Beta-arrestin

Overview
NameBeta-arrestin
Smed IDSMED30031199
Length (bp)1414
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Beta-arrestin (SMED30031199) t-SNE clustered cells

Violin plots show distribution of expression levels for Beta-arrestin (SMED30031199) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Beta-arrestin (SMED30031199) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Beta-arrestin (SMED30031199) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031199

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30031199SMESG000006894.1 SmedASXL_014009SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30031199SMESG000006894.1 dd_Smed_v4_19631_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031199SMESG000006894.1 dd_Smed_v4_19631_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031199SMESG000006894.1 dd_Smed_v4_19631_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031199SMESG000006894.1 dd_Smed_v4_19631_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031199SMESG000006894.1 dd_Smed_v6_19631_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30031199SMESG000006894.1 SMED30031199smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30031199SMESG000006894.1 SMED30031199smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30031199SMESG000006894.1 OX_Smed_1.0.02775ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30031199SMESG000006894.1 Contig36205newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30031199SMESG000006894.1 Contig36205uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Beta-arrestin vs. Ensembl Human
Match: ARRB1 (arrestin beta 1 [Source:HGNC Symbol;Acc:HGNC:711])

HSP 1 Score: 415.231 bits (1066), Expect = 3.220e-142
Identity = 211/405 (52.10%), Postives = 284/405 (70.12%), Query Frame = 2
Query:   68 GTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPN-SVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNETNCEE 1279
            GTRVFKK+SPN K+T+YLGKRDF+D   LVDP++G+VL+D +Y+K+++V++ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVDYE+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E DD   ++P    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L E ++ E +GIIV Y ++V+L++  G  D+ +E+PF L HP P  +   P+  V  +  P+D+N I+ D N      +++ +FEDFAR RL G + + EE
Sbjct:    5 GTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDT--VAPSST-FCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKPKEE--PPHREVPENETPVDTNLIELDTN------DDDIVFEDFARQRLKGMKDDKEE 397          
BLAST of Beta-arrestin vs. Ensembl Human
Match: ARRB1 (arrestin beta 1 [Source:HGNC Symbol;Acc:HGNC:711])

HSP 1 Score: 415.231 bits (1066), Expect = 3.358e-142
Identity = 212/412 (51.46%), Postives = 286/412 (69.42%), Query Frame = 2
Query:   68 GTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFG-------TSDIQLEIPFILTHPNPDSDFRIPN-SVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNETNCEE 1279
            GTRVFKK+SPN K+T+YLGKRDF+D   LVDP++G+VL+D +Y+K+++V++ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVDYE+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E DD   ++P    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L E ++ E +GIIV Y ++V+L++  G       +SD+ +E+PF L HP P  +   P+  V  +  P+D+N I+ D N      +++ +FEDFAR RL G + + EE
Sbjct:    5 GTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDT--VAPSST-FCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEE--PPHREVPENETPVDTNLIELDTN------DDDIVFEDFARQRLKGMKDDKEE 405          
BLAST of Beta-arrestin vs. Ensembl Human
Match: ARRB2 (arrestin beta 2 [Source:HGNC Symbol;Acc:HGNC:712])

HSP 1 Score: 412.92 bits (1060), Expect = 2.256e-141
Identity = 210/403 (52.11%), Postives = 284/403 (70.47%), Query Frame = 2
Query:   59 KKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLN---PLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            +K GTRVFKKSSPN K+T+YLGKRDF+D    VDP++G+VL+D DY+KD+KVF+ +   FRYGR+DLDVLGL+FRKDLF++T Q +PP  +     T+LQ+RL+ KLG +A PF F IP   P SVTLQP PED GK CGVD+E++ + +   + K+HKRNSVRL+IRK+ FA   PGPQ   E T+ F M    + LE SLDKE YYHGE + VNV V N S K ++KI++ V Q ADI LF+ A YKC V ++E DD   +SP    +CK++ + PLLS+NR+KRGLALDG L++EDTNLASST++ E ++ E +GI+V Y ++V+L++  G  D+ +E+PF+L HP P     +P   S       P+D+N I+ D N   +  +++ +FEDFARLRL G
Sbjct:    3 EKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQ--VSPSST-FCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTN---YATDDDIVFEDFARLRLKG 398          
BLAST of Beta-arrestin vs. Ensembl Human
Match: ARRB2 (arrestin beta 2 [Source:HGNC Symbol;Acc:HGNC:712])

HSP 1 Score: 400.593 bits (1028), Expect = 3.498e-136
Identity = 210/424 (49.53%), Postives = 284/424 (66.98%), Query Frame = 2
Query:   59 KKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQ---------------------IPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLN---PLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            +K GTRVFKKSSPN K+T+YLGKRDF+D    VDP++G+VL+D DY+KD+KVF+ +   FRYGR+DLDVLGL+FRKDLF++T Q +PP  +     T+LQ+RL+ KLG +A PF F                      IP   P SVTLQP PED GK CGVD+E++ + +   + K+HKRNSVRL+IRK+ FA   PGPQ   E T+ F M    + LE SLDKE YYHGE + VNV V N S K ++KI++ V Q ADI LF+ A YKC V ++E DD   +SP    +CK++ + PLLS+NR+KRGLALDG L++EDTNLASST++ E ++ E +GI+V Y ++V+L++  G  D+ +E+PF+L HP P     +P   S       P+D+N I+ D N   +  +++ +FEDFARLRL G
Sbjct:    3 EKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTVRMPLPSEGQGAGAGTVSGVGIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQ--VSPSST-FCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTN---YATDDDIVFEDFARLRLKG 419          
BLAST of Beta-arrestin vs. Ensembl Human
Match: ARRB2 (arrestin beta 2 [Source:HGNC Symbol;Acc:HGNC:712])

HSP 1 Score: 382.489 bits (981), Expect = 1.079e-129
Identity = 201/403 (49.88%), Postives = 270/403 (67.00%), Query Frame = 2
Query:   59 KKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLN---PLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            +K GTRVFKKSSPN K+T+YLGKRDF+D    VDP+               VF+ +   FRYGR+DLDVLGL+FRKDLF++T Q +PP  +     T+LQ+RL+ KLG +A PF F IP   P SVTLQP PED GK CGVD+E++ + +   + K+HKRNSVRL+IRK+ FA   PGPQ   E T+ F M    + LE SLDKE YYHGE + VNV V N S K ++KI++ V Q ADI LF+ A YKC V ++E DD   +SP    +CK++ + PLLS+NR+KRGLALDG L++EDTNLASST++ E ++ E +GI+V Y ++V+L++  G  D+ +E+PF+L HP P     +P   S       P+D+N I+ D N   +  +++ +FEDFARLRL G
Sbjct:    3 EKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPV---------------VFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQ--VSPSST-FCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTN---YATDDDIVFEDFARLRLKG 383          
BLAST of Beta-arrestin vs. Ensembl Celegans
Match: arr-1 (Beta-arrestin arr-1 [Source:UniProtKB/Swiss-Prot;Acc:P51485])

HSP 1 Score: 419.083 bits (1076), Expect = 7.699e-144
Identity = 221/426 (51.88%), Postives = 301/426 (70.66%), Query Frame = 2
Query:   32 MIDMDEGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKD-KKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTN-SIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMS--DGPDGKTHKR----NSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPD-----SDFRIPN-SVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNET 1267
            M+D D    KK GTRVFKK+SPN KIT YLGKRDF+D+   VD I+G+VL+D +Y+KD +KV  H+LA FRYGR+DLDVLGLTFRKDL   T Q+YP T+ SI   L++LQERL  KLG NA PF F++   + +SVTLQP P D GKPCGVDYELK +++  DG  G+  K+    N+VRL IRKLT+A  +  PQ   +V+K F M  G + +E SLDKE YYHGESI+VNV + N SNK ++K+++ ++Q+ADI LFT A Y C V  +E ++GFP+ PG     K+F +CPLLSNN+DKRGLALDG L++EDTNLASST+L+  +  E++GI+V+Y ++VR +LG    ++  E+PF LTH  P      +D  +P+   +N   P+D + I     +L+ + +++ IFEDFAR+RL+GN++
Sbjct:    1 MVDED----KKSGTRVFKKTSPNGKITTYLGKRDFIDRGDYVDLIDGMVLIDEEYIKDNRKVTAHLLAAFRYGREDLDVLGLTFRKDLISETFQVYPQTDKSISRPLSRLQERLKRKLGANAFPFWFEVAPKSASSVTLQPAPGDTGKPCGVDYELKTFVAVTDGSSGEKPKKSALSNTVRLAIRKLTYAPFESRPQPMVDVSKYFMMSSGLLHMEVSLDKEMYYHGESISVNVHIQNNSNKTVKKLKIYIIQVADICLFTTASYSCEVARIESNEGFPVGPGGT-LSKVFAVCPLLSNNKDKRGLALDGQLKHEDTNLASSTILDSKTSKESLGIVVQYRVKVRAVLGPLNGELFAELPFTLTHSKPPESPERTDRGLPSIEATNGSEPVDIDLIQL-HEELEPRYDDDLIFEDFARMRLHGNDS 420          
BLAST of Beta-arrestin vs. Ensembl Fly
Match: krz (gene:FBgn0040206 transcript:FBtr0305268)

HSP 1 Score: 407.527 bits (1046), Expect = 1.062e-138
Identity = 222/434 (51.15%), Postives = 291/434 (67.05%), Query Frame = 2
Query:   47 EGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILG--FGTSDIQLEIPFILTHPNPDSD------FRIPN-----------SVSNDLNPLDSNGID--TDFNKLQF----KQEEEFIFEDFARLRLYGNETNC 1273
            + + ++  TRVFKKSS N KIT+YLGKRDF+D    VDPI+G+V +D +YVKD+KVF  VLA FRYGR+DLDVLGLTFRKDL+L+ +QIYPP     P +T+LQERLI KLG NA PF F++P   PASV+LQP P D GK CGVDYELK ++ +  + K HKRNSVRL IRK+ +A S  G Q   EV+K+F M   KI LE +LDKE Y+HGE I+VNV V N SN+ ++KI++ V Q ADI LF+ A YK VV E+E +DG  ++PG     K+F +CPLL+NN+DK GLALDG L++EDTNLASST++   +  E++GI+V Y ++V+L++       D+  E+PF L HP P+ +       R P            S+S+      + G D  T  N +Q      Q+++ IFEDFARLRL G ET  
Sbjct:   39 DASSRRQATRVFKKSSSNGKITVYLGKRDFVDHVTHVDPIDGVVFIDPEYVKDRKVFGQVLAAFRYGREDLDVLGLTFRKDLYLAHEQIYPPMQLDRP-MTRLQERLIKKLGPNAHPFYFEVPPYCPASVSLQPAPGDVGKSCGVDYELKAFVGENVEDKPHKRNSVRLTIRKVMYAPSKVGEQPSIEVSKEFMMKPNKIHLEATLDKELYHHGEKISVNVHVANNSNRTVKKIKVCVRQFADICLFSTAQYKSVVAEIESEDGCQVAPG-FTLSKVFELCPLLANNKDKWGLALDGQLKHEDTNLASSTLITNPAQRESLGIMVHYKVKVKLLISSPLLNGDLVAELPFTLMHPKPEEEEHPLLGERSPRASLAGGGLPLVSMSDGETESATGGQDVPTTTNLIQLDDDEAQDDDIIFEDFARLRLKGAETEA 470          
BLAST of Beta-arrestin vs. Ensembl Fly
Match: krz (gene:FBgn0040206 transcript:FBtr0085877)

