin [Source:NCBI gene;Acc:101162089])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 391/923 (42.36%), Postives = 550/923 (59.59%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFN--SLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQP-SLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEET-LDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRP---CIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSR 3534
            + +F   +  P+F   PQD  V     + F C+        + W    +    +   +   +  L I  V    EG Y C A +  G++ AS +L++     P     P  ++ E G  V+  CRA G P P +TW+    + V++   GK+ +     +      +   GRY C A +  G      V+T+               +P+ ++  +  +   I+ A   ++ A + T  +L D  + R+  ++ +LFR P     +E A+A +++E+ L     +L +N V   L      T   +  L++P  L +I+ LSGC       +CS  +CFH+KYRS DG CNNL +P  G++L+ F RL+K  Y+NG N P G T  +L +GY  P  RLVS+ ++    ITPD   + M+MQWGQFLDHDLD T V  S SRFSDG  C + C ND PCFPI  PP D R  R    C+ F RS   CGSG +S+++  ++ REQ+NQITS++D SNVY S   E+ E+RDL    G LR G +  + K LLPF+     +C  D  ++ +PCF AGDHR NE L L  MHT+W REHNR++ EL  LN HW+GD IY+E+RKIVGA MQHITY+ WLP +LG  G+K LG Y  Y+  V++ I + FATAA RFGHTLINPILYRL+E+F+ IP+G++ LHKAFF+P R++ +GGIDP+LRGLF +  K   S Q++N EL E+LF+MAH VALDL A+N+QRGRDHG+  YN +R FC +  A+TFDD   EI +  IREK++++YG P N+DLF   + E  + G  +GPTL CLL  QFK +R+GDRFWYE+   F P+QL+Q+KQ +LAR+LCDN DNI+RVQ +VF +A+    F  C +IP ++L  W++C +  R
Sbjct:  397 ATAFIIVQATPQFTVTPQDQTVLESHTVEFPCEASGYPPPVIAWTRGGSALPLDRRHVVLSSGMLRITRVAAHDEGQYECQAVSPVGTVHASVQLRVEQRVTPVFTNAPRDLTVESGQDVQIPCRAQGQPPPVLTWI---KDGVQVTESGKFHISPEGFLEVRDAGTADAGRYECTARNPIGYQVAGMVLTVT--------------VPAVSREGDTFVSTSIEQAIRDVDSAIESTRRRLFD-GQPRTPGELLALFRYPRDPYTVEQARAGEIFEQTL-----LLIQNHVNRGLMVDTNGTAFRYNDLVSPRFLDMIANLSGCTAHRRINNCSD-ICFHQKYRSHDGTCNNLQHPMWGASLTAFERLLKSVYDNGFNLPRGAT-DRLQNGYRLPLPRLVSTTMIGTETITPDDRYTHMLMQWGQFLDHDLDSTVVALSQSRFSDGQLCAQVCTNDPPCFPIQFPPNDQRQLRTGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQITSYIDASNVYGSSRHESEEIRDLASQRGLLRQGIIQRTGKPLLPFSPGPPTECMRDENESPIPCFLAGDHRANEQLALTAMHTVWFREHNRIATELLRLNPHWDGDTIYHEARKIVGAQMQHITYSHWLPKILGEVGMKMLGPYKSYDPNVNAGIFNAFATAAFRFGHTLINPILYRLNEHFQPIPQGHISLHKAFFSPFRIVNEGGIDPLLRGLFGVPGKMRVSTQLLNTELTERLFSMAHAVALDLAAMNVQRGRDHGIPPYNDYRTFCNLSSAQTFDDLKNEIKNPIIREKLQRLYGTPQNIDLFPALMAEDIIPGSRLGPTLMCLLTTQFKLVRNGDRFWYENPGVFTPSQLTQLKQASLARVLCDNGDNITRVQSDVFMVAELPHGFGSCDDIPHIDLRMWQDCCEDCR 1294          

HSP 2 Score: 103.605 bits (257), Expect = 8.366e-22
Identity = 100/384 (26.04%), Postives = 166/384 (43.23%), Query Frame = 1
Query:  244 CLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLR---RIGLDFQKSQCQSPMNVKNQFLEEVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFN------DTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISAS-AKLKI--APNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKY-IVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            C  +C C   TV C     + +P + +   T L L  N I  +    F   K+L  + L+ N+I  +   A      L+ LYL  N IE L  + FS      +L    N   + +P +   L  +KRL L  N L C CE+ + A  L+     G     + C  P  ++ + +  +   EL        EL P+    PQD  V +G+ + F C+ E   + ++ W    N      D+  N L   +  L I++  E  +G+Y C A N  G +  S   L+   AP +  ++++ P +     G  V   C A G P P ++  W K ++  L  + +  I     L I+N+ +++  G+Y C+AS+   +   +A I +
Sbjct:   34 CPSRCLCFRTTVRCMHLNLEAVPAV-SPLTTILDLRFNKIKDLQPASFSRLKNLNTLLLNNNQIRRISRGAFEDLENLKYLYLHFNNIESLEPESFSHLPKLERLFLHNNRITQLVPGTFSHLSAMKRLRLDSNALNCNCEVLWLADLLKLYAESGNAQAAATCDHPSRLQGRSVATLTAEEL------NCEL-PRITSEPQDVDVTLGNTVYFTCRAEGNPKPQIIWLRNNNALNMRDDSRLNLL--EDGTLMIQDTRETDQGVYQCMAKNVAGEVKTSQVTLRYFGAPTRPSFVIQ-PQNTEVLVGESVTLECSATGQPQPRVS--WTKGDRTPLPNDPRITITTSGGLYIQNVQQAD-GGQYTCFASNNVDTIHATAFIIV 403          
BLAST of Peroxidasin vs. Ensembl Medaka
Match: mpx (eosinophil peroxidase [Source:NCBI gene;Acc:101171684])

HSP 1 Score: 501.901 bits (1291), Expect = 3.577e-161
Identity = 276/715 (38.60%), Postives = 419/715 (58.60%), Query Frame = 1
