Microtubule-associated protein 4

Overview
NameMicrotubule-associated protein 4
Smed IDSMED30031197
Length (bp)1416
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Microtubule-associated protein 4 (SMED30031197) t-SNE clustered cells

Violin plots show distribution of expression levels for Microtubule-associated protein 4 (SMED30031197) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Microtubule-associated protein 4 (SMED30031197) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Microtubule-associated protein 4 (SMED30031197) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031197

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30031197SMESG000068843.1 SmedASXL_013409SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30031197SMESG000068843.1 dd_Smed_v4_7133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031197SMESG000068843.1 dd_Smed_v4_7133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30031197SMESG000068843.1 dd_Smed_v4_7133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031197SMESG000068843.1 dd_Smed_v4_7133_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031197SMESG000068843.1 dd_Smed_v6_7133_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30031197SMESG000068843.1 dd_Smed_v4_7133_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Microtubule-associated protein 4 vs. Ensembl Human
Match: MAP4 (microtubule associated protein 4 [Source:HGNC Symbol;Acc:HGNC:6862])

HSP 1 Score: 122.479 bits (306), Expect = 9.724e-30
Identity = 59/117 (50.43%), Postives = 85/117 (72.65%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHI 1059
            + SK+GS  N +H+PGGG V+I  +KV++S++++KCGSK NIKH PGGG+V+I N+K++ + K  +K  S  NI+H+P GGDVKI++ KL +     +KVGSL N+ H P GG V I
Sbjct:  301 VRSKVGSTENIKHQPGGGRVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDIS-KVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKI 416          

HSP 2 Score: 117.857 bits (294), Expect = 4.549e-28
Identity = 72/170 (42.35%), Postives = 94/170 (55.29%), Query Frame = 1
Query:  508 PTYSKRSSRDPNLLQSSLNADVRLRSNAKS-LNRYDRATSEEMAGR--ITSMESSYSEKTNNSGSAASNNYVITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKV 1008
            PT +K SS  P L + + N       N +S +   +    +   GR  I S + SYS               I SK GS  N +H PGGGNV+I  +KV+ S V +KCGSK NIKHKPGGGDV+I ++KL F  KAQAKV SL N+ H P GG VKI+  +L +   ++ 
Sbjct:  274 PTSAKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRVQIVSKKVSYSH--------------IQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKIETYRLTFRANARA 429          
BLAST of Microtubule-associated protein 4 vs. Ensembl Human
Match: MAP4 (microtubule associated protein 4 [Source:HGNC Symbol;Acc:HGNC:6862])

HSP 1 Score: 121.324 bits (303), Expect = 1.333e-28
Identity = 59/117 (50.43%), Postives = 85/117 (72.65%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHI 1059
            + SK+GS  N +H+PGGG V+I  +KV++S++++KCGSK NIKH PGGG+V+I N+K++ + K  +K  S  NI+H+P GGDVKI++ KL +     +KVGSL N+ H P GG V I
Sbjct:  666 VRSKVGSTENIKHQPGGGRVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDIS-KVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKI 781          

HSP 2 Score: 117.087 bits (292), Expect = 3.527e-27
Identity = 92/248 (37.10%), Postives = 125/248 (50.40%), Query Frame = 1
Query:  316 TAIPRLSSAATPRP-SHNADSNGKTNKSKIPFSSLNVKPNRPKSVGSYIKTPTQESDNFREFLTS-PTYSKRSSRDPNLLQSSLNADVRLRSNAKS-LNRYDRATSEEMAGR--ITSMESSYSEKTNNSGSAASNNYVITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHKP 1038
            T +P+  +A   RP S +  S  KT        +  V P+R K+      TP     +   F+   PT +K SS  P L + + N       N +S +   +    +   GR  I S + SYS               I SK GS  N +H PGGGNV+I  +KV+ S V +KCGSK NIKHKPGGGDV+I ++KL F  KAQAKV SL N+ H P GG VKI+  +L +  N  ++    A+I  +P
Sbjct:  579 TLLPKKPTADLSRPKSTSTSSMKKTTTLSGTAPAAGVVPSRVKA------TPMPSRPSTTPFIDKKPTSAKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRVQIVSKKVSYSH--------------IQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKIETYRLTFRANARARTDHGADIVSRP 806          

HSP 3 Score: 84.7297 bits (208), Expect = 1.091e-16
Identity = 47/94 (50.00%), Postives = 66/94 (70.21%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            +  NV +K GS +NIKH+PGGG V+I ++K+ ++   Q+K  S  NI+H P GG+V+I N K++ + V SK GS ANIKHKP GG+V I S+ L
Sbjct:  662 DLKNVRSKVGSTENIKHQPGGGRVQIVSKKVSYSH-IQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKL 754          
BLAST of Microtubule-associated protein 4 vs. Ensembl Human
Match: MAPT (microtubule associated protein tau [Source:HGNC Symbol;Acc:HGNC:6893])

HSP 1 Score: 115.931 bits (289), Expect = 1.006e-27
Identity = 60/124 (48.39%), Postives = 84/124 (67.74%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SKIGS  N +H+PGGG V+I  +K++ SNV++KCGSK NIKH PGGG V+I  + ++ + K  +K  SL NI H+P GG V++ + KL++   V SK+GSL NI H P GGN  I +  L +
Sbjct:  227 VKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLS-KVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTF 349          

HSP 2 Score: 100.138 bits (248), Expect = 2.849e-22
Identity = 52/109 (47.71%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHK 1035
            + SK GS  N +H PGGG+V+I  + V+ S V +KCGS  NI HKPGGG VE+ +EKL+F  + Q+K+ SL NI H P GG+ KI+  KL +  N  +K    A I +K
Sbjct:  258 VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYK 366          

HSP 3 Score: 81.2629 bits (199), Expect = 5.253e-16
Identity = 45/96 (46.88%), Postives = 63/96 (65.62%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  NV++K GS +N+KH+PGGG V+I N+KL+ +   Q+K  S  NI+H P GG V+I    ++ + V SK GSL NI HKP GG V + SE L +
Sbjct:  223 DLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSN-VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDF 317          
BLAST of Microtubule-associated protein 4 vs. Ensembl Human
Match: MAPT (microtubule associated protein tau [Source:HGNC Symbol;Acc:HGNC:6893])

HSP 1 Score: 115.931 bits (289), Expect = 1.006e-27
Identity = 60/124 (48.39%), Postives = 84/124 (67.74%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SKIGS  N +H+PGGG V+I  +K++ SNV++KCGSK NIKH PGGG V+I  + ++ + K  +K  SL NI H+P GG V++ + KL++   V SK+GSL NI H P GGN  I +  L +
Sbjct:  227 VKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLS-KVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTF 349          

HSP 2 Score: 100.138 bits (248), Expect = 2.849e-22
Identity = 52/109 (47.71%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHK 1035
            + SK GS  N +H PGGG+V+I  + V+ S V +KCGS  NI HKPGGG VE+ +EKL+F  + Q+K+ SL NI H P GG+ KI+  KL +  N  +K    A I +K
Sbjct:  258 VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYK 366          

HSP 3 Score: 81.2629 bits (199), Expect = 5.253e-16
Identity = 45/96 (46.88%), Postives = 63/96 (65.62%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  NV++K GS +N+KH+PGGG V+I N+KL+ +   Q+K  S  NI+H P GG V+I    ++ + V SK GSL NI HKP GG V + SE L +
Sbjct:  223 DLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSN-VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDF 317          
BLAST of Microtubule-associated protein 4 vs. Ensembl Human
Match: MAPT (microtubule associated protein tau [Source:HGNC Symbol;Acc:HGNC:6893])

HSP 1 Score: 115.931 bits (289), Expect = 1.006e-27
Identity = 60/124 (48.39%), Postives = 84/124 (67.74%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SKIGS  N +H+PGGG V+I  +K++ SNV++KCGSK NIKH PGGG V+I  + ++ + K  +K  SL NI H+P GG V++ + KL++   V SK+GSL NI H P GGN  I +  L +
Sbjct:  227 VKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLS-KVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTF 349          

HSP 2 Score: 100.138 bits (248), Expect = 2.849e-22
Identity = 52/109 (47.71%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHK 1035
            + SK GS  N +H PGGG+V+I  + V+ S V +KCGS  NI HKPGGG VE+ +EKL+F  + Q+K+ SL NI H P GG+ KI+  KL +  N  +K    A I +K
Sbjct:  258 VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYK 366          

HSP 3 Score: 81.2629 bits (199), Expect = 5.253e-16
Identity = 45/96 (46.88%), Postives = 63/96 (65.62%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  NV++K GS +N+KH+PGGG V+I N+KL+ +   Q+K  S  NI+H P GG V+I    ++ + V SK GSL NI HKP GG V + SE L +
Sbjct:  223 DLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSN-VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDF 317          
BLAST of Microtubule-associated protein 4 vs. Ensembl Celegans
Match: ptl-1 (Microtubule-associated protein [Source:UniProtKB/TrEMBL;Acc:O02592])