HSP 1 Score: 407.527 bits (1046), Expect = 1.062e-138
Identity = 222/434 (51.15%), Postives = 291/434 (67.05%), Query Frame = 2
Query:   47 EGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILG--FGTSDIQLEIPFILTHPNPDSD------FRIPN-----------SVSNDLNPLDSNGID--TDFNKLQF----KQEEEFIFEDFARLRLYGNETNC 1273
            + + ++  TRVFKKSS N KIT+YLGKRDF+D    VDPI+G+V +D +YVKD+KVF  VLA FRYGR+DLDVLGLTFRKDL+L+ +QIYPP     P +T+LQERLI KLG NA PF F++P   PASV+LQP P D GK CGVDYELK ++ +  + K HKRNSVRL IRK+ +A S  G Q   EV+K+F M   KI LE +LDKE Y+HGE I+VNV V N SN+ ++KI++ V Q ADI LF+ A YK VV E+E +DG  ++PG     K+F +CPLL+NN+DK GLALDG L++EDTNLASST++   +  E++GI+V Y ++V+L++       D+  E+PF L HP P+ +       R P            S+S+      + G D  T  N +Q      Q+++ IFEDFARLRL G ET  
Sbjct:   39 DASSRRQATRVFKKSSSNGKITVYLGKRDFVDHVTHVDPIDGVVFIDPEYVKDRKVFGQVLAAFRYGREDLDVLGLTFRKDLYLAHEQIYPPMQLDRP-MTRLQERLIKKLGPNAHPFYFEVPPYCPASVSLQPAPGDVGKSCGVDYELKAFVGENVEDKPHKRNSVRLTIRKVMYAPSKVGEQPSIEVSKEFMMKPNKIHLEATLDKELYHHGEKISVNVHVANNSNRTVKKIKVCVRQFADICLFSTAQYKSVVAEIESEDGCQVAPG-FTLSKVFELCPLLANNKDKWGLALDGQLKHEDTNLASSTLITNPAQRESLGIMVHYKVKVKLLISSPLLNGDLVAELPFTLMHPKPEEEEHPLLGERSPRASLAGGGLPLVSMSDGETESATGGQDVPTTTNLIQLDDDEAQDDDIIFEDFARLRLKGAETEA 470          
BLAST of Beta-arrestin vs. Ensembl Fly
Match: Arr1 (gene:FBgn0000120 transcript:FBtr0307350)

HSP 1 Score: 306.22 bits (783), Expect = 1.410e-100
Identity = 148/347 (42.65%), Postives = 231/347 (66.57%), Query Frame = 2
Query:   74 RVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVK-DKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNP 1111
            +VFKK SPNN IT+Y+ +RDF+D    V+PI+GI++LD +YV+ ++K+F+ ++  FRYGR+D +++GL F+K+L L +QQ+ PP    I  LTK+QERL+ KLG NA PF+ Q+P  +PASV LQ    D  +PCGV Y +K++  D    ++H+R+++ L IRK+ +A +  G Q    V KDF +  G++ LE +LDK+ Y+HGE I+VN+ V N SNK+++KI+  V Q  D++LF    ++  +  ME  +G P++PG     K+ ++ P L  N D+ G+A++G ++ +DT LAS+T++      +  GIIV Y ++V+L LG    ++  E+PFIL HP P
Sbjct:    6 KVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEMIGLRFQKELTLVSQQVCPPQKQDI-QLTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASDESQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELELEVTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCPLNPGS-SLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVKVKLFLGALGGELCAELPFILMHPKP 350          
BLAST of Beta-arrestin vs. Ensembl Fly
Match: Arr1 (gene:FBgn0000120 transcript:FBtr0081030)

HSP 1 Score: 306.22 bits (783), Expect = 1.410e-100
Identity = 148/347 (42.65%), Postives = 231/347 (66.57%), Query Frame = 2
Query:   74 RVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVK-DKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNP 1111
            +VFKK SPNN IT+Y+ +RDF+D    V+PI+GI++LD +YV+ ++K+F+ ++  FRYGR+D +++GL F+K+L L +QQ+ PP    I  LTK+QERL+ KLG NA PF+ Q+P  +PASV LQ    D  +PCGV Y +K++  D    ++H+R+++ L IRK+ +A +  G Q    V KDF +  G++ LE +LDK+ Y+HGE I+VN+ V N SNK+++KI+  V Q  D++LF    ++  +  ME  +G P++PG     K+ ++ P L  N D+ G+A++G ++ +DT LAS+T++      +  GIIV Y ++V+L LG    ++  E+PFIL HP P
Sbjct:    6 KVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEMIGLRFQKELTLVSQQVCPPQKQDI-QLTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASDESQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELELEVTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCPLNPGS-SLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVKVKLFLGALGGELCAELPFILMHPKP 350          
BLAST of Beta-arrestin vs. Ensembl Fly
Match: Arr2 (gene:FBgn0000121 transcript:FBtr0076599)

HSP 1 Score: 304.679 bits (779), Expect = 2.189e-99
Identity = 161/402 (40.05%), Postives = 252/402 (62.69%), Query Frame = 2
Query:   65 LGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPG---PQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNEN-SDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEE--FIFEDFARLRL 1252
            +  +VFKK++PN K+T YLG+RDF+D     DP++G+++++ DY+K++KVF  +   +RYGR++ +V+G+ F K+L L  +QI P TN  +  +T +QE+L+ KLG NA PF F  P  +P+SVTLQ + +DNGKP GV+Y ++ ++ D  D + HKR+ V L+I+KL +A  + G   P     V+K F    GKI LE +LD+E YYHGE  A  V V N S K ++ I+  +VQ  +I +   A +   V ++E  +G PI+PG     K F++ PL +NN+D+ G+ALDG L+ ED NLASST++ E  S  +  GI++ Y +R++L  G    ++Q ++PF L  P P +   I    SN +  + S  I+   N   + Q+++   +FEDFA++R+
Sbjct:    3 VSVKVFKKATPNGKVTFYLGRRDFIDHIDYCDPVDGVIVVEPDYLKNRKVFGQLATTYRYGREEDEVMGVKFSKELILCREQIVPMTNPNM-EMTPMQEKLVRKLGSNAYPFTFHFPPNSPSSVTLQQEGDDNGKPLGVEYTIRAFVGDSEDDRQHKRSMVSLVIKKLQYAPLNRGQRLPSSL--VSKGFTFSNGKISLEVTLDREIYYHGEKTAATVQVSNNSKKSVKSIKCFIVQHTEITMVN-AQFSKHVAQLETKEGCPITPG-ANLTKTFYLIPLAANNKDRHGIALDGHLKDEDVNLASSTMVQEGKSTGDACGIVISYSVRIKLNCGTLGGEMQTDVPFKLLQPAPGT---IEKKRSNAMKKMKS--IEQHRNVKGYYQDDDDNIVFEDFAKMRM 394          
BLAST of Beta-arrestin vs. Ensembl Zebrafish
Match: arrb2b (arrestin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1332])

HSP 1 Score: 425.246 bits (1092), Expect = 2.253e-146
Identity = 212/401 (52.87%), Postives = 285/401 (71.07%), Query Frame = 2
Query:   62 KLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDS--DFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            K GTRVFKKSSPN K+T+YLGKRDF+D    VDP++G++L+D +Y+KD+KVF+ +   FRYGR+DLDVLGL+FRKDLF+S+ Q YPP       L++LQERL+ KLG NA PF F IP   P SVTLQP PED GK CGVD+E++ + +   D KTHKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N S K ++++++ V Q ADI LF+ A YKC V ++E DD    S     +CK++ + P LSNNR+KRGLALDG L++EDTNLASST++ + S+ E +GI+V Y ++V+L++  G  D+ +E+PF+L HP P    + R  ++V     P+D+N I+ + N   F Q+++F+FEDFARLRL G
Sbjct:    4 KAGTRVFKKSSPNCKLTVYLGKRDFVDHLDHVDPVDGVLLIDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFISSFQAYPPLPDERKPLSRLQERLLKKLGQNAYPFNFTIPQNLPCSVTLQPGPEDTGKACGVDFEVRAFCAKTVDEKTHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQVEADDQVSSSS---TFCKVYTLTPTLSNNREKRGLALDGQLKHEDTNLASSTIVKDVSNKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPSEQPNSRPQSAVPETDVPVDANLIEFETN--NFSQDDDFVFEDFARLRLKG 398          
BLAST of Beta-arrestin vs. Ensembl Zebrafish
Match: arrb1 (arrestin, beta 1 [Source:ZFIN;Acc:ZDB-GENE-060824-1])

HSP 1 Score: 417.542 bits (1072), Expect = 3.432e-143
Identity = 213/411 (51.82%), Postives = 285/411 (69.34%), Query Frame = 2
Query:   68 GTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFG-------TSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNETNCEE 1279
            GTRVFKK+SPN K+T+YLGKRDF+D   LV+P++G+VL+D +Y+K++KVF+ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP      SLT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVD+E+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E DD   I      +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L E ++ E +GIIV Y ++V+L++  G       +SD+ +E+PF L HP P  +    ++  ND  P+D+N I+ D N      +++ IFEDFAR RL G + + +E
Sbjct:    5 GTRVFKKASPNGKLTVYLGKRDFVDHVDLVEPVDGVVLIDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPEEKKSLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDFEVKAFCAENVEEKIHKRNSVRLVIRKVQYAPEKPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAIEESDD---IVAPSATFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANKEILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPLEESIYRDAPENDA-PIDTNLIEFDTN------DDDIIFEDFARQRLIGAKDDKDE 405          
BLAST of Beta-arrestin vs. Ensembl Zebrafish
Match: arrb2a (arrestin, beta 2a [Source:ZFIN;Acc:ZDB-GENE-030131-29])

HSP 1 Score: 407.527 bits (1046), Expect = 1.609e-139
Identity = 205/409 (50.12%), Postives = 282/409 (68.95%), Query Frame = 2
Query:   62 KLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDL--NPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG---NETNC 1273
            K GTRVFKKSSPN K+T+YLGKRDF+D    VDP++G++L+D +Y+KD+KVF+ +   FRYGR+DLDVLGL+FRKDL++ T Q YPP        ++LQERL+ KLG NA PF F IP   P SVTLQP PED GK CGVD+E++ + +   + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N S K ++++++ V Q ADI LF+ A YKC V ++E DD    S     +CK++ + P L+NNR+KRGLALDG L++EDTNLASST++ + S+ E +G++V Y ++V+L++  G  D+ +E+PF+L HP P       ++ +  +   P+D+N I+ D N L    +++ +FEDFARLRL G    E +C
Sbjct:    4 KAGTRVFKKSSPNCKVTVYLGKRDFVDHLDHVDPVDGVILVDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYIFTFQAYPPIPEESKPHSRLQERLLKKLGQNAYPFHFSIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSMEEKNHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQIEADDQVASSS---TFCKVYTLTPTLNNNREKRGLALDGKLKHEDTNLASSTIVKDVSNKEVLGVLVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPSESSLSHSTSAVPMLDPPIDTNLIEFDTNSLI--PDDDIVFEDFARLRLKGVIDKEEDC 406          
BLAST of Beta-arrestin vs. Ensembl Zebrafish
Match: arrb2a (arrestin, beta 2a [Source:ZFIN;Acc:ZDB-GENE-030131-29])

HSP 1 Score: 404.831 bits (1039), Expect = 2.572e-138
Identity = 205/416 (49.28%), Postives = 282/416 (67.79%), Query Frame = 2
Query:   62 KLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFG-------TSDIQLEIPFILTHPNPDSDFRIPNSVSNDL--NPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG---NETNC 1273
            K GTRVFKKSSPN K+T+YLGKRDF+D    VDP++G++L+D +Y+KD+KVF+ +   FRYGR+DLDVLGL+FRKDL++ T Q YPP        ++LQERL+ KLG NA PF F IP   P SVTLQP PED GK CGVD+E++ + +   + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N S K ++++++ V Q ADI LF+ A YKC V ++E DD    S     +CK++ + P L+NNR+KRGLALDG L++EDTNLASST++ + S+ E +G++V Y ++V+L++  G         D+ +E+PF+L HP P       ++ +  +   P+D+N I+ D N L    +++ +FEDFARLRL G    E +C
Sbjct:    4 KAGTRVFKKSSPNCKVTVYLGKRDFVDHLDHVDPVDGVILVDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYIFTFQAYPPIPEESKPHSRLQERLLKKLGQNAYPFHFSIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSMEEKNHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQIEADDQVASSS---TFCKVYTLTPTLNNNREKRGLALDGKLKHEDTNLASSTIVKDVSNKEVLGVLVSYRVKVKLVVSRGGLLSSLLERDVSVELPFVLMHPKPSESSLSHSTSAVPMLDPPIDTNLIEFDTNSLI--PDDDIVFEDFARLRLKGVIDKEEDC 414          
BLAST of Beta-arrestin vs. Ensembl Zebrafish
Match: saga (S-antigen; retina and pineal gland (arrestin) a [Source:ZFIN;Acc:ZDB-GENE-040426-1538])