Query: 1435 LYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQS------LFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHK--ITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRV-QRP--CIGFSRSIATCGSGQSSIILG-KLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKR-LLPFNIRGQVDCQI------DPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIK-RLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPE-GNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKE 3516
            L +  K+A++ ++ A+K + E+    + +R R+D+        L +QP        +++D  E+ L     +LRE   ++     Y  +L+ T LL+PE L  +++L+GC+       C Q L    KYR+    CNNL NPR G++ +PF R +  EY++GI+ P GW   + ++ +  P  R VS+ +L      +  D   + MV  +GQ+ DHDL FTP   S   FS+GL C+E+C    PC PI  PPGDPR+  RP  CI   RS   CG+G S+   G + + REQ+N +T+FLD   VY S+   A  LR+L+ D G +RV      N R LLPF+      C        D     VPCF AGD R +EN+ L  +HT+++REHNRL+  L+ LN HW+ + +Y E+RKI+GA  Q   +  +LP ++G + ++ +LG+YPGYN  +D +I++VFATAA RF H  I P+L RLD N    P+  ++PL++AFF P RV+ +GGIDP+LRGL    +K    D ++   L E+LF     +ALDLG+LN+QR RDHG+  YN+WR FCG+ + +     +  + ++++  ++ ++YG P N+D++ G V E  V GG VGP  +CL+  QF+R+R GDR WYE    F P+Q + ++ V+++RI+CDN+  I+ V  + + +  S    + CS+I  LNL  W+E
Sbjct:   30 LQQCFKEAKTIVDDAYKYSREE----SLKRVRTDVVKPHDALRLMKQPRGDTRSAVRSADYMEQTLR----LLRERVHRV-----YRRSLNATDLLSPEDLEKLAKLTGCEARVRLPQC-QILQNINKYRTATSICNNLNNPRLGASNTPFTRWLPAEYDDGISQPKGWNRNRTFNNFLLPLVRQVSNNILSTTDAGVVNDTEYTHMVTLFGQWNDHDLTFTPFSPSIRSFSNGLNCDESCEQSEPCTPIPIPPGDPRLPSRPDSCIPAFRSAPVCGTGYSAYNFGGEPNKREQINALTAFLDLGQVYGSEEKLALFLRNLSSDAGLMRVNTEFRDNGRELLPFHPMQVQMCATRRRITNDTNAKEVPCFIAGDGRVDENIALTSIHTLFVREHNRLARGLKNLNPHWDSETLYQEARKIMGAYTQTFVFRDYLPHIVGDDAMRNQLGRYPGYNPNIDPSIANVFATAAYRFAHLAIQPVLSRLDANNNEHPQFPSVPLYEAFFTPWRVVFEGGIDPLLRGLIIRPAKLNTQDHMLVNALRERLFQFVQHLALDLGSLNMQRSRDHGIPGYNAWRRFCGLSQPQNQAQLAQVLGNNDLARRLLELYGTPDNIDIWLGGVAEPFVRGGRVGPLFACLIATQFQRIRQGDRLWYEKPGVFTPSQRAALRSVSMSRIICDNT-GIAAVPMDAYRIVSSSNRLVRCSSIAGLNLAAWRE 729          
BLAST of Peroxidasin vs. Ensembl Medaka
Match: ENSORLT00000039781.1 (eosinophil peroxidase-like [Source:NCBI gene;Acc:110015551])

HSP 1 Score: 502.671 bits (1293), Expect = 2.333e-160
Identity = 267/710 (37.61%), Postives = 408/710 (57.46%), Query Frame = 1
Query: 1435 LYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRS--DIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRA--HKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQ---RPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKR-LLPFNIRGQVDCQI------DPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGI-KRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLP---LHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPW 3510
            + + + +A++ ++ A+  +  K  D  ++   S   +  L +QPS  + E  +A+D  +  L  L G L + +         + +++ T L+T E L +I++L+GC        C       K YR+    CNNL NPR GS+  PF R +  EYE+ + +P GWT+    + +  P  R VS+R+L      +  DP  S +V  +GQ+ DHDL FTP   S   F++ + C  +C    PCFPI  P  D R Q   + C+ FSRS   CGSG +  I G    R Q+N +TSF+D   VY SD  +A +LRDL+ +EG ++V P    N R LLPF       C+       DP    + CF AGD R+NEN+GL  +HT+ +REHN L+  L  LN +W+G+++Y E+RKI+G  MQ ITY  +L  +LG E + K+L  YPGY++ VD +I++VFATAA RF H ++ P ++RL+EN+E     + P   LH+  F P R+  +GG+DPILRGL    +K    + ++  EL  +LF  + ++A+DLG+LN+QRGRDHGL  YN WR FCG+ + +  ++ +  + ++++ +++  +YG   N+D++ G V E  V+GG VGP  +CL+  QFKR+R GDRFW+E++  F  AQ   ++  +LARI+CDN+  I+ V    F        +  C ++P  +L PW
Sbjct:   30 IVKAVAEAKANVDAAYTYSRRKSIDRVKRSGASPGSVIPLLKQPSGLSREAVRAADYMQNTLSLLRGALEKRQ---------KRSINATDLITVEDLNVIAKLTGCAAQIRPPSCKD---IPKSYRTAASSCNNLKNPRWGSSNIPFLRWLPAEYEDDLTSPKGWTSDLRVNYHLIPLVREVSNRILATANEDVESDPLYSHLVTIFGQWTDHDLTFTPHSPSIVSFNNNISCETSCARTEPCFPIEIPSNDERFQEDPKECLPFSRSAPACGSGNTGHIFGASTLRHQMNTLTSFIDAGQVYGSDEAKAQKLRDLSTEEGLMKVNPEFDDNGRALLPFTADNAKMCKTRANITKDPNARELECFFAGDDRSNENIGLASLHTLMVREHNHLARALANLNPNWDGNRLYQEARKIMGGYMQVITYRDYLRHILGPEVMSKQLSTYPGYDENVDPSIANVFATAAYRFAHLMVQPFIFRLNENYEN--HADYPTELLHRTMFTPWRIAFEGGLDPILRGLVGRPAKLNTQNHMLTEELRNRLFKFSVDLAMDLGSLNMQRGRDHGLPRYNKWRGFCGLSQPQNLEELATVLNNTDLAQRLLDLYGTADNIDVWLGGVAEPFVAGGRVGPLFACLISTQFKRIRQGDRFWWENNGVFTCAQRRSLRDASLARIICDNT-GITEVPNQPFQYRPRGSGYFQCKDLPAFDLKPW 724          
BLAST of Peroxidasin vs. Planmine SMEST
Match: SMESG000065495.1 (SMESG000065495.1)