HSP 1 Score: 110.153 bits (274), Expect = 6.583e-26
Identity = 72/226 (31.86%), Postives = 123/226 (54.42%), Query Frame = 1
Query:  433 RPKSVGSYIKTPTQESDNFREFLTSPTYSKRSSRDPNLL--QSSLNADVRLRSNAKSLNRYDRATSEEMAGRITSMESSYSEKTNNSGSAASNN-------YVITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPLPWL 1083
            +PK + + +  P   + + +  +++P  +  ++  P  +   S   +DV+  ++ +S++   R T + +  +  +++S     TN+     +         Y   SK+GSL N  H  GGGNV+I  RK++FS    K GSK N  ++P   DV+I +EKL +  +A++KV S+ N  H+P GG+V+I + KL W   SKVGS  N+ H+P GGNV I  E + ++
Sbjct:  217 QPKPIPASLPRPATATPSSQRAISTPRQTASTAPSPRPISKMSRERSDVQKSTSTRSIDNVGRMTPK-VNAKFVNVKSKVGSVTNHKAGGGNVEIFSEKRLYNAQSKVGSLKNATHVAGGGNVQIENRKLDFSAASPKVGSKTN--YQPAKSDVKIVSEKLTW--QAKSKVGSMDNAAHKPAGGNVQILSQKLNWKAESKVGSKDNMNHRPGGGNVQIFDEKIRYV 437          
BLAST of Microtubule-associated protein 4 vs. Ensembl Celegans
Match: ptl-1 (Microtubule-associated protein [Source:UniProtKB/TrEMBL;Acc:O02592])

HSP 1 Score: 110.153 bits (274), Expect = 6.583e-26
Identity = 72/226 (31.86%), Postives = 123/226 (54.42%), Query Frame = 1
Query:  433 RPKSVGSYIKTPTQESDNFREFLTSPTYSKRSSRDPNLL--QSSLNADVRLRSNAKSLNRYDRATSEEMAGRITSMESSYSEKTNNSGSAASNN-------YVITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPLPWL 1083
            +PK + + +  P   + + +  +++P  +  ++  P  +   S   +DV+  ++ +S++   R T + +  +  +++S     TN+     +         Y   SK+GSL N  H  GGGNV+I  RK++FS    K GSK N  ++P   DV+I +EKL +  +A++KV S+ N  H+P GG+V+I + KL W   SKVGS  N+ H+P GGNV I  E + ++
Sbjct:  217 QPKPIPASLPRPATATPSSQRAISTPRQTASTAPSPRPISKMSRERSDVQKSTSTRSIDNVGRMTPK-VNAKFVNVKSKVGSVTNHKAGGGNVEIFSEKRLYNAQSKVGSLKNATHVAGGGNVQIENRKLDFSAASPKVGSKTN--YQPAKSDVKIVSEKLTW--QAKSKVGSMDNAAHKPAGGNVQILSQKLNWKAESKVGSKDNMNHRPGGGNVQIFDEKIRYV 437          
BLAST of Microtubule-associated protein 4 vs. Ensembl Celegans
Match: ptl-1 (Microtubule-associated protein [Source:UniProtKB/TrEMBL;Acc:O02592])

HSP 1 Score: 102.834 bits (255), Expect = 1.263e-24
Identity = 57/115 (49.57%), Postives = 72/115 (62.61%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHI 1059
            + SK+GS+ N  H+ GGGNV+IF  K    N ++K GS KN  H  GGG+V+I N KL+F+  A  KV S  N  +QP   DVKI + KL W   SKVGS+ N  HKP GGNV +
Sbjct:  143 VKSKVGSVTN--HKAGGGNVEIFSEK-RLYNAQSKVGSLKNATHVAGGGNVQIENRKLDFS-AASPKVGSKTN--YQPAKSDVKIVSEKLTWQAKSKVGSMDNAAHKPAGGNVQV 251          

HSP 2 Score: 79.7221 bits (195), Expect = 1.263e-16
Identity = 53/107 (49.53%), Postives = 68/107 (63.55%), Query Frame = 1
Query:  769 NVKIFERKVN--FSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGS-KVGSLANIKHKPCGGNVHIVSEPLPW 1080
            NV     KVN  F NV++K GS  N  HK GGG+VEI +EK  +N  AQ+KV SLKN  H   GG+V+I+N KL+++  S KVGS  N  ++P   +V IVSE L W
Sbjct:  128 NVGRMTPKVNAKFVNVKSKVGSVTN--HKAGGGNVEIFSEKRLYN--AQSKVGSLKNATHVAGGGNVQIENRKLDFSAASPKVGSKTN--YQPAKSDVKIVSEKLTW 228          
BLAST of Microtubule-associated protein 4 vs. Ensembl Celegans
Match: ptl-1 (Microtubule-associated protein [Source:UniProtKB/TrEMBL;Acc:O02592])

HSP 1 Score: 102.834 bits (255), Expect = 1.263e-24
Identity = 57/115 (49.57%), Postives = 72/115 (62.61%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHI 1059
            + SK+GS+ N  H+ GGGNV+IF  K    N ++K GS KN  H  GGG+V+I N KL+F+  A  KV S  N  +QP   DVKI + KL W   SKVGS+ N  HKP GGNV +
Sbjct:  143 VKSKVGSVTN--HKAGGGNVEIFSEK-RLYNAQSKVGSLKNATHVAGGGNVQIENRKLDFS-AASPKVGSKTN--YQPAKSDVKIVSEKLTWQAKSKVGSMDNAAHKPAGGNVQV 251          

HSP 2 Score: 79.7221 bits (195), Expect = 1.263e-16
Identity = 53/107 (49.53%), Postives = 68/107 (63.55%), Query Frame = 1
Query:  769 NVKIFERKVN--FSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGS-KVGSLANIKHKPCGGNVHIVSEPLPW 1080
            NV     KVN  F NV++K GS  N  HK GGG+VEI +EK  +N  AQ+KV SLKN  H   GG+V+I+N KL+++  S KVGS  N  ++P   +V IVSE L W
Sbjct:  128 NVGRMTPKVNAKFVNVKSKVGSVTN--HKAGGGNVEIFSEKRLYN--AQSKVGSLKNATHVAGGGNVQIENRKLDFSAASPKVGSKTN--YQPAKSDVKIVSEKLTW 228          
BLAST of Microtubule-associated protein 4 vs. Ensembl Celegans
Match: ptl-1 (Microtubule-associated protein [Source:UniProtKB/TrEMBL;Acc:O02592])

HSP 1 Score: 105.916 bits (263), Expect = 1.751e-24
Identity = 58/117 (49.57%), Postives = 74/117 (63.25%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVS 1065
            + SK+GS+ N  H+ GGGNV+IF  K    N ++K GS KN  H  GGG+V+I N KL+F+  A  KV S  N  +QP   DVKI + KL W   SKVGS+ N  HKP GGNV ++S
Sbjct:  291 VKSKVGSVTN--HKAGGGNVEIFSEK-RLYNAQSKVGSLKNATHVAGGGNVQIENRKLDFS-AASPKVGSKTN--YQPAKSDVKIVSEKLTWQAKSKVGSMDNAAHKPAGGNVQVIS 401          
BLAST of Microtubule-associated protein 4 vs. Ensembl Fly
Match: tau (gene:FBgn0266579 transcript:FBtr0344751)

HSP 1 Score: 111.309 bits (277), Expect = 2.400e-27
Identity = 65/156 (41.67%), Postives = 84/156 (53.85%), Query Frame = 1
Query:  688 GSAASNNY-VITSKIGSLANTRHRPGGGNVKIFERKVNFS----------------------------NVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSE 1068
            G A S N   + SKIGSL N  ++PGGG+VKI  +K++                              N ++K GS +N  HKPGGGD +I   K++F  KA+ KV S  N++HQP GGD+KI   KLE    SKVGSL N+KHKP GG   I  +
Sbjct:   85 GHAPSPNLKAVRSKIGSLDNATYKPGGGHVKIESKKIDIKAAPRIEAKNDKYMPKGGEKKIVTTKLQWNAKSKIGSLENAAHKPGGGDKKIETLKMDFKDKAKPKVGSTANVKHQPGGGDIKIQTQKLEIKAQSKVGSLDNVKHKPGGGEKKIFDD 240          

HSP 2 Score: 62.3882 bits (150), Expect = 1.534e-10
Identity = 31/73 (42.47%), Postives = 47/73 (64.38%), Query Frame = 1
Query:  724 KIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEH 942
            K+GS AN +H+PGGG++KI  +K+     ++K GS  N+KHKPGGG+ +I ++K           + LKN+EH
Sbjct:  189 KVGSTANVKHQPGGGDIKIQTQKLEI-KAQSKVGSLDNVKHKPGGGEKKIFDDK-----------DYLKNVEH 249          
BLAST of Microtubule-associated protein 4 vs. Ensembl Fly
Match: tau (gene:FBgn0266579 transcript:FBtr0344750)