HSP 1 Score: 309.301 bits (791), Expect = 3.081e-101
Identity = 158/352 (44.89%), Postives = 235/352 (66.76%), Query Frame = 2
Query:   77 VFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDD-LDVLGLTFRKDLFLSTQQIYPPTNSIIPS-LTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMY-KCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILG--FGTSDIQLEIPFILTHPNPDS 1117
            VFKK S +  + +Y+GKRDF+D+   VDP++G++L+D + ++ KK ++ +  +FRYGRDD  +VLG++FRK++++ST+Q+YP         LTK+QE+L+ KLG NA PF F+ P   P SV LQP P+D GK C V++E+K + ++  D K  KR+SV L+IRK+ +A    GP    E T+DF M    + LE SL+K+ YYHGE I V V ++N SNK +R I L V Q A+++L+    Y K V  E   D G  +  G     K++ + PLL+NNR++RG+ALDG L++EDTNLASS+++ E    E +GI+V Y + V+LI+G   G+S++ +E+PF L HP PD+
Sbjct:    7 VFKKISKDKSVGVYMGKRDFVDRVDSVDPVDGVILIDPEQLRGKKAYVTLSCVFRYGRDDDAEVLGISFRKEIYISTRQVYPALQDKEQCILTKVQEKLLRKLGDNAYPFFFEFPDNLPCSVGLQPAPKDVGKHCAVEFEVKAFCAESQDAKVRKRSSVGLMIRKVQYAPEKLGPAPSVETTRDFLMSDKPLHLEASLEKQTYYHGEPINVRVKINNQSNKNVRNIILSVEQNANVVLYCNDNYMKVVATE---DSGHSVDSGA-KLEKVYTLLPLLANNRERRGIALDGKLKHEDTNLASSSIIKEGVQKEVLGIMVSYRVVVKLIVGGMMGSSEVGVELPFQLMHPKPDA 354          
BLAST of Beta-arrestin vs. Ensembl Xenopus
Match: ARRB1 (arrestin beta 1 [Source:NCBI gene;Acc:100486349])

HSP 1 Score: 369.777 bits (948), Expect = 1.737e-124
Identity = 199/394 (50.51%), Postives = 270/394 (68.53%), Query Frame = 2
Query:   77 VFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            V  +S P   +T+YLGKRDF+D   +VDP++G+VL+D +Y+K++KVF+ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVDYE+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E D+   ++P    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L + ++ E +GIIV Y ++V+L++  G  D+ +E+PF L HP P  +  +   V  +  P+D+N I+ D N      +++ +FEDFAR RL G
Sbjct:    3 VSGRSCPPVALTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPEEKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPINVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAVEEADNDV-VAPSST-FCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLRDGANKEILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKPTEE-PLHREVPENEAPIDTNLIEFDTN------DDDIVFEDFARQRLKG 386          
BLAST of Beta-arrestin vs. Ensembl Xenopus
Match: ARRB1 (arrestin beta 1 [Source:NCBI gene;Acc:100486349])

HSP 1 Score: 367.081 bits (941), Expect = 3.298e-123
Identity = 198/392 (50.51%), Postives = 269/392 (68.62%), Query Frame = 2
Query:  104 KITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFG-------TSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            K+T+YLGKRDF+D   +VDP++G+VL+D +Y+K++KVF+ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVDYE+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E D+   ++P    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L + ++ E +GIIV Y ++V+L++  G       +SD+ +E+PF L HP P  +  +   V  +  P+D+N I+ D N      +++ +FEDFAR RL G
Sbjct:   25 KLTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPEEKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPINVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAVEEADNDV-VAPSST-FCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLRDGANKEILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPTEE-PLHREVPENEAPIDTNLIEFDTN------DDDIVFEDFARQRLKG 407          
BLAST of Beta-arrestin vs. Ensembl Xenopus
Match: ARRB1 (arrestin beta 1 [Source:NCBI gene;Acc:100486349])

HSP 1 Score: 367.081 bits (941), Expect = 3.597e-123
Identity = 203/412 (49.27%), Postives = 278/412 (67.48%), Query Frame = 2
Query:   41 MDEGTEKKLGTRVF----KKSSPNN--KITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            +  GTE  LGT  +    +  +P    ++T+YLGKRDF+D   +VDP++G+VL+D +Y+K++KVF+ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVDYE+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E D+   ++P    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L + ++ E +GIIV Y ++V+L++  G  D+ +E+PF L HP P  +  +   V  +  P+D+N I+ D N      +++ +FEDFAR RL G
Sbjct:    5 LAAGTEVGLGTAAYGLMIQVLTPCVLLQLTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPEEKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPINVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAVEEADNDV-VAPSST-FCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLRDGANKEILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKPTEE-PLHREVPENEAPIDTNLIEFDTN------DDDIVFEDFARQRLKG 406          
BLAST of Beta-arrestin vs. Ensembl Xenopus
Match: ARRB1 (arrestin beta 1 [Source:NCBI gene;Acc:100486349])

HSP 1 Score: 365.925 bits (938), Expect = 6.046e-123
Identity = 199/397 (50.13%), Postives = 271/397 (68.26%), Query Frame = 2
Query:   68 GTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            G  +F  S+    +T+YLGKRDF+D   +VDP++G+VL+D +Y+K++KVF+ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVDYE+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E D+   ++P    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L + ++ E +GIIV Y ++V+L++  G  D+ +E+PF L HP P  +  +   V  +  P+D+N I+ D N      +++ +FEDFAR RL G
Sbjct:    4 GPIIFNSST----LTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPEEKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPINVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAVEEADNDV-VAPSST-FCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLRDGANKEILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKPTEE-PLHREVPENEAPIDTNLIEFDTN------DDDIVFEDFARQRLKG 386          
BLAST of Beta-arrestin vs. Ensembl Xenopus
Match: ARRB1 (arrestin beta 1 [Source:NCBI gene;Acc:100486349])

HSP 1 Score: 366.696 bits (940), Expect = 6.453e-123
Identity = 204/419 (48.69%), Postives = 280/419 (66.83%), Query Frame = 2
Query:   41 MDEGTEKKLGTRVF----KKSSPNN--KITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFG-------TSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            +  GTE  LGT  +    +  +P    ++T+YLGKRDF+D   +VDP++G+VL+D +Y+K++KVF+ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVDYE+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E D+   ++P    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L + ++ E +GIIV Y ++V+L++  G       +SD+ +E+PF L HP P  +  +   V  +  P+D+N I+ D N      +++ +FEDFAR RL G
Sbjct:    5 LAAGTEVGLGTAAYGLMIQVLTPCVLLQLTVYLGKRDFVDHIDVVDPVDGVVLVDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPEEKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPINVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAVEEADNDV-VAPSST-FCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLRDGANKEILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPTEE-PLHREVPENEAPIDTNLIEFDTN------DDDIVFEDFARQRLKG 414          
BLAST of Beta-arrestin vs. Ensembl Mouse
Match: Arrb1 (arrestin, beta 1 [Source:MGI Symbol;Acc:MGI:99473])

HSP 1 Score: 414.075 bits (1063), Expect = 6.709e-142
Identity = 209/400 (52.25%), Postives = 280/400 (70.00%), Query Frame = 2
Query:   68 GTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSD---FRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            GTRVFKK+SPN K+T+YLGKRDF+D   LVDP++G+VL+D +Y+K+++V++ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVDYE+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E DD   ++P    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L E ++ E +GIIV Y ++V+L++  G  D+ +E+PF L HP P  +     +P S +    P+D+N I+ D N      +++ +FEDFAR RL G
Sbjct:    5 GTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHACPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDN--VAPSST-FCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKPKEEPPHREVPESET----PVDTNLIELDTN------DDDIVFEDFARQRLKG 390          
BLAST of Beta-arrestin vs. Ensembl Mouse
Match: Arrb1 (arrestin, beta 1 [Source:MGI Symbol;Acc:MGI:99473])

HSP 1 Score: 413.305 bits (1061), Expect = 1.373e-141
Identity = 210/407 (51.60%), Postives = 282/407 (69.29%), Query Frame = 2
Query:   68 GTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFG-------TSDIQLEIPFILTHPNPDSD---FRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            GTRVFKK+SPN K+T+YLGKRDF+D   LVDP++G+VL+D +Y+K+++V++ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVDYE+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E DD   ++P    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L E ++ E +GIIV Y ++V+L++  G       +SD+ +E+PF L HP P  +     +P S +    P+D+N I+ D N      +++ +FEDFAR RL G
Sbjct:    5 GTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHACPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDN--VAPSST-FCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPESET----PVDTNLIELDTN------DDDIVFEDFARQRLKG 398          
BLAST of Beta-arrestin vs. Ensembl Mouse
Match: Arrb1 (arrestin, beta 1 [Source:MGI Symbol;Acc:MGI:99473])

HSP 1 Score: 411.764 bits (1057), Expect = 5.595e-141
Identity = 210/408 (51.47%), Postives = 281/408 (68.87%), Query Frame = 2
Query:   68 GTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGT--------SDIQLEIPFILTHPNPDSD---FRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            GTRVFKK+SPN K+T+YLGKRDF+D   LVDP++G+VL+D +Y+K+++V++ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVDYE+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E DD   ++P    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L E ++ E +GIIV Y ++V+L++  G         SD+ +E+PF L HP P  +     +P S +    P+D+N I+ D N      +++ +FEDFAR RL G
Sbjct:    5 GTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHACPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDN--VAPSST-FCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLAGRGVCFSDVAVELPFTLMHPKPKEEPPHREVPESET----PVDTNLIELDTN------DDDIVFEDFARQRLKG 399          
BLAST of Beta-arrestin vs. Ensembl Mouse
Match: Arrb2 (arrestin, beta 2 [Source:MGI Symbol;Acc:MGI:99474])

HSP 1 Score: 411.379 bits (1056), Expect = 5.725e-141
Identity = 212/412 (51.46%), Postives = 290/412 (70.39%), Query Frame = 2
Query:   59 KKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGK-IRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLN---PLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG-NETNCEE 1279
            +K GTRVFKKSSPN K+T+YLGKRDF+D    VDP++G+VL+D DY+KD+KVF+ +   FRYGR+DLDVLGL+FRKDLF++T Q +PP  +     T+LQ+RL+ KLG +A PF F IP   P SVTLQP PED GK CGVD+E++ + +   + K+HKRNSVRL+IRK+ FA   PGPQ   E T+ F M   + + LE SLDKE YYHGE + VNV V N S K ++KIR+ V Q ADI LF+ A YKC V ++E DD   +SP    +CK++ + PLLS+NR+KRGLALDG L++EDTNLASST++ E ++ E +GI+V Y ++V+L++  G  D+ +E+PF+L HP P     +P   S       P+D+N I+ D N   +  +++ +FEDFARLRL G  + +C++
Sbjct:    3 EKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPGPQPSAETTRHFLMSDRRSLHLEASLDKELYYHGEPLNVNVHVTNNSAKTVKKIRVSVRQYADICLFSTAQYKCPVAQLEQDDQ--VSPSST-FCKVYTITPLLSDNREKRGLALDGQLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPHDHITLPRPQSAPRETDVPVDTNLIEFDTN---YATDDDIVFEDFARLRLKGMKDDDCDD 407          
BLAST of Beta-arrestin vs. Ensembl Mouse
Match: Arrb2 (arrestin, beta 2 [Source:MGI Symbol;Acc:MGI:99474])