HSP 1 Score: 2417.5 bits (6264), Expect = 0.000e+0
Identity = 1175/1180 (99.58%), Postives = 1179/1180 (99.92%), Query Frame = 1
Query:  172 MNFFIVIIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFXXXXXXXXXXXXANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAGNLRRIGLDFQKSQCQSPMNVKNQFLEEVKFNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSRLTPEDQVPGLSPSRSRRSTNEFQDQNCKSKTNQCSSNISNLEERIKSLEDKMLHLNQKN 3711
            MNFFIVIIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFSDHSDSLKLLSLANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFA NLRRIGLDFQKSQCQSPMNVKNQFLEEVKFNELCSNSF+ASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSR+KLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITY+AWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWR+FCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSRLTPEDQVPGLSPSRSRRSTNEFQDQNCKSKTNQCSSNISNLEERIKSLEDKMLHLNQKN
Sbjct:    1 MNFFIVIIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEIGNKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPIFLETLYLKNNLIEYLPEQIFSDHSDSLKLLSLANNRLKTLPISLEKLINVKRLELYGNMLYCGCELRYFAANLRRIGLDFQKSQCQSPMNVKNQFLEEVKFNELCSNSFQASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRDKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQRSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTAYEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGKCNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARLVSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGCNETCVNDSPCFPILTPPGDPRVQRPCIGFSRSIATCGSGQSSIILGKLHYREQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLLPFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLSDELRGLNNHWNGDKIYYESRKIVGAMMQHITYHAWLPIVLGSEGIKRLGQYPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLHKAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHEVALDLGALNIQRGRDHGLASYNSWRKFCGMKKAETFDDFSGEIVSSEIREKMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRFWYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFIDCSNIPRLNLIPWKECYDPSRLTPEDQVPGLSPSRSRRSTNEFQDQNCKSKTNQCSSNISNLEERIKSLEDKMLHLNQKN 1180          
BLAST of Peroxidasin vs. Planmine SMEST
Match: SMESG000064665.1 (SMESG000064665.1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.829e-10
Identity = 51/185 (27.57%), Postives = 78/185 (42.16%), Query Frame = 1
Query:  817 PKFIERPQDAYVAVGDKIRFACQVENINETKVEWH---FQFNDTTFNSLYWRNQW-LFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRL---ETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVI 1350
            P F   P+   V V   I F C V   +   ++W+      ND + +     N   + I  V     G Y+C A N+ G      KL +     P  +E P +I    G +V   C A G P P++   W  +NQ  L   +   + IV +N  +  +   S+  G+Y CYASS  G ++  A +
Sbjct:  186 PIFHILPKHLQVMVSSHILFPCLVIGDSPMFIQWYKLGSGKNDISLSRTALSNNCSMIINNVKLEDSGAYVCRARNSGGITEIIYKLSVI--SFPSFIETPENIRTTVGEKVALRCSASGVPAPKV--FWWHTNQYFLSDIDNNNRIIVFENGTLSISSVRSKDSGKYYCYASSFVGVSRSEATL 366          
BLAST of Peroxidasin vs. Planmine SMEST
Match: SMESG000018028.1 (SMESG000018028.1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.759e-9
Identity = 50/191 (26.18%), Postives = 82/191 (42.93%), Query Frame = 1
Query:  817 PKFIERPQDAYVAVGDKIRFACQVENINETKVEWHF--QFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITW-----LWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSK 1368
            P+F   P +  V V +   F C  +   +  + W    Q    +  +    N+ + I +V     G YIC ASN+ G + A AKL +     P  +E P +     G    F+CR  G P P I W      ++   +    +E   + +  +L I  +  S+  G+Y C ASS  G  + SA + +I ++
Sbjct:  214 PQFKIAPSNIEVKVNEAAVFPCVADGDPKPTIVWRRDNQKKIPSSRATLIDNKGMQISKVQLTDMGNYICHASNSAGHLEAYAKLSVV--STPGFIETPDNQKVRVGDTAIFNCRVTGSPQPTIIWSHNGDHFIADEENSRRSERIQVDKLGSLTINPVKISD-SGKYECKASSYIGKIQSSASLHVIDAQ 401          

HSP 2 Score: 55.8398 bits (133), Expect = 1.570e-7
Identity = 55/238 (23.11%), Postives = 99/238 (41.60%), Query Frame = 1
Query:  817 PKFIERPQDAYVAVGDKIRFACQVENINETKVEWH--------FQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKG-SISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCR-AHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEK 1500