HSP 1 Score: 111.309 bits (277), Expect = 2.400e-27
Identity = 65/156 (41.67%), Postives = 84/156 (53.85%), Query Frame = 1
Query:  688 GSAASNNY-VITSKIGSLANTRHRPGGGNVKIFERKVNFS----------------------------NVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSE 1068
            G A S N   + SKIGSL N  ++PGGG+VKI  +K++                              N ++K GS +N  HKPGGGD +I   K++F  KA+ KV S  N++HQP GGD+KI   KLE    SKVGSL N+KHKP GG   I  +
Sbjct:   85 GHAPSPNLKAVRSKIGSLDNATYKPGGGHVKIESKKIDIKAAPRIEAKNDKYMPKGGEKKIVTTKLQWNAKSKIGSLENAAHKPGGGDKKIETLKMDFKDKAKPKVGSTANVKHQPGGGDIKIQTQKLEIKAQSKVGSLDNVKHKPGGGEKKIFDD 240          

HSP 2 Score: 62.3882 bits (150), Expect = 1.534e-10
Identity = 31/73 (42.47%), Postives = 47/73 (64.38%), Query Frame = 1
Query:  724 KIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEH 942
            K+GS AN +H+PGGG++KI  +K+     ++K GS  N+KHKPGGG+ +I ++K           + LKN+EH
Sbjct:  189 KVGSTANVKHQPGGGDIKIQTQKLEI-KAQSKVGSLDNVKHKPGGGEKKIFDDK-----------DYLKNVEH 249          
BLAST of Microtubule-associated protein 4 vs. Ensembl Fly
Match: tau (gene:FBgn0266579 transcript:FBtr0344746)

HSP 1 Score: 115.546 bits (288), Expect = 4.423e-27
Identity = 65/156 (41.67%), Postives = 84/156 (53.85%), Query Frame = 1
Query:  688 GSAASNNY-VITSKIGSLANTRHRPGGGNVKIFERKVNFS----------------------------NVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSE 1068
            G A S N   + SKIGSL N  ++PGGG+VKI  +K++                              N ++K GS +N  HKPGGGD +I   K++F  KA+ KV S  N++HQP GGD+KI   KLE    SKVGSL N+KHKP GG   I  +
Sbjct:  524 GHAPSPNLKAVRSKIGSLDNATYKPGGGHVKIESKKIDIKAAPRIEAKNDKYMPKGGEKKIVTTKLQWNAKSKIGSLENAAHKPGGGDKKIETLKMDFKDKAKPKVGSTANVKHQPGGGDIKIQTQKLEIKAQSKVGSLDNVKHKPGGGEKKIFDD 679          

HSP 2 Score: 64.6994 bits (156), Expect = 1.079e-10
Identity = 31/73 (42.47%), Postives = 47/73 (64.38%), Query Frame = 1
Query:  724 KIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEH 942
            K+GS AN +H+PGGG++KI  +K+     ++K GS  N+KHKPGGG+ +I ++K           + LKN+EH
Sbjct:  628 KVGSTANVKHQPGGGDIKIQTQKLEI-KAQSKVGSLDNVKHKPGGGEKKIFDDK-----------DYLKNVEH 688          
BLAST of Microtubule-associated protein 4 vs. Ensembl Fly
Match: tau (gene:FBgn0266579 transcript:FBtr0344741)

HSP 1 Score: 112.464 bits (280), Expect = 4.710e-27
Identity = 91/263 (34.60%), Postives = 123/263 (46.77%), Query Frame = 1
Query:  364 NADSNGKTNKSKIPFSSLNVKPNRPKSVGSYIKTPTQESDNFREFLTSPTYSKRSSRDPNLLQSSLNADVRLRSNAKSLNRYDRATSEEMAGRITSMESSYSEKTNNSGSAASNNYVITSKIGSLANTRHRPGGGNVKIFERKVNFS----------------------------NVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSE 1068
            N D     N S +  S+     N P S  S +KTPT  S       + P  S  +SR P+   S+ +A    +S + S NR    T E    +   M      K     + + N   + SKIGSL N  ++PGGG+VKI  +K++                              N ++K GS +N  HKPGGGD +I   K++F  KA+ KV S  N++HQP GGD+KI   KLE    SKVGSL N+KHKP GG   I  +
Sbjct:   77 NQDQKEGDNDSGVDESTQEKDRNGPNSPSSPVKTPTSTS-------SKPDKS-GTSRPPSATPSNKSAP---KSRSASKNRLLLKTPEPEPVKKVPMN-----KVQVGHAPSPNLKAVRSKIGSLDNATYKPGGGHVKIESKKIDIKAAPRIEAKNDKYMPKGGEKKIVTTKLQWNAKSKIGSLENAAHKPGGGDKKIETLKMDFKDKAKPKVGSTANVKHQPGGGDIKIQTQKLEIKAQSKVGSLDNVKHKPGGGEKKIFDD 323          

HSP 2 Score: 62.3882 bits (150), Expect = 2.557e-10
Identity = 31/73 (42.47%), Postives = 47/73 (64.38%), Query Frame = 1
Query:  724 KIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEH 942
            K+GS AN +H+PGGG++KI  +K+     ++K GS  N+KHKPGGG+ +I ++K           + LKN+EH
Sbjct:  272 KVGSTANVKHQPGGGDIKIQTQKLEI-KAQSKVGSLDNVKHKPGGGEKKIFDDK-----------DYLKNVEH 332          
BLAST of Microtubule-associated protein 4 vs. Ensembl Fly
Match: tau (gene:FBgn0266579 transcript:FBtr0344742)

HSP 1 Score: 112.464 bits (280), Expect = 4.710e-27
Identity = 91/263 (34.60%), Postives = 123/263 (46.77%), Query Frame = 1
Query:  364 NADSNGKTNKSKIPFSSLNVKPNRPKSVGSYIKTPTQESDNFREFLTSPTYSKRSSRDPNLLQSSLNADVRLRSNAKSLNRYDRATSEEMAGRITSMESSYSEKTNNSGSAASNNYVITSKIGSLANTRHRPGGGNVKIFERKVNFS----------------------------NVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSE 1068
            N D     N S +  S+     N P S  S +KTPT  S       + P  S  +SR P+   S+ +A    +S + S NR    T E    +   M      K     + + N   + SKIGSL N  ++PGGG+VKI  +K++                              N ++K GS +N  HKPGGGD +I   K++F  KA+ KV S  N++HQP GGD+KI   KLE    SKVGSL N+KHKP GG   I  +
Sbjct:   77 NQDQKEGDNDSGVDESTQEKDRNGPNSPSSPVKTPTSTS-------SKPDKS-GTSRPPSATPSNKSAP---KSRSASKNRLLLKTPEPEPVKKVPMN-----KVQVGHAPSPNLKAVRSKIGSLDNATYKPGGGHVKIESKKIDIKAAPRIEAKNDKYMPKGGEKKIVTTKLQWNAKSKIGSLENAAHKPGGGDKKIETLKMDFKDKAKPKVGSTANVKHQPGGGDIKIQTQKLEIKAQSKVGSLDNVKHKPGGGEKKIFDD 323          

HSP 2 Score: 62.3882 bits (150), Expect = 2.557e-10
Identity = 31/73 (42.47%), Postives = 47/73 (64.38%), Query Frame = 1
Query:  724 KIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEH 942
            K+GS AN +H+PGGG++KI  +K+     ++K GS  N+KHKPGGG+ +I ++K           + LKN+EH
Sbjct:  272 KVGSTANVKHQPGGGDIKIQTQKLEI-KAQSKVGSLDNVKHKPGGGEKKIFDDK-----------DYLKNVEH 332          
BLAST of Microtubule-associated protein 4 vs. Ensembl Zebrafish
Match: mapta (microtubule-associated protein tau a [Source:ZFIN;Acc:ZDB-GENE-081027-1])

HSP 1 Score: 122.479 bits (306), Expect = 3.008e-30
Identity = 59/117 (50.43%), Postives = 87/117 (74.36%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIV 1062
            + SK+GS  N +H+PGGG ++I ++KV+FSNV++KCGSK N+KH PGGG+V+I ++K++F  K Q+K  S  NI+H P GG+V+I + KL+  NV ++ GS  N+KH P GG V I+
Sbjct:  167 VRSKVGSTDNLKHQPGGGRIQILDQKVDFSNVQSKCGSKANLKHTPGGGNVKILDQKVDFT-KVQSKCGSKDNIKHAPGGGNVQILDQKLDLTNVQARCGSKDNLKHVPGGGKVQIL 282          