HSP 1 Score: 411.379 bits (1056), Expect = 5.725e-141
Identity = 212/412 (51.46%), Postives = 290/412 (70.39%), Query Frame = 2
Query:   59 KKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGK-IRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLN---PLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG-NETNCEE 1279
            +K GTRVFKKSSPN K+T+YLGKRDF+D    VDP++G+VL+D DY+KD+KVF+ +   FRYGR+DLDVLGL+FRKDLF++T Q +PP  +     T+LQ+RL+ KLG +A PF F IP   P SVTLQP PED GK CGVD+E++ + +   + K+HKRNSVRL+IRK+ FA   PGPQ   E T+ F M   + + LE SLDKE YYHGE + VNV V N S K ++KIR+ V Q ADI LF+ A YKC V ++E DD   +SP    +CK++ + PLLS+NR+KRGLALDG L++EDTNLASST++ E ++ E +GI+V Y ++V+L++  G  D+ +E+PF+L HP P     +P   S       P+D+N I+ D N   +  +++ +FEDFARLRL G  + +C++
Sbjct:    3 EKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPMPNPPRPPTRLQDRLLKKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKSHKRNSVRLIIRKVQFAPETPGPQPSAETTRHFLMSDRRSLHLEASLDKELYYHGEPLNVNVHVTNNSAKTVKKIRVSVRQYADICLFSTAQYKCPVAQLEQDDQ--VSPSST-FCKVYTITPLLSDNREKRGLALDGQLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPHDHITLPRPQSAPRETDVPVDTNLIEFDTN---YATDDDIVFEDFARLRLKGMKDDDCDD 407          
BLAST of Beta-arrestin vs. UniProt/SwissProt
Match: sp|P51485|ARRB_CAEEL (Beta-arrestin arr-1 OS=Caenorhabditis elegans OX=6239 GN=arr-1 PE=1 SV=2)

HSP 1 Score: 419.083 bits (1076), Expect = 9.794e-143
Identity = 221/426 (51.88%), Postives = 301/426 (70.66%), Query Frame = 2
Query:   32 MIDMDEGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKD-KKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTN-SIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMS--DGPDGKTHKR----NSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPD-----SDFRIPN-SVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNET 1267
            M+D D    KK GTRVFKK+SPN KIT YLGKRDF+D+   VD I+G+VL+D +Y+KD +KV  H+LA FRYGR+DLDVLGLTFRKDL   T Q+YP T+ SI   L++LQERL  KLG NA PF F++   + +SVTLQP P D GKPCGVDYELK +++  DG  G+  K+    N+VRL IRKLT+A  +  PQ   +V+K F M  G + +E SLDKE YYHGESI+VNV + N SNK ++K+++ ++Q+ADI LFT A Y C V  +E ++GFP+ PG     K+F +CPLLSNN+DKRGLALDG L++EDTNLASST+L+  +  E++GI+V+Y ++VR +LG    ++  E+PF LTH  P      +D  +P+   +N   P+D + I     +L+ + +++ IFEDFAR+RL+GN++
Sbjct:    1 MVDED----KKSGTRVFKKTSPNGKITTYLGKRDFIDRGDYVDLIDGMVLIDEEYIKDNRKVTAHLLAAFRYGREDLDVLGLTFRKDLISETFQVYPQTDKSISRPLSRLQERLKRKLGANAFPFWFEVAPKSASSVTLQPAPGDTGKPCGVDYELKTFVAVTDGSSGEKPKKSALSNTVRLAIRKLTYAPFESRPQPMVDVSKYFMMSSGLLHMEVSLDKEMYYHGESISVNVHIQNNSNKTVKKLKIYIIQVADICLFTTASYSCEVARIESNEGFPVGPGGT-LSKVFAVCPLLSNNKDKRGLALDGQLKHEDTNLASSTILDSKTSKESLGIVVQYRVKVRAVLGPLNGELFAELPFTLTHSKPPESPERTDRGLPSIEATNGSEPVDIDLIQL-HEELEPRYDDDLIFEDFARMRLHGNDS 420          
BLAST of Beta-arrestin vs. UniProt/SwissProt
Match: sp|Q4R562|ARRB1_MACFA (Beta-arrestin-1 OS=Macaca fascicularis OX=9541 GN=ARRB1 PE=2 SV=1)

HSP 1 Score: 417.157 bits (1071), Expect = 2.302e-142
Identity = 210/404 (51.98%), Postives = 283/404 (70.05%), Query Frame = 2
Query:   68 GTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNETNCEE 1279
            GTRVFKK+SPN K+T+YLGKRDF+D   LVDP++G+VL+D +Y+K+++V++ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVDYE+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E DD   ++P    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L E ++ E +GIIV Y ++V+L++  G  D+ +E+PF L HP P  +  +   V  +  P+D+N I+ D N      +++ +FEDFAR RL G + + EE
Sbjct:    5 GTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDT--VAPSST-FCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKPKEE-PLHREVPENQTPVDTNLIELDTN------DDDIVFEDFARQRLKGMKDDKEE 397          
BLAST of Beta-arrestin vs. UniProt/SwissProt
Match: sp|P49407|ARRB1_HUMAN (Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1 PE=1 SV=2)

HSP 1 Score: 415.231 bits (1066), Expect = 1.612e-141
Identity = 212/412 (51.46%), Postives = 286/412 (69.42%), Query Frame = 2
Query:   68 GTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFG-------TSDIQLEIPFILTHPNPDSDFRIPN-SVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNETNCEE 1279
            GTRVFKK+SPN K+T+YLGKRDF+D   LVDP++G+VL+D +Y+K+++V++ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVDYE+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E DD   ++P    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L E ++ E +GIIV Y ++V+L++  G       +SD+ +E+PF L HP P  +   P+  V  +  P+D+N I+ D N      +++ +FEDFAR RL G + + EE
Sbjct:    5 GTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDT--VAPSST-FCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEE--PPHREVPENETPVDTNLIELDTN------DDDIVFEDFARQRLKGMKDDKEE 405          
BLAST of Beta-arrestin vs. UniProt/SwissProt
Match: sp|Q8BWG8|ARRB1_MOUSE (Beta-arrestin-1 OS=Mus musculus OX=10090 GN=Arrb1 PE=1 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 9.606e-141
Identity = 210/407 (51.60%), Postives = 282/407 (69.29%), Query Frame = 2
Query:   68 GTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFG-------TSDIQLEIPFILTHPNPDSD---FRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            GTRVFKK+SPN K+T+YLGKRDF+D   LVDP++G+VL+D +Y+K+++V++ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVDYE+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N +NK ++KI++ V Q ADI LF  A YKC V   E DD   ++P    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L E ++ E +GIIV Y ++V+L++  G       +SD+ +E+PF L HP P  +     +P S +    P+D+N I+ D N      +++ +FEDFAR RL G
Sbjct:    5 GTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHACPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDN--VAPSST-FCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPESET----PVDTNLIELDTN------DDDIVFEDFARQRLKG 398          
BLAST of Beta-arrestin vs. UniProt/SwissProt
Match: sp|Q5RCR4|ARRB2_PONAB (Beta-arrestin-2 OS=Pongo abelii OX=9601 GN=ARRB2 PE=2 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 1.084e-140
Identity = 210/403 (52.11%), Postives = 284/403 (70.47%), Query Frame = 2
Query:   59 KKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLN---PLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            +K GTRVFKKSSPN K+T+YLGKRDF+D    VDP++G+VL+D DY+KD+KVF+ +   FRYGR+DLDVLGL+FRKDLF++T Q +PP  +     T+LQ+RL+ KLG +A PF F IP   P SVTLQP PED GK CGVD+E++ + +   + K+HKRNSVRL+IRK+ FA   PGPQ   E T+ F M    + LE SLDKE YYHGE + VNV V N S K ++KI++ V Q ADI LF+ A YKC V ++E DD   +SP    +CK++ + PLLS+NR+KRGLALDG L++EDTNLASST++ E ++ E +GI+V Y ++V+L++  G  D+ +E+PF+L HP P     +P   S       P+D+N I+ D N   +  +++ +FEDFARLRL G
Sbjct:    3 EKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQ--VSPSST-FCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTN---YATDDDIVFEDFARLRLKG 398          
BLAST of Beta-arrestin vs. TrEMBL
Match: T1EFX6 (Arrestin_C domain-containing protein OS=Helobdella robusta OX=6412 GN=20195478 PE=4 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 5.834e-175
Identity = 248/418 (59.33%), Postives = 315/418 (75.36%), Query Frame = 2
Query:   32 MIDMDEGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNP-DSDFRIPNSVSNDLNPLDSNGID-TDFNKLQFKQEE-----EFIFEDFARLRLYGNE 1264
            + D+D   +KKLGTRVFKKS PN+KIT+YLGKRDF+D    V+PI+G+VL+D DY+KD+KVF  +LA FRYGR+DLDVLGLTFRKDL L+T+Q+YPP +S  PSLT+LQERLI KLG NA PF F+IP  +PASVTLQP P D GKPCGVDYELK Y++  PD K H+RNSV+L IRKLTFA   P PQ   E  K+F M  G +RLE +LDKEKYYHGESI VNV VDN + + ++KI++ V Q ADI LF+ A YKC V E++ ++GFPI P Q G+CK++ + P+LSNNRDKRGLALDG L++EDTNLASST++  NS  EN+GI+V+Y ++VRLILGF +SD+ +E+PF LTHP P D+   +    S++     S G +  + N + F Q+E     + IFEDFARLRL G+E
Sbjct:    7 LSDVDNDGQKKLGTRVFKKSCPNSKITVYLGKRDFMDYLDHVEPIDGVVLVDPDYLKDRKVFAQILAAFRYGREDLDVLGLTFRKDLLLATKQVYPPPHSKPPSLTRLQERLIKKLGPNAFPFCFEIPTSSPASVTLQPAPGDTGKPCGVDYELKAYVASEPDEKPHRRNSVQLAIRKLTFAPEQPAPQPSAEAVKEFLMSSGTLRLEATLDKEKYYHGESITVNVLVDNNAGRSVKKIKISVRQYADICLFSTAQYKCNVAEIDSEEGFPIHPSQTGFCKVYQLTPILSNNRDKRGLALDGKLKHEDTNLASSTIITSNSQKENLGIVVQYKVKVRLILGFTSSDLSVELPFTLTHPKPIDASPVVSRPQSSNQK---SEGAEVVEKNLINFDQDEPNSCDDIIFEDFARLRLKGHE 421          
BLAST of Beta-arrestin vs. TrEMBL
Match: A0A1V1FN69 (Beta-arrestin OS=Ambigolimax valentianus OX=1338344 PE=2 SV=1)