            P   E P   +     ++   C  +      + W+        ++    T N L   N+ LF+  +    EG+Y C ASN  G +IS +A + IA   K  I  GP S +A  G  V   C+   G P P + W +   N + +    K I+   NL I+  T  +  GRY C A + +     ++ +  +R K +  +   + ++    K+    ++  + D   K  + +++  +K
Sbjct:   26 PIISEHPASTHGLSLQRVSLRCSAKGDPMPNIIWYKDGQVVESYRDKPATSNRLVKDNELLFM-HLDTQDEGVYYCNASNIHGWTISNNASVLIAFLNKDII--GPESKTASVGETVLMECKPPKGVPKPTVIWKF-NGNAIEVNKRIK-ILDNGNLRIDKATRKD-SGRYNCLAKNFADERDSTSALLTVRQKPQFKIAPSNIEV----KVNEAAVFPCVADGDPKPTIVWRRDNQK 253          

HSP 3 Score: 53.1434 bits (126), Expect = 1.121e-6
Identity = 43/185 (23.24%), Postives = 81/185 (43.78%), Query Frame = 1
Query:  820 KFIERPQDAYVAVGDKIRFACQV-ENINETKVEWHFQFNDTTFNSLY--WRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRS 1365
            K I  P+    +VG+ +   C+  + + +  V W F  N    N       N  L I +      G Y C A N      +++ L +   QKP     P++I  +      F C A G P P I  +W + NQ ++ +    ++    + I  +  +++ G Y+C+AS+ +G  +  A ++++ +
Sbjct:  123 KDIIGPESKTASVGETVLMECKPPKGVPKPTVIWKFNGNAIEVNKRIKILDNGNLRIDKATRKDSGRYNCLAKNFADERDSTSAL-LTVRQKPQFKIAPSNIEVKVNEAAVFPCVADGDPKPTI--VWRRDNQKKIPSSRATLIDNKGMQISKVQLTDM-GNYICHASNSAGHLEAYAKLSVVST 303          
BLAST of Peroxidasin vs. Planmine SMEST
Match: SMESG000021248.1 (SMESG000021248.1)

HSP 1 Score: 58.9214 bits (141), Expect = 2.866e-8
Identity = 50/201 (24.88%), Postives = 94/201 (46.77%), Query Frame = 1
Query:  787 SNSFEASELAPKFIERPQDA-YVAVGDKIRFACQVENINETKVEWHFQFNDTTFNSL-----YWRNQWLFIKEVHEFHEGIYICTASNNKG--SISASAKLKIAPNQ-KPYIVEGPASISAEKGSRVEFSCRA-HGYPVPEITWLWVKSNQVRL-ETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            S S +   ++P  IE P+ +  V VG+++   C VE     ++ W+   N+   +++     +   Q L I  V + H G+Y C A+N+ G   I  + ++ + P   +P   E    ++    + ++  C+   G P P ITW   + N + L + +  Y    + L I N  + E EG   C A +++G  +++  IT+
Sbjct: 2512 SKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLN----TVLQMQCKILEGIPQPVITW---ERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITV 2705          

HSP 2 Score: 58.5362 bits (140), Expect = 4.630e-8
Identity = 40/171 (23.39%), Postives = 71/171 (41.52%), Query Frame = 1
Query:  859 GDKIRFACQVENINETKVEWHFQFNDTTFNSLYWRNQW---LFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWL--WVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            GD+    C    + + K+ W F  +  T +     N+    L I  + +  +G ++C A+NN GS   S  L I     P I +   +I    G  +   C+  G+P P + WL        + +    +Y + ++N +I      E +  Y+C A +  G  + S  I +
Sbjct:  741 GDQQTVRCSANGVPQPKITWEFNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNNAGSSRKSFNLDIGFG--PRIKDFVTNIDGSYGENITIRCQVEGHPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRI 909          

HSP 3 Score: 53.9138 bits (128), Expect = 1.016e-6
Identity = 42/150 (28.00%), Postives = 66/150 (44.00%), Query Frame = 1
Query:  952 LYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKIAPNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEESSK 1401
            LY  +  L I +      GIY C ASN+ G   A  ++ +     P     P +ISA  G  +   C A GYP+P I+W   K+ ++      K +++  +L I  + + E  G Y C ASS  G      +   ++     +  +E SK
Sbjct: 2935 LYINDFNLIINQAKSKDTGIYQCIASNSAGE--AQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAAEGYPIPTISWY--KNKKLIKYDFVKSLIKNGSLRIIGV-QKEHSGVYFCVASSNQGEVHSQPIYLTVQIPGGWSAWQEWSK 3079          

HSP 4 Score: 52.373 bits (124), Expect = 2.885e-6
Identity = 55/215 (25.58%), Postives = 99/215 (46.05%), Query Frame = 1
Query:  796 FEASELAPKFIERPQDAYVAVGDK--IRFACQVENINET-KVEWHFQFNDTTFNSLYWRNQWLFIKEV------HEFHEGIYICTASNNKGSISASAKLKI--APNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLETEGKYI----VRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKNELNLNEES 1395
            F+ S  AP  I +   +   +G K  +   C + + N + K+EW+   N      +  R +    K +      +E   G Y C A+N   S S   ++ I  AP      +     I  ++G ++  +C+  G+P P   W W KS+ + L+     I    + KN+L+I  +  SE++G Y C  +++ GSAK+S  + ++ S   +  N++S