HSP 2 Score: 120.168 bits (300), Expect = 1.916e-29
Identity = 57/122 (46.72%), Postives = 86/122 (70.49%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SK GS  N +H PGGGNV+I ++K++ +NV+A+CGSK N+KH PGGG V+I ++K++ +   Q+K  S  N+ H+P GG+++I + KL++   SK+GS+ NIKH P GGN  I S  L +
Sbjct:  229 VQSKCGSKDNIKHAPGGGNVQILDQKLDLTNVQARCGSKDNLKHVPGGGKVQILHKKIDLSN-VQSKCGSKDNLRHKPGGGNIEIRSEKLDFKAQSKIGSMDNIKHTPGGGNRRIESHKLTF 349          
BLAST of Microtubule-associated protein 4 vs. Ensembl Zebrafish
Match: mapta (microtubule-associated protein tau a [Source:ZFIN;Acc:ZDB-GENE-081027-1])

HSP 1 Score: 117.857 bits (294), Expect = 7.618e-29
Identity = 60/124 (48.39%), Postives = 89/124 (71.77%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKP-CGGNVHIVSEPLPW 1080
            + SK+GS  N +H+PGGG ++I ++KV+FSNV++KCGSK N+KH PGGG+V+I ++KL+F+    ++  S  NI H P GG+V+I + KL+  NV ++ GS  N+KH P  GGN+ I SE L +
Sbjct:  152 VRSKVGSTDNLKHQPGGGRIQILDQKVDFSNVQSKCGSKANLKHTPGGGNVQILDQKLDFS-NVPSRCGSKDNITHTPGGGNVQILDQKLDLTNVQARCGSKDNLKHVPGGGGNIEIRSEKLDF 274          

HSP 2 Score: 117.472 bits (293), Expect = 1.220e-28
Identity = 57/113 (50.44%), Postives = 82/113 (72.57%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGG-DVKIDNLKLEWNVGSKVGSLANIKHKPCGGN 1050
            + SK GS AN +H PGGGNV+I ++K++FSNV ++CGSK NI H PGGG+V+I ++KL+     QA+  S  N++H P GG +++I + KL++   SK+GS+ NIKH P GGN
Sbjct:  183 VQSKCGSKANLKHTPGGGNVQILDQKLDFSNVPSRCGSKDNITHTPGGGNVQILDQKLDLTN-VQARCGSKDNLKHVPGGGGNIEIRSEKLDFKAQSKIGSMDNIKHTPGGGN 294          

HSP 3 Score: 82.0333 bits (201), Expect = 1.635e-16
Identity = 42/94 (44.68%), Postives = 64/94 (68.09%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            +  NV +K GS  N+KH+PGGG ++I ++K++F+   Q+K  S  N++H P GG+V+I + KL++ NV S+ GS  NI H P GGNV I+ + L
Sbjct:  148 DLKNVRSKVGSTDNLKHQPGGGRIQILDQKVDFS-NVQSKCGSKANLKHTPGGGNVQILDQKLDFSNVPSRCGSKDNITHTPGGGNVQILDQKL 240          
BLAST of Microtubule-associated protein 4 vs. Ensembl Zebrafish
Match: maptb (microtubule-associated protein tau b [Source:ZFIN;Acc:ZDB-GENE-081027-2])

HSP 1 Score: 114.39 bits (285), Expect = 8.513e-28
Identity = 56/120 (46.67%), Postives = 83/120 (69.17%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            + SKIGS  N +H+PGGG V I  +K++ +NV+++CGSK N++H PGGG+++I ++K++ +   Q+K  S  NI H+P GG+V+I + KL++   SKVGSL NI H P GG   I S  L
Sbjct:  163 VKSKIGSTENLKHQPGGGKVTIVHKKIDLTNVKSRCGSKDNMQHVPGGGNIQIVHKKIDLSN-VQSKCGSKANIHHKPGGGNVEIKSEKLDFKAQSKVGSLENIGHVPGGGQRRIESHKL 281          

HSP 2 Score: 107.071 bits (266), Expect = 3.480e-25
Identity = 51/92 (55.43%), Postives = 70/92 (76.09%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW 990
            + S+ GS  N +H PGGGN++I  +K++ SNV++KCGSK NI HKPGGG+VEI +EKL+F  KAQ+KV SL+NI H P GG  +I++ KL +
Sbjct:  194 VKSRCGSKDNMQHVPGGGNIQIVHKKIDLSNVQSKCGSKANIHHKPGGGNVEIKSEKLDF--KAQSKVGSLENIGHVPGGGQRRIESHKLNF 283          

HSP 3 Score: 79.7221 bits (195), Expect = 7.367e-16
Identity = 43/96 (44.79%), Postives = 65/96 (67.71%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  NV++K GS +N+KH+PGGG V I ++K++     +++  S  N++H P GG+++I + K++  NV SK GS ANI HKP GGNV I SE L +
Sbjct:  159 DLKNVKSKIGSTENLKHQPGGGKVTIVHKKIDLTN-VKSRCGSKDNMQHVPGGGNIQIVHKKIDLSNVQSKCGSKANIHHKPGGGNVEIKSEKLDF 253          
BLAST of Microtubule-associated protein 4 vs. Ensembl Zebrafish
Match: maptb (microtubule-associated protein tau b [Source:ZFIN;Acc:ZDB-GENE-081027-2])

HSP 1 Score: 109.383 bits (272), Expect = 1.122e-26
Identity = 52/92 (56.52%), Postives = 71/92 (77.17%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW 990
            + SKIGS  N +H+PGGG ++I  +K++ SNV++KCGSK NI HKPGGG+VEI +EKL+F  KAQ+KV SL+NI H P GG  +I++ KL +
Sbjct:  146 VKSKIGSTENLKHQPGGGKIQIVHKKIDLSNVQSKCGSKANIHHKPGGGNVEIKSEKLDF--KAQSKVGSLENIGHVPGGGQRRIESHKLNF 235          

HSP 2 Score: 79.337 bits (194), Expect = 3.834e-16
Identity = 42/93 (45.16%), Postives = 62/93 (66.67%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            +  NV++K GS +N+KH+PGGG ++I ++K++ +   Q+K  S  NI H+P GG+V+I + KL++   SKVGSL NI H P GG   I S  L
Sbjct:  142 DLKNVKSKIGSTENLKHQPGGGKIQIVHKKIDLSN-VQSKCGSKANIHHKPGGGNVEIKSEKLDFKAQSKVGSLENIGHVPGGGQRRIESHKL 233          
BLAST of Microtubule-associated protein 4 vs. Ensembl Zebrafish
Match: maptb (microtubule-associated protein tau b [Source:ZFIN;Acc:ZDB-GENE-081027-2])

HSP 1 Score: 110.153 bits (274), Expect = 1.304e-26
Identity = 52/92 (56.52%), Postives = 71/92 (77.17%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW 990
            + SKIGS  N +H+PGGG ++I  +K++ SNV++KCGSK NI HKPGGG+VEI +EKL+F  KAQ+KV SL+NI H P GG  +I++ KL +
Sbjct:  157 VKSKIGSTENLKHQPGGGKIQIVHKKIDLSNVQSKCGSKANIHHKPGGGNVEIKSEKLDF--KAQSKVGSLENIGHVPGGGQRRIESHKLNF 246          

HSP 2 Score: 80.4925 bits (197), Expect = 2.373e-16
Identity = 42/93 (45.16%), Postives = 62/93 (66.67%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            +  NV++K GS +N+KH+PGGG ++I ++K++ +   Q+K  S  NI H+P GG+V+I + KL++   SKVGSL NI H P GG   I S  L
Sbjct:  153 DLKNVKSKIGSTENLKHQPGGGKIQIVHKKIDLSN-VQSKCGSKANIHHKPGGGNVEIKSEKLDFKAQSKVGSLENIGHVPGGGQRRIESHKL 244          
BLAST of Microtubule-associated protein 4 vs. Ensembl Xenopus
Match: tbp (TATA-box binding protein [Source:Xenbase;Acc:XB-GENE-488470])

HSP 1 Score: 115.931 bits (289), Expect = 2.004e-27
Identity = 56/123 (45.53%), Postives = 84/123 (68.29%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SKIGS+ N RH+PGGG V+I  +K++ S+V++KCGSK N+KH PGGG ++I ++ ++      +K  S  NI H+P GG+V++ + KLE++ + SK+GSL NI H P GG   I S  L +
Sbjct:  281 VRSKIGSIDNIRHQPGGGKVQIVHKKIDLSSVQSKCGSKDNLKHMPGGGTIQITHKPIDLTH-ITSKCGSFGNIHHRPGGGNVEVKSEKLEFDKIQSKIGSLDNITHTPGGGAKKIESHKLMF 402          

HSP 2 Score: 79.7221 bits (195), Expect = 2.062e-15
Identity = 40/100 (40.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFN 1092
            +  NV +K GS  NI+H+PGGG V+I ++K++ +   Q+K  S  N++H P GG ++I +  ++  ++ SK GS  NI H+P GGNV + SE L + K  
Sbjct:  277 DLKNVRSKIGSIDNIRHQPGGGKVQIVHKKIDLS-SVQSKCGSKDNLKHMPGGGTIQITHKPIDLTHITSKCGSFGNIHHRPGGGNVEVKSEKLEFDKIQ 375          
BLAST of Microtubule-associated protein 4 vs. Ensembl Xenopus
Match: tbp (TATA-box binding protein [Source:Xenbase;Acc:XB-GENE-488470])