HSP 1 Score: 504.212 bits (1297), Expect = 1.239e-173
Identity = 248/422 (58.77%), Postives = 312/422 (73.93%), Query Frame = 2
Query:   47 EGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPS--LTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNP------LDSNGIDTDFNKLQF--KQEEEFIFEDFARLRLYGNETNCEEA 1282
            E  +KK GTRVFKKS PN K+T YLGKRDF+D    +DPI+G++L+D DY+KD+KVF H+LA FRYGR+DLDVLGLTFRKDL+LS+ Q+YPP      S  LT+LQERLI KLG NA PF F++P  +PASVTLQP P D GKPCGVDYELK +++D  D K HKRNSVRL IRKLT+A  +P PQ   E  KDF M  G +RLE SLDKEKYYHGESIA+NV VDN +NK ++KI++ V Q ADI LF+ A YKC V ++E ++GFPI   Q G+CK+FHM PLLSNNRDKRGLALDG L++EDTNLASST++ E S  E++GI+V Y ++V+LI+GF + ++ +E+PF LTHP P  D   P+  ++   P       D+N I  D N   F   ++++FIFEDFARLRL G+E +  EA
Sbjct:   16 EDQQKKQGTRVFKKSCPNGKVTTYLGKRDFIDHLSHIDPIDGVILVDPDYLKDRKVFAHILAAFRYGREDLDVLGLTFRKDLYLSSMQVYPPVKDSKESKPLTRLQERLIKKLGPNAYPFFFELPPNSPASVTLQPAPGDTGKPCGVDYELKTFVADNIDEKPHKRNSVRLAIRKLTYAPEEPAPQPNAEALKDFIMSPGSMRLEASLDKEKYYHGESIAINVLVDNNTNKTVKKIKISVRQFADICLFSTAQYKCTVADLESEEGFPIQSSQTGFCKVFHMTPLLSNNRDKRGLALDGKLKHEDTNLASSTIMTEKSQKESLGIVVSYRVKVKLIMGFTSGELAVELPFTLTHPKP-PDSPAPSRSASTAPPEGGDASFDTNLIQLDTNGEAFYGDKDDDFIFEDFARLRLKGHEGDDTEA 436          
BLAST of Beta-arrestin vs. TrEMBL
Match: A0A2T7NC68 (Arrestin_C domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_21283 PE=4 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 3.158e-172
Identity = 250/413 (60.53%), Postives = 307/413 (74.33%), Query Frame = 2
Query:   68 GTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPT--NSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDL----NPLDSNGIDTDFNKLQF--KQEEEFIFEDFARLRLYGNETNCEEA 1282
            G  VFKKSSPN KIT YLGKRDF+D    +DPI+G+VL+D +Y+KD+KV+ H+LA FRYGR+DLDVLGLTFRKDL+LS+ Q+YPP   +S    LT+LQERLI KLG NA PF F++P   PASVTLQP P D GKPCGVDYELK Y++D  D K HKRNSVRL IRKLT+A  +P PQ   E  KDF M  G IRLE SLDKEKYYHGESIA+NV VDN +NK ++K++L V Q ADI LF+ A YKC V EME ++GFPI P Q G+CK++H+CPLL+NNRDKRGLALDG L++EDTNLASST++ E S  EN+GI+V Y ++V+LILGFG+ D+ +E+PF LTHP P          S        P+D+N I  D N   F   ++++FIFEDFARLRL G+E +  EA
Sbjct:  180 GPSVFKKSSPNGKITTYLGKRDFIDHLTHIDPIDGVVLVDPEYLKDRKVYAHILAAFRYGREDLDVLGLTFRKDLYLSSMQVYPPVKDHSEPKPLTRLQERLIKKLGPNAYPFYFELPPNAPASVTLQPAPGDTGKPCGVDYELKTYVADNVDEKPHKRNSVRLAIRKLTYAPEEPAPQPSAEAVKDFMMSPGSIRLEASLDKEKYYHGESIALNVLVDNNTNKTVKKVKLSVRQFADICLFSTAQYKCTVAEMESEEGFPIQPSQTGFCKVYHLCPLLTNNRDKRGLALDGKLKHEDTNLASSTIMTEKSQKENLGIVVSYRVKVKLILGFGSGDLSVELPFTLTHPKPIESPPPSRPPSMVPPEVETPVDANLIKLDTNGEPFYADKDDDFIFEDFARLRLKGHEGDDTEA 592          
BLAST of Beta-arrestin vs. TrEMBL
Match: R7TPP3 (Arrestin_C domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_177196 PE=4 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 1.115e-171
Identity = 246/415 (59.28%), Postives = 313/415 (75.42%), Query Frame = 2
Query:   74 RVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRI--------PNSVSNDLN--PLDSNGIDTDFNKLQF--KQEEEFIFEDFARLRLYGNETNCEEA 1282
            RVFKKSSPN+KIT+Y+GKRDF+D    +DPI+G+VL+D DY+KD+KVF HVLA FRYGR+DLDVLGLTFRKDLFL++ Q+YPP      +LT+LQERLI KLG NA PF F++P  +PASVTLQP P D GKPCGVDYELK Y+++  D K HKRNSV L IRKLT+A  +P PQ   E TK+F M  G +RLE SL+KEKYYHGESIAVNV VDN SNK ++K+++ V Q ADI LF+ A YKCVV ++E ++GFP++P Q G+CK++++ PLL NNRDKRGLALDG L++EDTNLASST++ + +  EN+GI+V+Y ++VRLILGFG+SD+ +E+PF LTHP P              P +  N  N  P+D+N I  D N   +   Q+++FIFEDFARLRL G+E    EA
Sbjct:    9 RVFKKSSPNSKITVYIGKRDFIDHLTHIDPIDGVVLVDPDYLKDRKVFAHVLAAFRYGREDLDVLGLTFRKDLFLASTQVYPPDKEPKRTLTRLQERLIQKLGPNAYPFFFELPACSPASVTLQPAPGDTGKPCGVDYELKTYVAENQDDKPHKRNSVSLAIRKLTYAPEEPAPQPSAEATKEFMMSQGNLRLECSLEKEKYYHGESIAVNVLVDNNSNKSVKKVKISVRQYADICLFSTAQYKCVVADLETEEGFPVAPSQTGFCKVYYLTPLLKNNRDKRGLALDGKLKHEDTNLASSTIITDQNQKENLGIVVQYKVKVRLILGFGSSDLSVELPFTLTHPKPPESPPPSRPTSVAPPTNPENSDNSAPVDTNLIQLDTNGEGYYANQDDDFIFEDFARLRLKGHEGEDTEA 423          
BLAST of Beta-arrestin vs. TrEMBL
Match: A0A1I8J0I0 (Arrestin_C domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010879g1 PE=4 SV=1)

HSP 1 Score: 497.664 bits (1280), Expect = 1.635e-170
Identity = 244/436 (55.96%), Postives = 311/436 (71.33%), Query Frame = 2
Query:   47 EGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIP-HMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDL-ENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSD-------------------FRIPNSVSNDLNPLDSNGIDTDF----------NKLQFKQEEEFIFEDFARLRLYGN 1261
            +   ++ GTRVFKKSSPN KIT YLGKRDF+D    VDPI+G+VL+D DY+KD+KV+ HVLA FRYGR+DLDVLGLTFRKDL+++  Q+YPP       LT+LQERLI KLG NA PF F++P   +PASVTLQP P D+GKPCGVDYELK Y+++  DGK+HKR++VRL IRKLT+A   PGPQ   E TK+F M  G +RLE SLDKEKYYHGESIA+NV VDN ++K ++K+R+ V Q+ADI LF+   YKC V E+E ++GFPI P Q GWCK++H+CPLL+NNRDKRGLALDG L++EDTNLASST+L + S   EN+GI+V Y ++VRL+LGFG+SD+ +E+PF+LTHP P  +                      P   +      DS+ +DTD             L    +++ IFEDFARLRL G+
Sbjct:   38 QAQSQRQGTRVFKKSSPNGKITAYLGKRDFVDHLTHVDPIDGVVLVDPDYMKDRKVYAHVLAAFRYGREDLDVLGLTFRKDLYIACMQVYPPIKDNAKPLTRLQERLIKKLGDNAHPFFFELPPQQSPASVTLQPGPNDSGKPCGVDYELKTYVAETADGKSHKRSTVRLAIRKLTYAPEQPGPQPSAETTKEFIMSAGCLRLEASLDKEKYYHGESIAINVLVDNNTSKTVKKVRISVRQIADICLFSPNSYKCGVAELESEEGFPIGPSQTGWCKVYHVCPLLANNRDKRGLALDGQLKHEDTNLASSTILKDASQSKENLGIVVNYRVKVRLVLGFGSSDVCVELPFVLTHPKPCEEDLSEAGDAPAAASAGSTSKAAAPEPAAAAAAAADSDILDTDLIHLDAGSDGARSLHLHPDDDLIFEDFARLRLQGH 473          
BLAST of Beta-arrestin vs. Ensembl Cavefish
Match: arrb2a (arrestin red cell [Source:NCBI gene;Acc:103028079])

HSP 1 Score: 414.461 bits (1064), Expect = 4.216e-142
Identity = 208/415 (50.12%), Postives = 284/415 (68.43%), Query Frame = 2
Query:   62 KLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFG-------TSDIQLEIPFILTHPNP-DSDFRIPNSVSNDLN-PLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNETNCEE 1279
            K GTRVFKKSSPN KIT+YLGKRDF+D    VDP++G++L+D +Y+KD+KVF+ +   FRYGR+DLDVLGL+FRKDL++ST Q +PP        ++LQERL+ KLG  A PF F IP   P SVTLQP PED GK CGVDYE++ + +   + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N S K ++++++ V Q ADI LF+ A YKC V ++E DD    S     +CK++ + P L+NNR+KRGLALDG L++EDTNLASST++ E  + E +G++V Y ++V+L++  G         D+ +E+PF+L HP P D     P S   +++ P+D+N I+ + N   F Q+++ +FEDFARLRL G   + +E
Sbjct:    4 KAGTRVFKKSSPNCKITVYLGKRDFVDHLDQVDPVDGVILVDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYISTFQAFPPIQEERKPNSRLQERLLKKLGQQAHPFHFTIPQNLPCSVTLQPGPEDTGKACGVDYEIRAFCARSVEEKIHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQIEADDQVSSSS---TFCKVYTLTPTLNNNREKRGLALDGKLKHEDTNLASSTIVKEGCNKEVLGVLVSYRVKVKLVVSRGGLLSSLLERDVSVELPFVLMHPKPIDLSTSRPASAVPEVDPPIDTNLIEFETN--SFAQDDDLVFEDFARLRLKGTTEDKDE 413          
BLAST of Beta-arrestin vs. Ensembl Cavefish
Match: arrb2a (arrestin red cell [Source:NCBI gene;Acc:103028079])

HSP 1 Score: 397.897 bits (1021), Expect = 3.132e-135
Identity = 208/444 (46.85%), Postives = 284/444 (63.96%), Query Frame = 2
Query:   62 KLGTRVFKKSSPNNK------------------------------------ITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNP-DSDFRIPNSVSNDLN-PLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNETNCEE 1279
            K GTRVFKKSSPN K                                    IT+YLGKRDF+D    VDP++G++L+D +Y+KD+KVF+ +   FRYGR+DLDVLGL+FRKDL++ST Q +PP        ++LQERL+ KLG  A PF F IP   P SVTLQP PED GK CGVDYE++ + +   + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N S K ++++++ V Q ADI LF+ A YKC V ++E DD    S     +CK++ + P L+NNR+KRGLALDG L++EDTNLASST++ E  + E +G++V Y ++V+L++  G  D+ +E+PF+L HP P D     P S   +++ P+D+N I+ + N   F Q+++ +FEDFARLRL G   + +E
Sbjct:    4 KAGTRVFKKSSPNCKVNFTAYFQFFFEHLSLFLFVIVFIMHELIMHSVLFQITVYLGKRDFVDHLDQVDPVDGVILVDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYISTFQAFPPIQEERKPNSRLQERLLKKLGQQAHPFHFTIPQNLPCSVTLQPGPEDTGKACGVDYEIRAFCARSVEEKIHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQIEADDQVSSSS---TFCKVYTLTPTLNNNREKRGLALDGKLKHEDTNLASSTIVKEGCNKEVLGVLVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPIDLSTSRPASAVPEVDPPIDTNLIEFETN--SFAQDDDLVFEDFARLRLKGTTEDKDE 441          
BLAST of Beta-arrestin vs. Ensembl Cavefish
Match: arrb1 (arrestin, beta 1 [Source:ZFIN;Acc:ZDB-GENE-060824-1])

HSP 1 Score: 390.193 bits (1001), Expect = 3.581e-133
Identity = 189/346 (54.62%), Postives = 249/346 (71.97%), Query Frame = 2
Query:   74 RVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNP 1111
            RVFKK+SPN K+T+YLGKRDF+D   LV+P++G+VL+D +Y+K++KVF+ +   FRYGR+DLDVLGLTFRKDLF++  Q +PP       LT+LQERLI KLG +A PF F+IP   P SVTLQP PED GK CGVD+E+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N +NK ++K+++ V Q ADI LF  A YKC V   E DD   I      +CK++ + P L+NNR+KRGLALDG L++EDTNLASST+L E ++ E +GIIV Y ++V+L++  G  D+ +E+PF L HP P
Sbjct:   17 RVFKKASPNGKLTVYLGKRDFVDHVDLVEPVDGVVLIDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFVANIQAFPPVPEEKKGLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDFEVKAFCAENVEEKIHKRNSVRLIIRKVQYAPEKPGPQPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKMKISVRQYADICLFNTAQYKCPVATEESDD---IVAPSATFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANKEILGIIVSYKVKVKLVVSRG-GDVAVELPFTLMHPKP 358          
BLAST of Beta-arrestin vs. Ensembl Cavefish
Match: arrb2b (arrestin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1332])