Sbjct: 1092 FKVSVKAPPQISKEGISDYEIGSKENVELNCIITSGNPSPKIEWYK--NGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKM---IKIYTKEGEKLTLNCKIDGFPTPTKKWSW-KSSILDLQRNPFGITNSPIDKNDLLITQM-RSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKS 1299          
BLAST of Peroxidasin vs. Planmine SMEST
Match: SMESG000005752.1 (SMESG000005752.1)

HSP 1 Score: 58.9214 bits (141), Expect = 3.573e-8
Identity = 57/213 (26.76%), Postives = 88/213 (41.31%), Query Frame = 1
Query:  805 SELAPKFI-ERPQDAYVAVGDKIRFACQVENINETKVEWHFQ------------FNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKI---------APNQK--PYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRL-ETEGKYIVRKNN----LVIENITESEVEGRYVCYASSLSGSAKVSAVITL 1356
            S   PKF+ E  +   V  GD ++   +V+      VEW+              F D    SLY       I E      G Y   A N  GS+ +SA L +          P  K  P I++ P S+      +  F  +  G PVPE++W     N + + E+E   I+  NN    L+I ++ E++  G Y   A ++ G A+ S  +T+
Sbjct: 5044 STYPPKFVRELEKSIQVKEGDSVKLLAEVDGYPTPVVEWYKNGIVIEKNPDYKLFRDGNVVSLY-------IHETFTDDTGEYNLIARNPFGSVKSSAHLTVTITPESADNVPQSKQIPRIIQEPKSVKLNLNKKAVFEAKVIGSPVPEVSWY---HNDIFIEESENVSIIYSNNEYTKLIINSVKETDA-GTYTVKAVNIVGEAQFSTSLTV 5245          
The following BLAST results are available for this feature:
BLAST of Peroxidasin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PXDN8.094e-2343.38peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966][more]
PXDNL1.035e-2039.74peroxidasin like [Source:HGNC Symbol;Acc:HGNC:2635... [more]
PXDNL0.000e+048.33peroxidasin like [Source:HGNC Symbol;Acc:HGNC:2635... [more]
EPX9.629e-17039.61eosinophil peroxidase [Source:HGNC Symbol;Acc:HGNC... [more]
MPO2.154e-16938.90myeloperoxidase [Source:HGNC Symbol;Acc:HGNC:7218][more]
back to top
BLAST of Peroxidasin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pxn-16.872e-1740.67Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;... [more]
pxn-20.000e+040.27PeroXidasiN (Drosophila peroxidase) homolog [Sour... [more]
skpo-32.362e-11934.92ShK domain and PerOxidase domain containing protei... [more]
skpo-32.362e-11934.92ShK domain and PerOxidase domain containing protei... [more]
skpo-23.110e-11935.30ShK domain and PerOxidase domain containing protei... [more]
back to top
BLAST of Peroxidasin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pxn4.975e-2441.02gene:FBgn0011828 transcript:FBtr0072954[more]
Pxn4.975e-2441.02gene:FBgn0011828 transcript:FBtr0072951[more]
Pxn4.975e-2441.02gene:FBgn0011828 transcript:FBtr0072952[more]
Pxn4.975e-2441.02gene:FBgn0011828 transcript:FBtr0072953[more]
CG102111.966e-10135.88gene:FBgn0032685 transcript:FBtr0343824[more]
back to top
BLAST of Peroxidasin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pxdn3.975e-2541.53peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
pxdn6.465e-2642.08peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
pxdn8.519e-2542.25peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
pxdn6.942e-2542.25peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
mpx1.113e-16939.75myeloid-specific peroxidase [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Peroxidasin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
polr1e2.330e-2242.41polymerase (RNA) I polypeptide E [Source:Xenbase;A... [more]
polr1e3.015e-2142.41polymerase (RNA) I polypeptide E [Source:Xenbase;A... [more]
polr1e5.026e-2342.41polymerase (RNA) I polypeptide E [Source:Xenbase;A... [more]
polr1e2.691e-1242.41polymerase (RNA) I polypeptide E [Source:Xenbase;A... [more]
polr1e2.695e-2242.41polymerase (RNA) I polypeptide E [Source:Xenbase;A... [more]
back to top
BLAST of Peroxidasin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pxdn4.006e-2643.38peroxidasin [Source:MGI Symbol;Acc:MGI:1916925][more]
Pxdn1.533e-1743.38peroxidasin [Source:MGI Symbol;Acc:MGI:1916925][more]
Epx3.471e-16839.48eosinophil peroxidase [Source:MGI Symbol;Acc:MGI:1... [more]
Mpo6.543e-16839.86myeloperoxidase [Source:MGI Symbol;Acc:MGI:97137][more]
Mpo6.543e-16839.86myeloperoxidase [Source:MGI Symbol;Acc:MGI:97137][more]
back to top
BLAST of Peroxidasin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3UQ28|PXDN_MOUSE2.802e-2543.38Peroxidasin homolog OS=Mus musculus OX=10090 GN=Px... [more]