HSP 1 Score: 115.931 bits (289), Expect = 2.243e-27
Identity = 56/123 (45.53%), Postives = 84/123 (68.29%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SKIGS+ N RH+PGGG V+I  +K++ S+V++KCGSK N+KH PGGG ++I ++ ++      +K  S  NI H+P GG+V++ + KLE++ + SK+GSL NI H P GG   I S  L +
Sbjct:  298 VRSKIGSIDNIRHQPGGGKVQIVHKKIDLSSVQSKCGSKDNLKHMPGGGTIQITHKPIDLTH-ITSKCGSFGNIHHRPGGGNVEVKSEKLEFDKIQSKIGSLDNITHTPGGGAKKIESHKLMF 419          

HSP 2 Score: 79.7221 bits (195), Expect = 2.206e-15
Identity = 40/100 (40.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFN 1092
            +  NV +K GS  NI+H+PGGG V+I ++K++ +   Q+K  S  N++H P GG ++I +  ++  ++ SK GS  NI H+P GGNV + SE L + K  
Sbjct:  294 DLKNVRSKIGSIDNIRHQPGGGKVQIVHKKIDLS-SVQSKCGSKDNLKHMPGGGTIQITHKPIDLTHITSKCGSFGNIHHRPGGGNVEVKSEKLEFDKIQ 392          
BLAST of Microtubule-associated protein 4 vs. Ensembl Xenopus
Match: tbp (TATA-box binding protein [Source:Xenbase;Acc:XB-GENE-488470])

HSP 1 Score: 115.161 bits (287), Expect = 1.014e-26
Identity = 56/121 (46.28%), Postives = 83/121 (68.60%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            + SKIGS+ N RH+PGGG V+I  +K++ S+V++KCGSK N+KH PGGG ++I ++ ++      +K  S  NI H+P GG+V++ + KLE++ + SK+GSL NI H P GG   I S  L
Sbjct:  507 VRSKIGSIDNIRHQPGGGKVQIVHKKIDLSSVQSKCGSKDNLKHMPGGGTIQITHKPIDLTH-ITSKCGSFGNIHHRPGGGNVEVKSEKLEFDKIQSKIGSLDNITHTPGGGAKKIESHKL 626          

HSP 2 Score: 78.9518 bits (193), Expect = 6.434e-15
Identity = 40/100 (40.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFN 1092
            +  NV +K GS  NI+H+PGGG V+I ++K++ +   Q+K  S  N++H P GG ++I +  ++  ++ SK GS  NI H+P GGNV + SE L + K  
Sbjct:  503 DLKNVRSKIGSIDNIRHQPGGGKVQIVHKKIDLS-SVQSKCGSKDNLKHMPGGGTIQITHKPIDLTHITSKCGSFGNIHHRPGGGNVEVKSEKLEFDKIQ 601          
BLAST of Microtubule-associated protein 4 vs. Ensembl Xenopus
Match: tbp (TATA-box binding protein [Source:Xenbase;Acc:XB-GENE-488470])

HSP 1 Score: 115.161 bits (287), Expect = 1.032e-26
Identity = 56/121 (46.28%), Postives = 83/121 (68.60%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            + SKIGS+ N RH+PGGG V+I  +K++ S+V++KCGSK N+KH PGGG ++I ++ ++      +K  S  NI H+P GG+V++ + KLE++ + SK+GSL NI H P GG   I S  L
Sbjct:  462 VRSKIGSIDNIRHQPGGGKVQIVHKKIDLSSVQSKCGSKDNLKHMPGGGTIQITHKPIDLTH-ITSKCGSFGNIHHRPGGGNVEVKSEKLEFDKIQSKIGSLDNITHTPGGGAKKIESHKL 581          

HSP 2 Score: 78.5666 bits (192), Expect = 7.235e-15
Identity = 40/100 (40.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFN 1092
            +  NV +K GS  NI+H+PGGG V+I ++K++ +   Q+K  S  N++H P GG ++I +  ++  ++ SK GS  NI H+P GGNV + SE L + K  
Sbjct:  458 DLKNVRSKIGSIDNIRHQPGGGKVQIVHKKIDLS-SVQSKCGSKDNLKHMPGGGTIQITHKPIDLTHITSKCGSFGNIHHRPGGGNVEVKSEKLEFDKIQ 556          
BLAST of Microtubule-associated protein 4 vs. Ensembl Xenopus
Match: tbp (TATA-box binding protein [Source:Xenbase;Acc:XB-GENE-488470])

HSP 1 Score: 115.161 bits (287), Expect = 1.105e-26
Identity = 56/121 (46.28%), Postives = 83/121 (68.60%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            + SKIGS+ N RH+PGGG V+I  +K++ S+V++KCGSK N+KH PGGG ++I ++ ++      +K  S  NI H+P GG+V++ + KLE++ + SK+GSL NI H P GG   I S  L
Sbjct:  524 VRSKIGSIDNIRHQPGGGKVQIVHKKIDLSSVQSKCGSKDNLKHMPGGGTIQITHKPIDLTH-ITSKCGSFGNIHHRPGGGNVEVKSEKLEFDKIQSKIGSLDNITHTPGGGAKKIESHKL 643          

HSP 2 Score: 78.9518 bits (193), Expect = 6.373e-15
Identity = 40/100 (40.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFN 1092
            +  NV +K GS  NI+H+PGGG V+I ++K++ +   Q+K  S  N++H P GG ++I +  ++  ++ SK GS  NI H+P GGNV + SE L + K  
Sbjct:  520 DLKNVRSKIGSIDNIRHQPGGGKVQIVHKKIDLS-SVQSKCGSKDNLKHMPGGGTIQITHKPIDLTHITSKCGSFGNIHHRPGGGNVEVKSEKLEFDKIQ 618          
BLAST of Microtubule-associated protein 4 vs. Ensembl Mouse
Match: Map4 (microtubule-associated protein 4 [Source:MGI Symbol;Acc:MGI:97178])

HSP 1 Score: 124.02 bits (310), Expect = 1.283e-31
Identity = 59/117 (50.43%), Postives = 85/117 (72.65%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHI 1059
            + SK+GS  N +H+PGGG V+I  +KV++S++++KCGSK NIKH PGGG+V+I N+K++ + K  +K  S  NI+H+P GGDVKI++ KL +     +KVGSL N+ H P GG V I
Sbjct:  128 VRSKVGSTENIKHQPGGGRVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDIS-KVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKI 243          

HSP 2 Score: 117.472 bits (293), Expect = 2.726e-29
Identity = 55/92 (59.78%), Postives = 67/92 (72.83%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW 990
            I SK GS  N +H PGGGNV+I  +KV+ S V +KCGSK NIKHKPGGGDV+I ++KL F  KAQAKV SL N+ H P GG VKI+  +L +
Sbjct:  159 IQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKIETYRLTF 250          

HSP 3 Score: 85.8853 bits (211), Expect = 3.076e-18
Identity = 46/94 (48.94%), Postives = 66/94 (70.21%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            +  +V +K GS +NIKH+PGGG V+I ++K+ ++   Q+K  S  NI+H P GG+V+I N K++ + V SK GS ANIKHKP GG+V I S+ L
Sbjct:  124 DLKSVRSKVGSTENIKHQPGGGRVQIVSKKVSYSH-IQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKL 216          
BLAST of Microtubule-associated protein 4 vs. Ensembl Mouse
Match: Map4 (microtubule-associated protein 4 [Source:MGI Symbol;Acc:MGI:97178])

HSP 1 Score: 120.939 bits (302), Expect = 2.202e-31
Identity = 62/128 (48.44%), Postives = 89/128 (69.53%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHKPCGGNVHIV----SEPLPW 1080
            + SK+GS  N +H+PGGG V+I  +KV++S++++KCGSK NIKH PGGG+V+I N+K++ + K  +K  S  NI+H+P GGDVKI++ KL +     +KVGSL N+ H P GG V +     SE LP 
Sbjct:   28 VRSKVGSTENIKHQPGGGRVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDIS-KVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKVTEGGGSEALPC 154          

HSP 2 Score: 110.538 bits (275), Expect = 1.105e-27
Identity = 70/158 (44.30%), Postives = 91/158 (57.59%), Query Frame = 1
Query:  508 PTYSKRSSRDPNL--LQSSLNADVRLRSNAKSLNRYDRATSEEMAGR--ITSMESSYSEKTNNSGSAASNNYVITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKI 969
            PT +K SS  P +  L ++++A   L+S    +   +    +   GR  I S + SYS               I SK GS  N +H PGGGNV+I  +KV+ S V +KCGSK NIKHKPGGGDV+I ++KL F  KAQAKV SL N+ H P GG VK+
Sbjct:    1 PTSTKPSSSAPRVSRLATTVSAP-DLKSVRSKVGSTENIKHQPGGGRVQIVSKKVSYSH--------------IQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKV 143          