HSP 1 Score: 380.948 bits (977), Expect = 2.108e-129
Identity = 192/395 (48.61%), Postives = 264/395 (66.84%), Query Frame = 2
Query:   74 RVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            RVFKKSSPN K+T+YLGKRDF+D    VDP++G++L+D +Y+KD+KVF+ +   FRYGR+DLDVLGL+FRKDL++ST Q +PP       L++LQERL+ KLG +A PF F IP   P SVTLQP PED GK CGVD+E++ + +   + K HKR  V+       +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N S K ++++++ V Q ADI LF+ A YKC V ++E DD   +SP    +CK++ + P L+NNR+KRGLALDG L++EDTNLASST++ + S+ E +GI+V Y ++V+L++  G  D+ +E+PF+L HP P                  S+   +      F Q+++F+FEDFARLRL G
Sbjct:    8 RVFKKSSPNCKLTVYLGKRDFVDHLDHVDPVDGVLLIDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYISTFQAFPPLPEEHKPLSRLQERLLKKLGQHAHPFNFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSVEEKIHKRCRVQ-------YAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQVEADDQ--VSPSST-FCKVYTLTPTLNNNREKRGLALDGKLKHEDTNLASSTIVKDVSNKEVLGILVSYRVKVKLVVSRG-GDVSVELPFVLMHPKPSEQ--------------PSSRPQSGMYATNFSQDDDFVFEDFARLRLKG 377          
BLAST of Beta-arrestin vs. Ensembl Cavefish
Match: sagb (S-antigen; retina and pineal gland (arrestin) b [Source:ZFIN;Acc:ZDB-GENE-050913-98])

HSP 1 Score: 306.605 bits (784), Expect = 1.158e-99
Identity = 149/341 (43.70%), Postives = 222/341 (65.10%), Query Frame = 2
Query:  104 KITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSL-TKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILG--FGTSDIQLEIPFILTHPNPDS 1117
            ++ +YLG+RDF+D    VDP++G+VL+D +  K KKV++ +   FRYGRDD+DVLG+ FR+D+FL T+Q+YPP   +  S+ TKLQERL+ KLG NA PF F+ P   P SV L P P D GK C V++E+K + +D  D K  KR+SVRL IRK+ +A    GP    E T +F M    + +  SLDK+ YYHG++I  NV +DN+S+K ++ I + V Q+ +++L++   Y   V  +  D+     P      K++ + PLL +NR+KRGLA+DG L++EDTNLASST++      E +G++V Y + V+       G+S++ +++PFIL HP PD+
Sbjct:   97 QVGVYLGRRDFVDHCDFVDPVDGVVLIDPEQTKGKKVYVMLSCTFRYGRDDMDVLGVAFRRDIFLCTRQVYPPLQDVERSIHTKLQERLLRKLGINAYPFFFEFPDNLPCSVALHPTPTDVGKHCAVEFEVKAFCADNQDEKAQKRSSVRLAIRKVQYAPDQGGPAPSNETTCEFMMSDKPLHMSISLDKDTYYHGDTIHANVVIDNSSSKDVKNITVSVEQITNVVLYSNDKY---VRTIACDESSESVPSGTSMKKVYSLRPLLDSNREKRGLAVDGKLKHEDTNLASSTIVKAEVLKEVLGMVVSYRVVVKGTAAGMIGSSEVTVDVPFILMHPKPDA 434          
BLAST of Beta-arrestin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004302.1 (pep scaffold:Pmarinus_7.0:GL490722:800:6194:-1 gene:ENSPMAG00000003892.1 transcript:ENSPMAT00000004302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 8.897e-53
Identity = 94/193 (48.70%), Postives = 124/193 (64.25%), Query Frame = 2
Query:  494 KVYMSDGPDGKTH---KRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQ-LADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFG 1060
            +V  S  P    H   +RNSVRL+IRK+ FA   PGPQ   E T+ F M    + LE SLDK  YYHGE I VNV V N S K ++KI++ V +  ADI LF  A YKC V   E DD   + P     CK++ + PLL++NRDKRGLALDG L++EDTNLASST++ + ++ E +GI+V Y ++V+LI+  G
Sbjct:    4 QVNRSSAPANTVHHSRRRNSVRLVIRKVQFAPEKPGPQPMAETTRQFLMSDKPLHLEASLDKMIYYHGEPINVNVHVTNNSTKTVKKIKMTVKEFFADICLFNTAQYKCPVATEEGDD--TVGPSST-LCKVYTLTPLLASNRDKRGLALDGKLKHEDTNLASSTIVQDGANKEVLGILVSYRVKVKLIVSRG 193          
BLAST of Beta-arrestin vs. Ensembl Nematostella
Match: EDO43535 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYJ9])

HSP 1 Score: 355.91 bits (912), Expect = 3.438e-121
Identity = 176/294 (59.86%), Postives = 219/294 (74.49%), Query Frame = 2
Query:  101 NKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKD-KKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTV 979
             +IT YLGKRDF+D    +DPI+G+VL+D +YVKD KKVF HVLA FRYGR+DLDVLGLTFRKDLFL+T Q+YPP      +LT+LQERL+ KLG NA PF F++P  +P+SVTLQP P D GKPCGVDYELK Y+++  + K HKR++VRL IRKLT+AT  P PQ F E  KDF M    + +E SLDK  YYHGE+IAVNV + N S++  +KI++ V Q ADI LF+ A YKC V  +E +DGFP+ P      K++ + PLL  NRDKRGLALDG L++EDTNLASST+
Sbjct:   12 TQITTYLGKRDFIDHVKHIDPIDGVVLVDPEYVKDGKKVFAHVLAAFRYGREDLDVLGLTFRKDLFLATVQVYPPKTDDQKALTRLQERLLKKLGSNAYPFKFELPPGSPSSVTLQPAPGDTGKPCGVDYELKTYVAESLEEKPHKRDTVRLAIRKLTYATEQPQPQPFSEGEKDFMMSQHPLHVEASLDKGLYYHGETIAVNVIISNRSSRNCKKIKITVRQFADICLFSTAQYKCPVASLESEDGFPVHPSGT-LTKVYCLTPLLGENRDKRGLALDGKLKHEDTNLASSTM 304          
BLAST of Beta-arrestin vs. Ensembl Nematostella
Match: EDO27814 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T880])

HSP 1 Score: 73.9442 bits (180), Expect = 2.677e-16
Identity = 39/94 (41.49%), Postives = 61/94 (64.89%), Query Frame = 2
Query:  998 LENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVS-----NDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNE 1264
            +EN+GIIV+Y ++VR+I+ +G  D+ LE+PF+L+HP P  D   P + +     N+   +D N ID D +  +    ++ IFEDFARLRL G++
Sbjct:    1 MENLGIIVQYKVKVRIIVAYG-GDLTLELPFMLSHPKPCEDPTPPPTPAKQPSNNEQAAVDHNLIDFDTDGPEQDNNDDLIFEDFARLRLKGSD 93          
BLAST of Beta-arrestin vs. Ensembl Medaka
Match: arrb2a (arrestin beta 2 [Source:NCBI gene;Acc:101159286])

HSP 1 Score: 407.912 bits (1047), Expect = 1.010e-139
Identity = 203/401 (50.62%), Postives = 281/401 (70.07%), Query Frame = 2
Query:   62 KLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNP-DSDFRIPNSVSNDLN-PLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            K GTRVFKKSSPN K+T+YLGKRDF+D    VDP++G++L+D +Y+KD+KVF+ +   FRYGR+DLDVLGL+FRKDL++ST Q +PP        ++LQ+RL+ KLG +A PF F IP   P SVTLQP PED GK CGVD+E++ + +   + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N S K ++++++ V Q ADI LF+ A YKC V ++E DD    S     +CK++ + P L  NR+KRGLALDG L++EDTNLASST++ + ++ E +GI+V Y ++V+L++  G  D+ +E+PFIL HP P +     P S   +++ P+D+N I+ + N     Q+++F+FEDFARLRL G
Sbjct:    4 KAGTRVFKKSSPNCKLTVYLGKRDFVDHLDHVDPVDGVILVDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYISTFQAFPPVPEERKPNSRLQDRLLKKLGQHAHPFYFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKIHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQLEADDQVSSSS---TFCKVYTLTPTLDKNREKRGLALDGKLKHEDTNLASSTIVKDVTNKEVLGILVSYRVKVKLVVSRG-GDVSVELPFILMHPKPVEPPLSRPQSAVPEMDPPIDTNLIEFETN---VSQDDDFVFEDFARLRLKG 397          
BLAST of Beta-arrestin vs. Ensembl Medaka
Match: arrb2a (arrestin beta 2 [Source:NCBI gene;Acc:101159286])

HSP 1 Score: 393.66 bits (1010), Expect = 4.373e-134
Identity = 198/401 (49.38%), Postives = 275/401 (68.58%), Query Frame = 2
Query:   71 TRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNP-DSDFRIPNSVSN----DLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            +RVFKKSSPN K+T+YLGKRDF+D    VDP++G++L+D +Y+KD+KVF+ +   FRYGR+DLDVLGL+FRKDL++ST Q +PP        ++LQ+RL+ KLG +A PF F IP   P SVTLQP PED GK CGVD+E++ + +   + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N S K ++++++ V Q ADI LF+ A YKC V ++E DD    S     +CK++ + P L  NR+KRGLALDG L++EDTNLASST++ + ++ E +GI+V Y ++V+L++  G  D+ +E+PFIL HP P +     P S  +      + L+   ++TD       Q+++F+FEDFARLRL G
Sbjct:    7 SRVFKKSSPNCKLTVYLGKRDFVDHLDHVDPVDGVILVDPEYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLYISTFQAFPPVPEERKPNSRLQDRLLKKLGQHAHPFYFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKIHKRNSVRLVIRKVQYAPEKPGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYADICLFSTAQYKCPVAQLEADDQVSSSS---TFCKVYTLTPTLDKNREKRGLALDGKLKHEDTNLASSTIVKDVTNKEVLGILVSYRVKVKLVVSRG-GDVSVELPFILMHPKPVEPPLSRPQSGRSTRRRHYSGLELVSMETD----HVSQDDDFVFEDFARLRLKG 399          
BLAST of Beta-arrestin vs. Ensembl Medaka
Match: arrb1 (arrestin beta 1 [Source:NCBI gene;Acc:101163309])

HSP 1 Score: 387.111 bits (993), Expect = 5.078e-131
Identity = 191/379 (50.40%), Postives = 260/379 (68.60%), Query Frame = 2
Query:   74 RVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGT-----------SDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGI 1177
            RVFKK+SPN K+T+YLGKRDF+D    VDP++G++L+D +Y+K++KVF+ +   FRYGR+DLDVLGLTFRKDLFL+  Q +PP      SLT+LQERLI KLG +A PFIF+IP   P SVTLQP PED GK CGVD+E+K + ++  + K HKRNSVRL+IRK+ +A   PGPQ   E T+ F M    + LE SLDKE YYHGE I+VNV V N +NK ++++++ V Q ADI LF  A YKC V   E DD   ++P    +CK+F + P L+NN++KRGLALDG L++EDTNLASST+L + ++ E +GI+V Y ++V+L++  G            SD+ +E+PF L HP P  +    +     L  + + G+
Sbjct:    7 RVFKKASPNGKLTVYLGKRDFVDHVDFVDPVDGVILIDPEYLKERKVFVTLTCAFRYGREDLDVLGLTFRKDLFLANIQAFPPLPEEKKSLTRLQERLIKKLGEHAYPFIFEIPLNLPCSVTLQPGPEDTGKACGVDFEVKAFCAENAEEKIHKRNSVRLVIRKVQYAPEKPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKRMKISVRQHADICLFNTAQYKCPVAVEESDDV--VAPSST-FCKVFTLTPFLANNQEKRGLALDGKLKHEDTNLASSTLLRDGANKEILGILVSYKVKVKLVVSRGGSPVMHLNLLCFSDVSVELPFTLMHPKPLEESIYKDGEQQQLQTVSARGV 382          
BLAST of Beta-arrestin vs. Ensembl Medaka
Match: kfharr-r2 (arrestin [Source:NCBI gene;Acc:100144345])