sp|Q92626|PXDN_HUMAN3.887e-2243.38Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXD... [more]
sp|A4IGL7|PXDN_XENTR1.123e-2142.41Peroxidasin OS=Xenopus tropicalis OX=8364 GN=pxdn ... [more]
sp|Q9VZZ4|PXDN_DROME4.987e-2341.02Peroxidasin OS=Drosophila melanogaster OX=7227 GN=... [more]
sp|A8WQH2|PXDN1_CAEBR8.876e-1741.00Peroxidasin homolog OS=Caenorhabditis briggsae OX=... [more]
back to top
BLAST of Peroxidasin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068Y4S00.000e+043.52Peroxidasin OS=Echinococcus multilocularis OX=6211... [more]
A0A0R3X4X00.000e+043.54Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A158R8930.000e+042.23Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A068WWK60.000e+043.31Peroxidasin OS=Echinococcus granulosus OX=6210 GN=... [more]
A0A5K3FIH80.000e+044.26Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Peroxidasin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pxdn4.170e-2142.83peroxidasin [Source:NCBI gene;Acc:103028918][more]
pxdn6.119e-2342.83peroxidasin [Source:NCBI gene;Acc:103028918][more]
mpx2.579e-16339.82myeloid-specific peroxidase [Source:ZFIN;Acc:ZDB-G... [more]
mpx1.352e-15539.08myeloid-specific peroxidase [Source:ZFIN;Acc:ZDB-G... [more]
mpx2.267e-15539.08myeloid-specific peroxidase [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Peroxidasin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pxdn2.450e-1642.67peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
pxdn0.000e+042.40peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
pxdn9.004e-18045.23peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
duox7.381e-4828.14dual oxidase [Source:ZFIN;Acc:ZDB-GENE-091117-14][more]
duox1.019e-4427.89dual oxidase [Source:ZFIN;Acc:ZDB-GENE-091117-14][more]
back to top
BLAST of Peroxidasin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peroxidasin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO394240.000e+054.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420522.181e-12440.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301201.573e-11137.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419788.955e-9338.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448108.772e-8235.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peroxidasin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pxdn1.176e-2342.36peroxidasin [Source:NCBI gene;Acc:101162089][more]
pxdn2.574e-1942.36peroxidasin [Source:NCBI gene;Acc:101162089][more]
pxdn8.366e-2242.36peroxidasin [Source:NCBI gene;Acc:101162089][more]
mpx3.577e-16138.60eosinophil peroxidase [Source:NCBI gene;Acc:101171... [more]
ENSORLT00000039781.12.333e-16037.61eosinophil peroxidase-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Peroxidasin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065495.10.000e+099.58SMESG000065495.1[more]
SMESG000064665.12.829e-1027.57SMESG000064665.1[more]
SMESG000018028.12.759e-926.18SMESG000018028.1[more]
SMESG000021248.12.866e-824.88SMESG000021248.1[more]
SMESG000005752.13.573e-826.76SMESG000005752.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031201 ID=SMED30031201|Name=Peroxidasin|organism=Schmidtea mediterranea sexual|type=transcript|length=3771bp
TGTGAACATGCGTTATAATTGAAGGATTACGTAAATAAAGTTTCGTTACG
TATTCCGTGTCAATGAATCAACGAAAATGATTATTTTTGTAGGAAAACAA
TAAAGTTCGGATCACACACTTTCACTATAAAACAATTATTTTCACCGAAT
TGTTTTCAGTTTGATTAAATAATGAATTTTTTCATTGTTATTATTTTTCT
GGGTTCGTTGAATTTCCTCTCGGTTTCAACAACCGGTCAAGAATGTCTAC
CGCAATGCAGATGCACGGAAAAAACTGTCACTTGCCGTCGAGGAGGTTTC
CAAATGATTCCGGAAATAGGAAACAAAAGGTTGACATATCTCTCGCTTCC
TGGAAATTCTATCTCGAAAATAATTGCTAACCAATTCAAGGAATTCAAAG
ACCTCATCCATGTAGATTTGAGTTTTAACAAAATTTCTTTGGTCGAAGAA
AATGCCTTGTATGGACCGATTTTCCTCGAGACTTTGTACTTGAAAAATAA
TCTCATTGAATATTTACCGGAACAAATCTTTTCCGATCATTCTGATAGTC
TTAAGCTACTAAGTTTAGCGAACAATCGTCTGAAAACGTTACCAATATCT
TTGGAAAAGCTAATTAATGTTAAGCGATTAGAATTGTACGGAAATATGCT
TTATTGCGGATGTGAGCTTCGATATTTTGCAGGGAATTTACGAAGAATAG
GATTGGACTTTCAAAAGTCTCAATGTCAAAGTCCCATGAATGTAAAGAAC
CAATTTTTGGAAGAAGTGAAGTTTAATGAACTTTGTTCAAATTCTTTTGA