HSP 3 Score: 81.6481 bits (200), Expect = 2.272e-17
Identity = 46/94 (48.94%), Postives = 66/94 (70.21%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            +  +V +K GS +NIKH+PGGG V+I ++K+ ++   Q+K  S  NI+H P GG+V+I N K++ + V SK GS ANIKHKP GG+V I S+ L
Sbjct:   24 DLKSVRSKVGSTENIKHQPGGGRVQIVSKKVSYSH-IQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKL 116          
BLAST of Microtubule-associated protein 4 vs. Ensembl Mouse
Match: Map4 (microtubule-associated protein 4 [Source:MGI Symbol;Acc:MGI:97178])

HSP 1 Score: 117.857 bits (294), Expect = 3.663e-30
Identity = 62/127 (48.82%), Postives = 88/127 (69.29%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHKPCGGNVHI---VSEPLPW 1080
            + SK+GS  N +H+PGGG V+I  +KV++S++++KCGSK NIKH PGGG+V+I N+K++ + K  +K  S  NI+H+P GGDVKI++ KL +     +KVGSL N+ H P GG V      SE LP 
Sbjct:   36 VRSKVGSTENIKHQPGGGRVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDIS-KVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEALPC 161          

HSP 2 Score: 109.768 bits (273), Expect = 3.333e-27
Identity = 70/160 (43.75%), Postives = 91/160 (56.88%), Query Frame = 1
Query:  508 PTYSKRSSRDPNL--LQSSLNADVRLRSNAKSLNRYDRATSEEMAGR--ITSMESSYSEKTNNSGSAASNNYVITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDN 975
            PT +K SS  P +  L ++++A   L+S    +   +    +   GR  I S + SYS               I SK GS  N +H PGGGNV+I  +KV+ S V +KCGSK NIKHKPGGGDV+I ++KL F  KAQAKV SL N+ H P GG VK + 
Sbjct:    9 PTSTKPSSSAPRVSRLATTVSAP-DLKSVRSKVGSTENIKHQPGGGRVQIVSKKVSYSH--------------IQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEG 153          

HSP 3 Score: 81.2629 bits (199), Expect = 3.675e-17
Identity = 46/94 (48.94%), Postives = 66/94 (70.21%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            +  +V +K GS +NIKH+PGGG V+I ++K+ ++   Q+K  S  NI+H P GG+V+I N K++ + V SK GS ANIKHKP GG+V I S+ L
Sbjct:   32 DLKSVRSKVGSTENIKHQPGGGRVQIVSKKVSYSH-IQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKL 124          
BLAST of Microtubule-associated protein 4 vs. Ensembl Mouse
Match: Map4 (microtubule-associated protein 4 [Source:MGI Symbol;Acc:MGI:97178])

HSP 1 Score: 121.324 bits (303), Expect = 9.420e-29
Identity = 62/127 (48.82%), Postives = 88/127 (69.29%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHKPCGGNVHIV---SEPLPW 1080
            + SK+GS  N +H+PGGG V+I  +KV++S++++KCGSK NIKH PGGG+V+I N+K++ + K  +K  S  NI+H+P GGDVKI++ KL +     +KVGSL N+ H P GG V      SE LP 
Sbjct:  755 VRSKVGSTENIKHQPGGGRVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDIS-KVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEALPC 880          

HSP 2 Score: 83.9593 bits (206), Expect = 1.482e-16
Identity = 46/94 (48.94%), Postives = 66/94 (70.21%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            +  +V +K GS +NIKH+PGGG V+I ++K+ ++   Q+K  S  NI+H P GG+V+I N K++ + V SK GS ANIKHKP GG+V I S+ L
Sbjct:  751 DLKSVRSKVGSTENIKHQPGGGRVQIVSKKVSYSH-IQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKL 843          
BLAST of Microtubule-associated protein 4 vs. Ensembl Mouse
Match: Mapt (microtubule-associated protein tau [Source:MGI Symbol;Acc:MGI:97180])

HSP 1 Score: 115.931 bits (289), Expect = 4.395e-28
Identity = 60/124 (48.39%), Postives = 84/124 (67.74%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SKIGS  N +H+PGGG V+I  +K++ SNV++KCGSK NIKH PGGG V+I  + ++ + K  +K  SL NI H+P GG V++ + KL++   V SK+GSL NI H P GGN  I +  L +
Sbjct:  187 VRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLS-KVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTF 309          

HSP 2 Score: 100.138 bits (248), Expect = 1.130e-22
Identity = 52/109 (47.71%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHK 1035
            + SK GS  N +H PGGG+V+I  + V+ S V +KCGS  NI HKPGGG VE+ +EKL+F  + Q+K+ SL NI H P GG+ KI+  KL +  N  +K    A I +K
Sbjct:  218 VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYK 326          

HSP 3 Score: 81.2629 bits (199), Expect = 3.174e-16
Identity = 45/96 (46.88%), Postives = 62/96 (64.58%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  NV +K GS +N+KH+PGGG V+I N+KL+ +   Q+K  S  NI+H P GG V+I    ++ + V SK GSL NI HKP GG V + SE L +
Sbjct:  183 DLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSN-VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDF 277          
BLAST of Microtubule-associated protein 4 vs. UniProt/SwissProt
Match: sp|Q6TS35|TAU_SPECI (Microtubule-associated protein tau OS=Spermophilus citellus OX=9997 GN=MAPT PE=1 SV=3)

HSP 1 Score: 116.701 bits (291), Expect = 4.030e-27
Identity = 60/124 (48.39%), Postives = 84/124 (67.74%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SKIGS  N +H+PGGG V+I  +K++ SNV++KCGSK NIKH PGGG V+I  + ++ + K  +K  SL NI H+P GG V++ + KL++   V SK+GSL NI H P GGN  I +  L +
Sbjct:  245 VRSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLS-KVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTF 367          

HSP 2 Score: 101.293 bits (251), Expect = 6.874e-22
Identity = 52/109 (47.71%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHK 1035
            + SK GS  N +H PGGG+V+I  + V+ S V +KCGS  NI HKPGGG VE+ +EKL+F  + Q+K+ SL NI H P GG+ KI+  KL +  N  +K    A I +K
Sbjct:  276 VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYK 384          

HSP 3 Score: 81.6481 bits (200), Expect = 2.261e-15
Identity = 45/96 (46.88%), Postives = 62/96 (64.58%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  NV +K GS +N+KH+PGGG V+I N+KL+ +   Q+K  S  NI+H P GG V+I    ++ + V SK GSL NI HKP GG V + SE L +
Sbjct:  241 DLKNVRSKIGSTENLKHQPGGGKVQIINKKLDLSN-VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDF 335          
BLAST of Microtubule-associated protein 4 vs. UniProt/SwissProt
Match: sp|Q9MYX8|TAU_PAPHA (Microtubule-associated protein tau OS=Papio hamadryas OX=9557 GN=MAPT PE=2 SV=3)

HSP 1 Score: 115.546 bits (288), Expect = 4.081e-27
Identity = 60/124 (48.39%), Postives = 84/124 (67.74%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SKIGS  N +H+PGGG V+I  +K++ SNV++KCGSK NIKH PGGG V+I  + ++ + K  +K  SL NI H+P GG V++ + KL++   V SK+GSL NI H P GGN  I +  L +
Sbjct:  198 VKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLS-KVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTF 320          

HSP 2 Score: 99.7525 bits (247), Expect = 1.366e-21
Identity = 52/109 (47.71%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHK 1035
            + SK GS  N +H PGGG+V+I  + V+ S V +KCGS  NI HKPGGG VE+ +EKL+F  + Q+K+ SL NI H P GG+ KI+  KL +  N  +K    A I +K
Sbjct:  229 VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYK 337          

HSP 3 Score: 81.2629 bits (199), Expect = 2.243e-15
Identity = 45/96 (46.88%), Postives = 63/96 (65.62%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  NV++K GS +N+KH+PGGG V+I N+KL+ +   Q+K  S  NI+H P GG V+I    ++ + V SK GSL NI HKP GG V + SE L +
Sbjct:  194 DLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSN-VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDF 288          
BLAST of Microtubule-associated protein 4 vs. UniProt/SwissProt
Match: sp|O02828|TAU_CAPHI (Microtubule-associated protein tau OS=Capra hircus OX=9925 GN=MAPT PE=2 SV=3)

HSP 1 Score: 115.931 bits (289), Expect = 5.055e-27
Identity = 60/124 (48.39%), Postives = 84/124 (67.74%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SKIGS  N +H+PGGG V+I  +K++ SNV++KCGSK NIKH PGGG V+I  + ++ + K  +K  SL NI H+P GG V++ + KL++   V SK+GSL NI H P GGN  I +  L +
Sbjct:  218 VKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLS-KVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTF 340          