HSP 1 Score: 303.523 bits (776), Expect = 6.555e-99
Identity = 165/398 (41.46%), Postives = 251/398 (63.07%), Query Frame = 2
Query:   77 VFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSL-TKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMY-KCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILG--FGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYG 1258
            +FKK+  +  + +++GKRDF+D+   VDP++G++L+D + +  +KVF+ +   FRYGRDD+DV+G+ FR++L+L T+Q+YPP      ++ T++Q +L+ KLG+NA PF F+ P   P SV LQP P D GK C V++E+K + ++  D K  KR++V+L+IRK+ +A          E+TKDF M    + ++ +LDKE YYHGE I V+V V N SNK I+ I + V Q+A ++LF+   Y KCV  E   D+G  +S G     K++ + PLL+NNR++RG+ALDG L++EDTNLASS+V+ E    E MGI+V Y + V+LI+G   G+S++ LE+PF L HP PD+                           + + E+E +FE+F R  L G
Sbjct:    7 IFKKTCKDKSVGVFMGKRDFVDRVDSVDPVDGVILIDPEVLAGRKVFVTLSCTFRYGRDDMDVMGIAFRRELYLVTRQVYPPMQDRDKTVHTRVQAKLLRKLGNNAYPFFFEFPDNLPCSVALQPAPNDVGKQCAVEFEIKAFSAESQDAKVRKRSTVKLMIRKVQYAPESQEVAPSVEITKDFVMSDKPLHVQATLDKELYYHGEPIKVHVNVTNNSNKNIKNIIVSVDQVATVVLFSNDSYTKCVDYE---DNGDSVSAGAT-LKKVYTLLPLLANNRERRGIALDGKLKHEDTNLASSSVVKEGVLKEVMGIMVSYRVMVKLIVGGMMGSSEVGLEVPFRLMHPKPDA-------------------------VRESEMEDEMVFEEFKRSYLRG 375          
BLAST of Beta-arrestin vs. Ensembl Medaka
Match: kfharr-r2 (arrestin [Source:NCBI gene;Acc:100144345])

HSP 1 Score: 301.982 bits (772), Expect = 1.064e-98
Identity = 157/351 (44.73%), Postives = 238/351 (67.81%), Query Frame = 2
Query:   77 VFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSL-TKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMY-KCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILG--FGTSDIQLEIPFILTHPNPDS 1117
            +FKK+  +  + +++GKRDF+D+   VDP++G++L+D + +  +KVF+ +   FRYGRDD+DV+G+ FR++L+L T+Q+YPP      ++ T++Q +L+ KLG+NA PF F+ P   P SV LQP P D GK C V++E+K + ++  D K  KR++V+L+IRK+ +A          E+TKDF M    + ++ +LDKE YYHGE I V+V V N SNK I+ I + V Q+A ++LF+   Y KCV  E   D+G  +S G     K++ + PLL+NNR++RG+ALDG L++EDTNLASS+V+ E    E MGI+V Y + V+LI+G   G+S++ LE+PF L HP PD+
Sbjct:    7 IFKKTCKDKSVGVFMGKRDFVDRVDSVDPVDGVILIDPEVLAGRKVFVTLSCTFRYGRDDMDVMGIAFRRELYLVTRQVYPPMQDRDKTVHTRVQAKLLRKLGNNAYPFFFEFPDNLPCSVALQPAPNDVGKQCAVEFEIKAFSAESQDAKVRKRSTVKLMIRKVQYAPESQEVAPSVEITKDFVMSDKPLHVQATLDKELYYHGEPIKVHVNVTNNSNKNIKNIIVSVDQVATVVLFSNDSYTKCVDYE---DNGDSVSAGAT-LKKVYTLLPLLANNRERRGIALDGKLKHEDTNLASSSVVKEGVLKEVMGIMVSYRVMVKLIVGGMMGSSEVGLEVPFRLMHPKPDA 353          
BLAST of Beta-arrestin vs. Planmine SMEST
Match: SMESG000006894.1 (SMESG000006894.1)

HSP 1 Score: 852.432 bits (2201), Expect = 0.000e+0
Identity = 416/417 (99.76%), Postives = 416/417 (99.76%), Query Frame = 2
Query:   32 MIDMDEGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNETNCEEA 1282
            MIDMDEGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRL VVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNETNCEEA
Sbjct:    1 MIDMDEGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLHVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNETNCEEA 417          
BLAST of Beta-arrestin vs. Planmine SMEST
Match: SMESG000006894.1 (SMESG000006894.1)

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 413/414 (99.76%), Postives = 413/414 (99.76%), Query Frame = 2
Query:   41 MDEGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNETNCEEA 1282
            MDEGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRL VVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNETNCEEA
Sbjct:    1 MDEGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLHVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFEDFARLRLYGNETNCEEA 414          
BLAST of Beta-arrestin vs. Planmine SMEST
Match: SMESG000037193.1 (SMESG000037193.1)

HSP 1 Score: 522.316 bits (1344), Expect = 0.000e+0
Identity = 268/470 (57.02%), Postives = 328/470 (69.79%), Query Frame = 2
Query:   35 IDMD----EGTEK-KLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNSI----IP-----SLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNP-----------------------------DSDFRIPNSVSND-LNPLDSNGIDTDFNKLQ--------------FKQEEEFIFEDFARLRLYGNETN 1270
            +D+D    +GT K K  ++VFKKSSPN KIT YLGKRDF+D    VDP++G+VL+D DY+KD+KVF+HVLA FRYGR+DLDVLGLTFRKDL+L++QQ+YPP N +     P      LT+LQERLI KLGHNA PF F++PH TPASVTLQP P DNGKPCGVDYELK Y++D PD K HKRNSV+L IRKLT+A   P PQ   E+ KDF M  G +RLE SLDKEKYYHGESI+VNV VDN SNK I+KI++ V Q ADI L+    YKC+VDE+E +DGFPI   Q GWCK++ +CPLLSNNRDKRGLALDG L++EDTNLASST++NEN++ EN+GIIV+Y ++VRL+LGFGTSDI LE+PF L+HP P                              +D    ++V ND L   DS  ID D  +L                  +++ IFEDFARLRL G + N
Sbjct:    7 VDLDDIKKQGTSKEKETSKVFKKSSPNGKITAYLGKRDFIDYLDYVDPVDGVVLIDPDYLKDRKVFVHVLAAFRYGREDLDVLGLTFRKDLYLASQQVYPPLNKVEFDKTPDISNRKLTRLQERLIKKLGHNAYPFYFELPHNTPASVTLQPGPNDNGKPCGVDYELKTYVADNPDEKAHKRNSVKLAIRKLTYAPDKPSPQPSAEIVKDFIMSPGSLRLEASLDKEKYYHGESISVNVLVDNNSNKTIKKIKIAVRQHADICLYNATSYKCLVDELEFEDGFPIYSSQTGWCKVYKVCPLLSNNRDKRGLALDGKLKHEDTNLASSTIINENTNKENLGIIVQYKVKVRLVLGFGTSDISLELPFTLSHPKPADEEPNMSNFTFEDLHSNKSKIQSPEIISKTDVNTESNVPNDKLLESDSRIIDPDLIQLDTSCDNRNHTNKENILSADDDLIFEDFARLRLTGGDKN 476          
BLAST of Beta-arrestin vs. Planmine SMEST
Match: SMESG000078454.1 (SMESG000078454.1)

HSP 1 Score: 478.019 bits (1229), Expect = 5.398e-167
Identity = 242/425 (56.94%), Postives = 310/425 (72.94%), Query Frame = 2
Query:   41 MDEGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNS----------IIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQF-----------KQEEEFIFEDFARLRL 1252
            M +  + K GTRVFKKSS N KIT+Y+GKRD+L++N  +DPI+G+VL+D DYVKD++VF+HVLA FRYGR+DLDVLGLTFRKDL+L  QQ+YP   +             SLT+LQ RL+ KLG NA  F F +P  +PASVTLQP PED GKPCGVDYELKVY++   + KT KR+ V+L IRKLTFA + P      E+ K+F++  GK+ ++ SLDK+ Y+HGESI+V V+VDN+S K I+KI+LQV+Q+ADIMLFTRA+YKCV+DE+E +  FPI+PGQ GW   F MCPLLSNNR KRGLALDG LR+EDTNLASSTV+    ++E++GIIV Y +R++LILGF +SDIQLE+PF LTHPNP+ D  +        N  D  G+D   N L F           +Q+++ IF DFARL+L
Sbjct:    1 MADFIDSKGGTRVFKKSSLNGKITVYIGKRDYLERNDHIDPIDGVVLIDPDYVKDRRVFVHVLAAFRYGREDLDVLGLTFRKDLYLDYQQLYPKIENENCDLDKQQDQSNSLTRLQARLMQKLGTNAYAFYFNLPRNSPASVTLQPAPEDVGKPCGVDYELKVYVAKSFEDKTQKRSCVKLAIRKLTFAFNGPNIPPTDEIIKEFRLSSGKVIMDASLDKQTYFHGESISVTVSVDNSSTKTIKKIKLQVLQIADIMLFTRAVYKCVIDEVESEKFFPINPGQTGWNVTFSMCPLLSNNRHKRGLALDGKLRHEDTNLASSTVVQSKDNIEDLGIIVSYKVRIKLILGFTSSDIQLELPFNLTHPNPEEDLTV--------NTYD--GLDIFKNSLTFTDNYEPISSQAEQDDDLIFVDFARLKL 415          
BLAST of Beta-arrestin vs. Planmine SMEST
Match: SMESG000033976.1 (SMESG000033976.1)