AGCTTCAGAACTTGCTCCAAAGTTCATTGAACGACCTCAAGACGCATATG
TTGCAGTGGGAGATAAAATTAGGTTTGCCTGTCAAGTAGAGAACATTAAT
GAAACCAAAGTAGAATGGCATTTTCAGTTCAACGATACCACCTTCAATTC
GTTGTATTGGAGGAATCAATGGTTGTTTATTAAGGAAGTTCACGAATTCC
ATGAAGGAATTTACATATGTACGGCATCAAACAACAAAGGCTCAATTTCT
GCGTCAGCCAAGTTAAAAATCGCTCCGAATCAAAAACCTTATATTGTGGA
AGGGCCTGCAAGTATAAGTGCGGAAAAAGGTTCACGAGTAGAATTTTCAT
GTCGGGCTCATGGATATCCAGTCCCTGAAATCACATGGCTATGGGTAAAG
TCGAATCAAGTTCGTTTGGAAACCGAAGGGAAATATATTGTGAGGAAAAA
TAACTTAGTTATTGAAAATATAACTGAATCTGAAGTTGAAGGAAGATATG
TATGTTACGCAAGTAGTCTTTCAGGATCTGCTAAAGTTTCCGCAGTTATT
ACGTTGATCAGATCGAAAAATGAATTAAATCTTAACGAAGAAAGTAGTAA
GTTGCCGTCAAGAAATAAATTGAAAAATGAGCAATTGTATGAGATCATCA
AAGATGCTCAATCGAAAATTAATGTTGCGTTCAAAAAAACCGCCGAAAAG
TTGCGAGACCCAAACAGACAGAGGTCGAGATCAGACATTCAGTCGTTATT
CCGGCAGCCGAGCTTGGCCGCACTAGAGTTGGCAAAAGCGAGCGATGTTT
ATGAAAAGGTATTAGACGACTTAACGGGAATTCTTCGAGAAAACAAAGTA
AAATTAAATTTAACAACAGCATACGAAGAAACTCTAGATTTCACAACATT
ATTAACCCCAGAACAATTGGCGATCATTTCACAACTTTCCGGATGTCAGA
GATCGACAGAAGAGTTACATTGTTCACAACAGTTATGCTTTCATAAGAAA
TACCGAAGCATCGATGGAAAGTGTAATAATTTAATAAATCCAAGACGGGG
GTCAGCTCTTTCACCTTTTTATCGTTTGATGAAGCCAGAGTATGAAAATG
GAATTAATACTCCGATTGGATGGACGGCTGGGAAGCTGTATCACGGATAT
TCTAAACCGAGTGCTCGATTGGTCTCTTCAAGACTACTTCGAGCTCACAA
AATAACTCCAGATCCAAATTTATCTGCAATGGTTATGCAATGGGGTCAGT
TTTTAGATCACGATTTGGACTTTACTCCAGTTGATGCCTCAAATAGTAGA
TTCAGTGATGGTCTAGGATGTAACGAGACTTGTGTCAATGATTCTCCTTG
TTTTCCAATATTAACTCCACCTGGTGATCCAAGAGTACAAAGACCTTGCA
TAGGGTTTTCTAGATCTATTGCAACCTGTGGATCTGGTCAATCATCAATT
ATTCTAGGGAAACTTCATTATAGAGAACAAGTTAACCAGATAACTTCATT
TCTAGACGGTTCGAACGTTTATTCAAGTGATCCTCTTGAGGCTACTGAAC
TCCGAGATCTTACATATGATGAAGGAAAATTAAGAGTAGGTCCTGTTACT
CCGTCTAATAAACGGTTACTTCCATTTAATATAAGAGGACAAGTAGATTG
TCAGATTGACCCTGCAAAAGCTCATGTACCCTGTTTTAAGGCTGGAGATC
ACAGAAATAATGAGAATTTGGGTTTACTAGTGATGCATACAATTTGGATG
AGAGAACACAATAGGCTGTCAGATGAGTTACGTGGGTTAAATAACCATTG
GAATGGAGATAAGATTTACTATGAGTCTAGAAAGATTGTAGGAGCAATGA
TGCAGCATATAACATACAATGCCTGGTTACCGATTGTATTGGGAAGCGAA
GGTATTAAAAGGTTAGGACAATATCCTGGATACAATGATATGGTTGATTC
AACTATAAGTAGTGTTTTTGCAACCGCTGCAATGAGATTTGGTCACACGT
TGATTAATCCAATTCTATATAGGCTAGATGAAAACTTTGAAACCATTCCG
GAAGGAAATCTTCCTTTGCATAAAGCATTTTTCGCTCCCGATAGGGTAAT
GGAGGATGGTGGCATTGATCCTATACTAAGAGGTCTTTTTGCTATAGGAT
CAAAAGCAGTGAAATCAGATCAAGTAATGAATGCAGAGTTAATTGAAAAA
TTATTTGCCATGGCTCACGAAGTGGCACTAGACTTAGGAGCTCTGAATAT
CCAAAGAGGAAGAGATCATGGACTTGCTAGTTATAATTCATGGAGAGAAT
TCTGTGGAATGAAAAAAGCCGAGACTTTTGATGACTTTTCTGGTGAAATA
GTTTCAAGTGAAATAAGAGAAAAGATGAGACAAGTTTATGGTCATCCGGG
TAATGTCGACTTATTTGCGGGAGCTGTTTTAGAACAGAAGGTTTCTGGCG
GTTTGGTAGGCCCAACTTTAAGTTGCTTATTAATAGATCAATTTAAACGA
TTGAGAGATGGTGACAGATTTTGGTATGAGAGCCATGACCAATTCGAGCC
TGCGCAACTTTCACAAATCAAACAAGTAACATTAGCGCGCATTTTATGCG
ACAATTCCGATAACATCTCTCGTGTACAAAGAAATGTTTTCTTCATGGCA
AAATCCAAATTAGAATTCATTGACTGTAGCAATATTCCAAGATTAAATCT
AATCCCGTGGAAAGAATGTTATGATCCATCAAGGCTAACGCCAGAAGATC
AAGTTCCAGGTTTATCGCCATCCAGATCAAGGAGAAGCACAAATGAATTT
CAAGATCAAAACTGCAAAAGTAAAACAAATCAATGTTCTTCAAATATTTC
TAATTTGGAAGAAAGAATCAAAAGCTTAGAAGATAAGATGTTACACCTGA
ACCAGAAAAATTAATTTTTTATCATTGTCATTTAATGAACCATAAAATGT
ATTTTTTAATGTGTGTCAAAC
back to top

protein sequence of SMED30031201-orf-1

>SMED30031201-orf-1 ID=SMED30031201-orf-1|Name=SMED30031201-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1181bp
MNFFIVIIFLGSLNFLSVSTTGQECLPQCRCTEKTVTCRRGGFQMIPEIG
NKRLTYLSLPGNSISKIIANQFKEFKDLIHVDLSFNKISLVEENALYGPI
FLETLYLKNNLIEYLPEQIFSDHSDSLKLLSLANNRLKTLPISLEKLINV
KRLELYGNMLYCGCELRYFAGNLRRIGLDFQKSQCQSPMNVKNQFLEEVK
FNELCSNSFEASELAPKFIERPQDAYVAVGDKIRFACQVENINETKVEWH
FQFNDTTFNSLYWRNQWLFIKEVHEFHEGIYICTASNNKGSISASAKLKI
APNQKPYIVEGPASISAEKGSRVEFSCRAHGYPVPEITWLWVKSNQVRLE
TEGKYIVRKNNLVIENITESEVEGRYVCYASSLSGSAKVSAVITLIRSKN
ELNLNEESSKLPSRNKLKNEQLYEIIKDAQSKINVAFKKTAEKLRDPNRQ
RSRSDIQSLFRQPSLAALELAKASDVYEKVLDDLTGILRENKVKLNLTTA
YEETLDFTTLLTPEQLAIISQLSGCQRSTEELHCSQQLCFHKKYRSIDGK
CNNLINPRRGSALSPFYRLMKPEYENGINTPIGWTAGKLYHGYSKPSARL
VSSRLLRAHKITPDPNLSAMVMQWGQFLDHDLDFTPVDASNSRFSDGLGC
NETCVNDSPCFPILTPPGDPRVQRPCIGFSRSIATCGSGQSSIILGKLHY
REQVNQITSFLDGSNVYSSDPLEATELRDLTYDEGKLRVGPVTPSNKRLL
PFNIRGQVDCQIDPAKAHVPCFKAGDHRNNENLGLLVMHTIWMREHNRLS