HSP 2 Score: 100.138 bits (248), Expect = 1.161e-21
Identity = 52/109 (47.71%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHK 1035
            + SK GS  N +H PGGG+V+I  + V+ S V +KCGS  NI HKPGGG VE+ +EKL+F  + Q+K+ SL NI H P GG+ KI+  KL +  N  +K    A I +K
Sbjct:  249 VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYK 357          

HSP 3 Score: 81.2629 bits (199), Expect = 2.688e-15
Identity = 45/96 (46.88%), Postives = 63/96 (65.62%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  NV++K GS +N+KH+PGGG V+I N+KL+ +   Q+K  S  NI+H P GG V+I    ++ + V SK GSL NI HKP GG V + SE L +
Sbjct:  214 DLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSN-VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDF 308          
BLAST of Microtubule-associated protein 4 vs. UniProt/SwissProt
Match: sp|P57786|TAU_MACMU (Microtubule-associated protein tau OS=Macaca mulatta OX=9544 GN=MAPT PE=2 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 6.134e-27
Identity = 60/124 (48.39%), Postives = 84/124 (67.74%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SKIGS  N +H+PGGG V+I  +K++ SNV++KCGSK NIKH PGGG V+I  + ++ + K  +K  SL NI H+P GG V++ + KL++   V SK+GSL NI H P GGN  I +  L +
Sbjct:  274 VKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLS-KVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTF 396          

HSP 2 Score: 100.523 bits (249), Expect = 1.356e-21
Identity = 52/109 (47.71%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHK 1035
            + SK GS  N +H PGGG+V+I  + V+ S V +KCGS  NI HKPGGG VE+ +EKL+F  + Q+K+ SL NI H P GG+ KI+  KL +  N  +K    A I +K
Sbjct:  305 VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYK 413          

HSP 3 Score: 81.6481 bits (200), Expect = 2.653e-15
Identity = 45/96 (46.88%), Postives = 63/96 (65.62%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  NV++K GS +N+KH+PGGG V+I N+KL+ +   Q+K  S  NI+H P GG V+I    ++ + V SK GSL NI HKP GG V + SE L +
Sbjct:  270 DLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSN-VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDF 364          
BLAST of Microtubule-associated protein 4 vs. UniProt/SwissProt
Match: sp|P29172|TAU_BOVIN (Microtubule-associated protein tau OS=Bos taurus OX=9913 GN=MAPT PE=1 SV=3)

HSP 1 Score: 115.931 bits (289), Expect = 7.636e-27
Identity = 60/124 (48.39%), Postives = 84/124 (67.74%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SKIGS  N +H+PGGG V+I  +K++ SNV++KCGSK NIKH PGGG V+I  + ++ + K  +K  SL NI H+P GG V++ + KL++   V SK+GSL NI H P GGN  I +  L +
Sbjct:  263 VKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLS-KVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTF 385          

HSP 2 Score: 100.523 bits (249), Expect = 1.410e-21
Identity = 52/109 (47.71%), Postives = 70/109 (64.22%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHK 1035
            + SK GS  N +H PGGG+V+I  + V+ S V +KCGS  NI HKPGGG VE+ +EKL+F  + Q+K+ SL NI H P GG+ KI+  KL +  N  +K    A I +K
Sbjct:  294 VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYK 402          

HSP 3 Score: 81.2629 bits (199), Expect = 2.950e-15
Identity = 45/96 (46.88%), Postives = 63/96 (65.62%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  NV++K GS +N+KH+PGGG V+I N+KL+ +   Q+K  S  NI+H P GG V+I    ++ + V SK GSL NI HKP GG V + SE L +
Sbjct:  259 DLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSN-VQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDF 353          
BLAST of Microtubule-associated protein 4 vs. TrEMBL
Match: A0A0X3PA02 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR114015 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.935e-46
Identity = 96/203 (47.29%), Postives = 130/203 (64.04%), Query Frame = 1
Query:  541 NLLQSSLNADVRLRSNAKSLNRYDRATSEEMAGRITSMESSYSE---KTNNSGSAASNNYVITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFNKPNLPPEEIAKINK 1134
            +L +S+  + VR R       RYDRA SE+  G          +   + +++ S++     IT+K+ SLAN  ++PGGGNVKI +RK++FSN ++KC SK NI +KPGGGD+ I +EKL F   ++ KVNSL+N +H P GGDVKID  K ++      K+ SL N +H P GG V I SE LPWLK+NKPNLP EE+ KINK
Sbjct:  173 DLRESTRASSVRAR------GRYDRAMSEDFLGGGCGSGGGVGDTESEHSSAFSSSGQPRRITAKVNSLANASYKPGGGNVKILDRKLDFSNAKSKCNSKANIHYKPGGGDICIMDEKLNFKEASKPKVNSLQNAKHAPRGGDVKIDTQKFDFRDTAKPKIESLKNAQHHPGGGGVQIFSEKLPWLKYNKPNLPREELEKINK 369          
BLAST of Microtubule-associated protein 4 vs. TrEMBL
Match: A0A564YC92 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS4530 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 6.916e-46
Identity = 83/142 (58.45%), Postives = 107/142 (75.35%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFNKPNLPPEEIAKINK 1134
            ITSKIGS  N  ++PGGGNVKI + KV+FS  ++KC SK N+KHKP GGDV+I + KL F    ++++NSL N +H P GG+VKI++ KLE+  +  S++GSL N  +K  GGNV I +E LPWLK+NKPNLPPEEIAKINK
Sbjct:  168 ITSKIGSFTNANYKPGGGNVKILDEKVDFSYAQSKCNSKANLKHKPCGGDVQIVDNKLHFKENGRSRINSLANAKHVPGGGNVKIESRKLEFKESATSRIGSLQNASYKAGGGNVKIFNEKLPWLKYNKPNLPPEEIAKINK 309          
BLAST of Microtubule-associated protein 4 vs. TrEMBL
Match: A0A3P7D748 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS13723 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.672e-45
Identity = 82/144 (56.94%), Postives = 105/144 (72.92%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFNKPNLPPEEIAKINKKS 1140
            IT+K+ SLAN  ++PGGGNVKI +RK++FSN ++KC SK NI +KPGGGD+ I +EKL F   ++ KVNSL+N +H P GGDVKID  K ++      K+ SL N +H P GG V I SE LPWLK+NKPNLP EE+ KINK +
Sbjct:   92 ITAKVNSLANASYKPGGGNVKILDRKLDFSNAKSKCNSKANIHYKPGGGDICIMDEKLNFKEASKPKVNSLQNAKHAPRGGDVKIDTQKFDFRDTAKPKIESLKNAQHHPGGGGVQIFSEKLPWLKYNKPNLPREELEKINKHA 235          
BLAST of Microtubule-associated protein 4 vs. TrEMBL
Match: A0A183TB75 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.799e-45
Identity = 82/144 (56.94%), Postives = 105/144 (72.92%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFNKPNLPPEEIAKINKKS 1140
            IT+K+ SLAN  ++PGGGNVKI +RK++FSN ++KC SK NI +KPGGGD+ I +EKL F   ++ KVNSL+N +H P GGDVKID  K ++      K+ SL N +H P GG V I SE LPWLK+NKPNLP EE+ KINK +
Sbjct:   92 ITAKVNSLANASYKPGGGNVKILDRKLDFSNAKSKCNSKANIHYKPGGGDICIMDEKLNFKEASKPKVNSLQNAKHAPRGGDVKIDTQKFDFRDTAKPKIESLKNAQHHPGGGGVQIFSEKLPWLKYNKPNLPREELEKINKHA 235          
BLAST of Microtubule-associated protein 4 vs. TrEMBL
Match: A0A095AIH7 (Microtubule-associated protein (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_01947 PE=4 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 2.370e-42
Identity = 80/144 (55.56%), Postives = 104/144 (72.22%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFNKPNLPPEEIAKINKKS 1140
            I+SKIGS  N +H+PGGGNV+IF  KV  + V  KC S  N+KHKPGGG+++I ++KL+F+   Q+KV S +NI+H P GGD KI   KL++      KVGSLAN+KH P GG+V I +E LPWLK+NKPNLP  E  +INK+S
Sbjct:    3 ISSKIGSFQNAKHKPGGGNVQIFNEKVIVNTVAGKCNSLANVKHKPGGGNLQIIDQKLDFSSNTQSKVRSFQNIKHIPGGGDKKIPVEKLDFKEKASPKVGSLANVKHNPAGGDVKIFNEHLPWLKYNKPNLPDSEKDRINKRS 146          
BLAST of Microtubule-associated protein 4 vs. Ensembl Cavefish
Match: mapta (microtubule-associated protein tau a [Source:ZFIN;Acc:ZDB-GENE-081027-1])