HSP 1 Score: 327.02 bits (837), Expect = 2.245e-108
Identity = 164/391 (41.94%), Postives = 250/391 (63.94%), Query Frame = 2
Query:   77 VFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVLLDSDYVKDKKVFIHVLALFRYGRDDLD--VLGLTFRKDLFLSTQQIYPPTNSIIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQ--PDPEDNGKPCGVDYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQF-QEVTKDFKMCGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIMLFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLALDGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLEIPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFED 1234
            +FKKSS NNKI +YLG RDF D    +DPI+G++ +D +Y+K +KVF+ +  LFRYGR+D+D  + G+ F+KD  L  +QIYPP +     LT LQ+RL+ K  + A PF+F +PH  P SV LQ   D +   +PCG++Y LK ++ +G D K H  NSV ++IR+LT A  +P  Q + +E+ K F +  G I++E SL KE ++HGE+I +++ +DN S+  I++I+LQ++Q+ ++ LF    YK V+ E E     PI   + GW + F M P L++NR + GLALDG ++++DTN A+ST++ +      M IIV+Y IRV++I GFG  D +++IPFIL H     D   P+S+S D+N         +F++++ K +EE    D
Sbjct:    6 IFKKSSVNNKIVLYLGSRDFFDDLHTIDPIDGVITVDKNYIKGRKVFLRIQCLFRYGREDMDDVLSGVNFKKDFHLQCEQIYPPADGETNKLTPLQDRLMRKFNNEAYPFLFYLPHDIPCSVMLQLSEDEDPTNQPCGIEYSLKAFVGEGKDDKAHSHNSVSVIIRRLTTAPVNPRCQPYSKELQKPFHIHSGIIKIEASLPKEVFFHGETITLSLVIDNNSSNTIKRIKLQILQIVELTLFRPQTYKTVIYESETTSAMPIEASKTGWSQNFKMRPSLTHNRGQCGLALDGKMKHQDTNFATSTLVKDYRKKNTMAIIVQYSIRVKVITGFGGRDTEMDIPFILIHEPKKLD---PSSISEDINI-------ENFSRIKLKLDEELASSD 386          
The following BLAST results are available for this feature:
BLAST of Beta-arrestin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARRB13.220e-14252.10arrestin beta 1 [Source:HGNC Symbol;Acc:HGNC:711][more]
ARRB13.358e-14251.46arrestin beta 1 [Source:HGNC Symbol;Acc:HGNC:711][more]
ARRB22.256e-14152.11arrestin beta 2 [Source:HGNC Symbol;Acc:HGNC:712][more]
ARRB23.498e-13649.53arrestin beta 2 [Source:HGNC Symbol;Acc:HGNC:712][more]
ARRB21.079e-12949.88arrestin beta 2 [Source:HGNC Symbol;Acc:HGNC:712][more]
back to top
BLAST of Beta-arrestin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
arr-17.699e-14451.88Beta-arrestin arr-1 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Beta-arrestin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
krz1.062e-13851.15gene:FBgn0040206 transcript:FBtr0305268[more]
krz1.062e-13851.15gene:FBgn0040206 transcript:FBtr0085877[more]
Arr11.410e-10042.65gene:FBgn0000120 transcript:FBtr0307350[more]
Arr11.410e-10042.65gene:FBgn0000120 transcript:FBtr0081030[more]
Arr22.189e-9940.05gene:FBgn0000121 transcript:FBtr0076599[more]
back to top
BLAST of Beta-arrestin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arrb2b2.253e-14652.87arrestin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-040426... [more]
arrb13.432e-14351.82arrestin, beta 1 [Source:ZFIN;Acc:ZDB-GENE-060824-... [more]
arrb2a1.609e-13950.12arrestin, beta 2a [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
arrb2a2.572e-13849.28arrestin, beta 2a [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
saga3.081e-10144.89S-antigen; retina and pineal gland (arrestin) a [S... [more]
back to top
BLAST of Beta-arrestin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARRB11.737e-12450.51arrestin beta 1 [Source:NCBI gene;Acc:100486349][more]
ARRB13.298e-12350.51arrestin beta 1 [Source:NCBI gene;Acc:100486349][more]
ARRB13.597e-12349.27arrestin beta 1 [Source:NCBI gene;Acc:100486349][more]
ARRB16.046e-12350.13arrestin beta 1 [Source:NCBI gene;Acc:100486349][more]
ARRB16.453e-12348.69arrestin beta 1 [Source:NCBI gene;Acc:100486349][more]
back to top
BLAST of Beta-arrestin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arrb16.709e-14252.25arrestin, beta 1 [Source:MGI Symbol;Acc:MGI:99473][more]
Arrb11.373e-14151.60arrestin, beta 1 [Source:MGI Symbol;Acc:MGI:99473][more]
Arrb15.595e-14151.47arrestin, beta 1 [Source:MGI Symbol;Acc:MGI:99473][more]
Arrb25.725e-14151.46arrestin, beta 2 [Source:MGI Symbol;Acc:MGI:99474][more]
Arrb25.725e-14151.46arrestin, beta 2 [Source:MGI Symbol;Acc:MGI:99474][more]
back to top
BLAST of Beta-arrestin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51485|ARRB_CAEEL9.794e-14351.88Beta-arrestin arr-1 OS=Caenorhabditis elegans OX=6... [more]
sp|Q4R562|ARRB1_MACFA2.302e-14251.98Beta-arrestin-1 OS=Macaca fascicularis OX=9541 GN=... [more]
sp|P49407|ARRB1_HUMAN1.612e-14151.46Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1 P... [more]
sp|Q8BWG8|ARRB1_MOUSE9.606e-14151.60Beta-arrestin-1 OS=Mus musculus OX=10090 GN=Arrb1 ... [more]
sp|Q5RCR4|ARRB2_PONAB1.084e-14052.11Beta-arrestin-2 OS=Pongo abelii OX=9601 GN=ARRB2 P... [more]
back to top
BLAST of Beta-arrestin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1EFX65.834e-17559.33Arrestin_C domain-containing protein OS=Helobdella... [more]
A0A1V1FN691.239e-17358.77Beta-arrestin OS=Ambigolimax valentianus OX=133834... [more]
A0A2T7NC683.158e-17260.53Arrestin_C domain-containing protein OS=Pomacea ca... [more]
R7TPP31.115e-17159.28Arrestin_C domain-containing protein OS=Capitella ... [more]
A0A1I8J0I01.635e-17055.96Arrestin_C domain-containing protein OS=Macrostomu... [more]
back to top
BLAST of Beta-arrestin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arrb2a4.216e-14250.12arrestin red cell [Source:NCBI gene;Acc:103028079][more]
arrb2a3.132e-13546.85arrestin red cell [Source:NCBI gene;Acc:103028079][more]
arrb13.581e-13354.62arrestin, beta 1 [Source:ZFIN;Acc:ZDB-GENE-060824-... [more]
arrb2b2.108e-12948.61arrestin, beta 2b [Source:ZFIN;Acc:ZDB-GENE-040426... [more]
sagb1.158e-9943.70S-antigen; retina and pineal gland (arrestin) b [S... [more]
back to top
BLAST of Beta-arrestin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004302.18.897e-5348.70pep scaffold:Pmarinus_7.0:GL490722:800:6194:-1 gen... [more]
back to top
BLAST of Beta-arrestin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Beta-arrestin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO435353.438e-12159.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278142.677e-1641.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Beta-arrestin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arrb2a1.010e-13950.62arrestin beta 2 [Source:NCBI gene;Acc:101159286][more]
arrb2a4.373e-13449.38arrestin beta 2 [Source:NCBI gene;Acc:101159286][more]
arrb15.078e-13150.40arrestin beta 1 [Source:NCBI gene;Acc:101163309][more]
kfharr-r26.555e-9941.46arrestin [Source:NCBI gene;Acc:100144345][more]
kfharr-r21.064e-9844.73arrestin [Source:NCBI gene;Acc:100144345][more]
back to top
BLAST of Beta-arrestin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006894.10.000e+099.76SMESG000006894.1[more]
SMESG000006894.10.000e+099.76SMESG000006894.1[more]
SMESG000037193.10.000e+057.02SMESG000037193.1[more]
SMESG000078454.15.398e-16756.94SMESG000078454.1[more]
SMESG000033976.12.245e-10841.94SMESG000033976.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031199 ID=SMED30031199|Name=Beta-arrestin|organism=Schmidtea mediterranea sexual|type=transcript|length=1414bp
TCTTCCGATCTTATAATTCCAATTATTTTAAATGATTGATATGGATGAAG
GAACAGAGAAAAAGCTTGGAACAAGAGTATTTAAGAAAAGTTCACCAAAC
AATAAAATAACTATTTATCTTGGAAAGCGTGATTTTTTAGACAAAAACGG
ACTCGTCGACCCAATCGAAGGAATTGTCCTCCTTGACTCGGATTATGTCA
AAGATAAAAAGGTTTTTATTCACGTACTGGCTTTATTTCGATATGGAAGA
GATGATCTCGATGTTCTCGGACTTACATTCAGAAAAGACCTCTTTTTGTC
AACTCAACAGATCTATCCGCCAACTAATTCGATAATTCCTAGTTTGACCA
AACTTCAAGAACGTTTAATTGGCAAACTTGGCCATAACGCAATTCCGTTT
ATATTCCAGATTCCCCACATGACTCCCGCCTCAGTTACCTTACAACCTGA
TCCGGAAGACAATGGAAAGCCTTGCGGAGTTGATTATGAATTAAAAGTCT
ACATGTCGGACGGACCAGATGGCAAGACTCATAAAAGGAATTCAGTGAGG
TTATTAATAAGAAAACTAACCTTTGCAACTTCAGATCCAGGTCCTCAACA
GTTTCAAGAAGTTACAAAAGACTTTAAAATGTGCGGTGGTAAAATAAGAT
TAGAAACTAGTTTAGACAAAGAAAAATATTATCATGGAGAATCAATTGCT
GTAAATGTCACTGTCGACAATACTTCCAATAAAATTATCAGAAAAATAAG
ACTACAAGTTGTCCAGCTTGCTGATATAATGCTTTTTACGAGAGCCATGT
ACAAATGCGTGGTAGATGAAATGGAAATAGATGATGGTTTTCCAATATCT
CCGGGTCAAATCGGTTGGTGTAAAATATTCCATATGTGCCCTTTATTGAG
CAATAATAGAGACAAAAGAGGTCTAGCATTAGATGGATTGCTACGGTATG
AAGATACGAATTTGGCATCTTCAACTGTGTTGAATGAGAACAGTGATCTA
GAGAATATGGGGATCATAGTAAAGTATTTCATTAGAGTTAGATTAATTCT
TGGATTCGGAACGAGTGATATTCAATTGGAAATTCCTTTCATTCTAACTC
ATCCTAATCCAGATTCAGACTTCAGAATTCCGAATTCTGTTTCAAATGAT
TTAAATCCTTTAGATTCCAACGGGATAGATACTGATTTCAATAAATTACA
ATTTAAACAAGAAGAAGAATTTATTTTTGAAGACTTTGCTAGATTAAGAC
TGTATGGAAATGAAACGAATTGTGAAGAAGCCTGAATTGAAACTTGGTGT
AAAATAACAGATCTGACTGCCAAGTTTATAACATTATACCTTGAAACACT
TTTTCTGTAATATTAGATAAATTTGCACTGAATTGCACGATAATAAATAA
ATGCTATTTCAAAG
back to top

protein sequence of SMED30031199-orf-1

>SMED30031199-orf-1 ID=SMED30031199-orf-1|Name=SMED30031199-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=418bp
MIDMDEGTEKKLGTRVFKKSSPNNKITIYLGKRDFLDKNGLVDPIEGIVL
LDSDYVKDKKVFIHVLALFRYGRDDLDVLGLTFRKDLFLSTQQIYPPTNS
IIPSLTKLQERLIGKLGHNAIPFIFQIPHMTPASVTLQPDPEDNGKPCGV
DYELKVYMSDGPDGKTHKRNSVRLLIRKLTFATSDPGPQQFQEVTKDFKM
CGGKIRLETSLDKEKYYHGESIAVNVTVDNTSNKIIRKIRLQVVQLADIM
LFTRAMYKCVVDEMEIDDGFPISPGQIGWCKIFHMCPLLSNNRDKRGLAL
DGLLRYEDTNLASSTVLNENSDLENMGIIVKYFIRVRLILGFGTSDIQLE
IPFILTHPNPDSDFRIPNSVSNDLNPLDSNGIDTDFNKLQFKQEEEFIFE
DFARLRLYGNETNCEEA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000698Arrestin
IPR011022Arrestin_C-like
IPR011021Arrestin-like_N
IPR014752Arrestin_C
IPR014753Arrestin_N
IPR017864Arrestin_CS
IPR014756Ig_E-set
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000698ArrestinPRINTSPR00309ARRESTINcoord: 291..309
score: 68.59
coord: 69..87
score: 77.25
coord: 394..408
score: 50.97
coord: 32..54
score: 46.98
coord: 163..180
score: 58.06
IPR000698ArrestinPANTHERPTHR11792ARRESTINcoord: 15..413
IPR011022Arrestin C-terminal-like domainSMARTSM01017Arrestin_C_2coord: 201..360
e-value: 6.0E-22
score: 88.9
IPR011022Arrestin C-terminal-like domainPFAMPF02752Arrestin_Ccoord: 203..359
e-value: 5.2E-22
score: 78.7
IPR014752Arrestin, C-terminalGENE3DG3DSA:2.60.40.640coord: 186..396
e-value: 3.0E-65
score: 221.9
IPR011021Arrestin-like, N-terminalPFAMPF00339Arrestin_Ncoord: 27..181
e-value: 1.4E-28
score: 99.8
IPR014753Arrestin, N-terminalGENE3DG3DSA:2.60.40.840coord: 8..184
e-value: 2.7E-76
score: 257.1
IPR017864Arrestin, conserved sitePROSITEPS00295ARRESTINScoord: 69..87
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 14..182
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 185..410