DELRGLNNHWNGDKIYYESRKIVGAMMQHITYNAWLPIVLGSEGIKRLGQ
YPGYNDMVDSTISSVFATAAMRFGHTLINPILYRLDENFETIPEGNLPLH
KAFFAPDRVMEDGGIDPILRGLFAIGSKAVKSDQVMNAELIEKLFAMAHE
VALDLGALNIQRGRDHGLASYNSWREFCGMKKAETFDDFSGEIVSSEIRE
KMRQVYGHPGNVDLFAGAVLEQKVSGGLVGPTLSCLLIDQFKRLRDGDRF
WYESHDQFEPAQLSQIKQVTLARILCDNSDNISRVQRNVFFMAKSKLEFI
DCSNIPRLNLIPWKECYDPSRLTPEDQVPGLSPSRSRRSTNEFQDQNCKS
KTNQCSSNISNLEERIKSLEDKMLHLNQKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037120Haem_peroxidase_sf_animal
IPR034828Peroxidasin
IPR034824Peroxidasin_peroxidase
IPR036179Ig-like_dom_sf
IPR019791Haem_peroxidase_animal
IPR003598Ig_sub2
IPR003599Ig_sub
IPR003591Leu-rich_rpt_typical-subtyp
IPR013098Ig_I-set
IPR013783Ig-like_fold
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
IPR007110Ig-like_dom
IPR010255Haem_peroxidase_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0020037heme binding
GO:0004601peroxidase activity
Vocabulary: biological process
TermDefinition
GO:0006979response to oxidative stress
GO:0055114oxidation-reduction process
GO:0098869cellular oxidant detoxification
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1152..1179
NoneNo IPR availablePFAMPF13927Ig_3coord: 305..381
e-value: 1.1E-11
score: 45.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1127..1147
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1124..1147
NoneNo IPR availablePANTHERPTHR11475OXIDASE/PEROXIDASEcoord: 230..1156
NoneNo IPR availableCDDcd00096Igcoord: 233..297
e-value: 2.4042E-6
score: 44.1553
NoneNo IPR availableCDDcd00096Igcoord: 323..392
e-value: 4.84159E-10
score: 54.5556
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.734
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 22..205
IPR019791Haem peroxidase, animal-typePRINTSPR00457ANPEROXIDASEcoord: 815..841
score: 38.5
coord: 995..1015
score: 24.68
coord: 568..579
score: 30.3
coord: 1066..1080
score: 31.72
coord: 772..790
score: 38.92
coord: 868..878
score: 45.18
coord: 790..810
score: 52.96
coord: 620..635
score: 45.45
IPR019791Haem peroxidase, animal-typePFAMPF03098An_peroxidasecoord: 544..1090
e-value: 5.3E-192
score: 639.1
IPR019791Haem peroxidase, animal-typePROSITEPS50292PEROXIDASE_3coord: 531..1117
score: 159.333
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 222..301
e-value: 8.4E-8
score: 41.9
coord: 312..396
e-value: 2.0E-7
score: 40.7
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 228..290
e-value: 0.025
score: 22.5
coord: 318..385
e-value: 1.4E-6
score: 37.9
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 102..122
e-value: 11.0
score: 13.1
coord: 126..147
e-value: 120.0
score: 4.6
coord: 75..98
e-value: 50.0
score: 7.5
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 21..121
e-value: 2.7E-20
score: 74.1
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 122..210
e-value: 9.7E-12
score: 46.7
IPR037120Haem peroxidase domain superfamily, animal typeGENE3DG3DSA:1.10.640.10coord: 521..1117
e-value: 3.1E-223
score: 744.3
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 216..300
e-value: 6.1E-11
score: 42.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 211..303
e-value: 5.8E-15
score: 57.1
coord: 304..401
e-value: 1.9E-16
score: 61.9
IPR034828PeroxidasinPANTHERPTHR11475:SF58PEROXIDASINcoord: 230..1156
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 126..148
score: 7.235
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 101..122
score: 6.611
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 77..98
score: 5.463
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 53..74
score: 6.28
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 306..394
score: 12.568
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 216..299
score: 11.043
IPR034824Peroxidasin, peroxidase domainCDDcd09826peroxidasin_likecoord: 666..1104
e-value: 0.0
score: 779.95
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 214..300
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 305..394
IPR010255Haem peroxidase superfamilySUPERFAMILYSSF48113Heme-dependent peroxidasescoord: 538..1116