HSP 1 Score: 119.398 bits (298), Expect = 9.118e-29
Identity = 61/120 (50.83%), Postives = 85/120 (70.83%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            + SKIGS  N +H+PGGG VKI ++K++ SNV++KCGSK N+KH PGGG+V+I ++K++ +   Q+K  S  NI H+P GG+++I + KLE+ V SKVGSL NI H   GG   I S  L
Sbjct:  312 VRSKIGSTDNLKHQPGGGRVKILDQKLDLSNVQSKCGSKDNMKHVPGGGNVQIVHKKIDLSN-VQSKCGSKDNIRHKPGGGNIEIRSEKLEFKVQSKVGSLDNIGHVAGGGQRRIESHKL 430          
BLAST of Microtubule-associated protein 4 vs. Ensembl Cavefish
Match: maptb (microtubule-associated protein tau-like [Source:NCBI gene;Acc:103023138])

HSP 1 Score: 110.153 bits (274), Expect = 9.250e-27
Identity = 53/92 (57.61%), Postives = 69/92 (75.00%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW 990
            + SKIGS  N +H+PGGG ++I  +K++ SNV++KCGSK NI HKPGGG+ EI +EKLEF  KAQ+KV SL NI H P GG  KI++ KL +
Sbjct:  146 VKSKIGSTENLKHQPGGGKIQIVHKKIDLSNVQSKCGSKANIHHKPGGGNFEIKSEKLEF--KAQSKVGSLDNIGHVPGGGQRKIESHKLVF 235          

HSP 2 Score: 80.1073 bits (196), Expect = 2.992e-16
Identity = 42/95 (44.21%), Postives = 62/95 (65.26%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  NV++K GS +N+KH+PGGG ++I ++K++ +   Q+K  S  NI H+P GG+ +I + KLE+   SKVGSL NI H P GG   I S  L +
Sbjct:  142 DLKNVKSKIGSTENLKHQPGGGKIQIVHKKIDLSN-VQSKCGSKANIHHKPGGGNFEIKSEKLEFKAQSKVGSLDNIGHVPGGGQRKIESHKLVF 235          
BLAST of Microtubule-associated protein 4 vs. Ensembl Cavefish
Match: maptb (microtubule-associated protein tau-like [Source:NCBI gene;Acc:103023138])

HSP 1 Score: 110.153 bits (274), Expect = 1.762e-26
Identity = 53/92 (57.61%), Postives = 69/92 (75.00%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW 990
            + SKIGS  N +H+PGGG ++I  +K++ SNV++KCGSK NI HKPGGG+ EI +EKLEF  KAQ+KV SL NI H P GG  KI++ KL +
Sbjct:  180 VKSKIGSTENLKHQPGGGKIQIVHKKIDLSNVQSKCGSKANIHHKPGGGNFEIKSEKLEF--KAQSKVGSLDNIGHVPGGGQRKIESHKLVF 269          

HSP 2 Score: 79.7221 bits (195), Expect = 5.455e-16
Identity = 42/95 (44.21%), Postives = 62/95 (65.26%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  NV++K GS +N+KH+PGGG ++I ++K++ +   Q+K  S  NI H+P GG+ +I + KLE+   SKVGSL NI H P GG   I S  L +
Sbjct:  176 DLKNVKSKIGSTENLKHQPGGGKIQIVHKKIDLSN-VQSKCGSKANIHHKPGGGNFEIKSEKLEFKAQSKVGSLDNIGHVPGGGQRKIESHKLVF 269          
BLAST of Microtubule-associated protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000047795.1 (microtubule-associated protein 4-like [Source:NCBI gene;Acc:103034726])

HSP 1 Score: 113.62 bits (283), Expect = 3.133e-26
Identity = 52/97 (53.61%), Postives = 70/97 (72.16%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSK 1005
            +TS++GS  N +H PGGGNV+I  +KV+ S V +KCGSK NIKHKPGGGDV+I + K+ F  KA  KV SL N+ H P GG+ KI++ KL + V ++
Sbjct: 1209 VTSRLGSKDNMKHVPGGGNVQILSKKVDLSKVTSKCGSKSNIKHKPGGGDVKIESHKVNFKDKAHPKVGSLDNVSHAPGGGNFKIESFKLNFRVKAR 1305          

HSP 2 Score: 95.1301 bits (235), Expect = 2.934e-20
Identity = 57/144 (39.58%), Postives = 83/144 (57.64%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNV-------------------------KIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHIVS 1065
            I SKIGS  N +++PGGG V                         +I  +KV++S+V ++ GSK N+KH PGGG+V+I ++K++ + K  +K  S  NI+H+P GGDVKI++ K+ +      KVGSL N+ H P GGN  I S
Sbjct: 1153 IRSKIGSTDNIKYQPGGGKVTVSQSRTDALAQGSKETKETSQGKVQIVSKKVDYSHVTSRLGSKDNMKHVPGGGNVQILSKKVDLS-KVTSKCGSKSNIKHKPGGGDVKIESHKVNFKDKAHPKVGSLDNVSHAPGGGNFKIES 1295          
BLAST of Microtubule-associated protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000045977.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:2828307:2868566:1 gene:ENSAMXG00000034032.1 transcript:ENSAMXT00000045977.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 1.679e-25
Identity = 53/121 (43.80%), Postives = 84/121 (69.42%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHKPCGGNVHIVSEP 1071
            + SKIGS  N +++P GG ++I  +K+  S+V++KCGSK N+ H P GG+V+I ++KL+ +    +K  SL NI H+P GG+V+I+++KL++     +KVGSL N  H P GG+V +V +P
Sbjct:  209 VRSKIGSTDNIKYQPKGGQIQILNKKLELSHVQSKCGSKDNLLHSPRGGNVQIQSKKLDLSH-VTSKCGSLDNIRHRPGGGNVRIESVKLDFKDKAQAKVGSLDNAHHTPGGGHV-LVRDP 327          

HSP 2 Score: 83.5741 bits (205), Expect = 3.376e-17
Identity = 44/91 (48.35%), Postives = 61/91 (67.03%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVS 1065
            +  NV +K GS  NIK++P GG ++I N+KLE +   Q+K  S  N+ H P GG+V+I + KL+  +V SK GSL NI+H+P GGNV I S
Sbjct:  205 DLKNVRSKIGSTDNIKYQPKGGQIQILNKKLELSH-VQSKCGSKDNLLHSPRGGNVQIQSKKLDLSHVTSKCGSLDNIRHRPGGGNVRIES 294          

HSP 3 Score: 63.929 bits (154), Expect = 8.322e-11
Identity = 32/67 (47.76%), Postives = 42/67 (62.69%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSN-VEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQA 912
            +TSK GSL N RHRPGGGNV+I   K++F +  +AK GS  N  H PGGG V + + +   + K  A
Sbjct:  271 VTSKCGSLDNIRHRPGGGNVRIESVKLDFKDKAQAKVGSLDNAHHTPGGGHVLVRDPQRAMSLKVNA 337          
BLAST of Microtubule-associated protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002181.1 (pep scaffold:Pmarinus_7.0:GL476563:68046:79774:-1 gene:ENSPMAG00000001984.1 transcript:ENSPMAT00000002181.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 6.238e-30
Identity = 52/92 (56.52%), Postives = 73/92 (79.35%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW 990
            +TSK GS+AN +H PGGGNV+I  +KV+  +V +KCGSK NI HKPGGG+++I ++KL+F+ KAQ+KV SL N +H P GG+VKI++ KL +
Sbjct:  126 VTSKCGSMANVKHIPGGGNVQIVSKKVDVRHVASKCGSKDNITHKPGGGNIQIVSKKLDFSEKAQSKVGSLDNADHVPGGGNVKIESQKLSF 217          

HSP 2 Score: 110.538 bits (275), Expect = 8.724e-28
Identity = 59/133 (44.36%), Postives = 88/133 (66.17%), Query Frame = 1
Query:  703 NNYVITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN--VGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFNK 1095
            N   + SKIGS  N +H+P GG ++I  +K++FS+V +KCGS  N+KH PGGG+V+I ++K++  R   +K  S  NI H+P GG+++I + KL+++    SKVGSL N  H P GGNV I S+ L + +  K
Sbjct:   91 NLKAVRSKIGSTDNIKHQPAGGKIQIVTKKLDFSHVTSKCGSMANVKHIPGGGNVQIVSKKVDV-RHVASKCGSKDNITHKPGGGNIQIVSKKLDFSEKAQSKVGSLDNADHVPGGGNVKIESQKLSFRETAK 222          
BLAST of Microtubule-associated protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003065.1 (pep scaffold:Pmarinus_7.0:GL477794:46732:52129:1 gene:ENSPMAG00000002792.1 transcript:ENSPMAT00000003065.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 8.414e-28
Identity = 50/92 (54.35%), Postives = 68/92 (73.91%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW 990
            + SK GS    +H PGGGNV+I  +K++ S+V +KCGSK N+KHKPGGG + I N KLEF  KAQ+KV S+ N++H P GG VKI++ KL++
Sbjct:  117 VVSKCGSKDKIKHAPGGGNVQIVSKKIDLSHVTSKCGSKDNLKHKPGGGHISIENHKLEFKDKAQSKVGSMDNVDHMPGGGVVKIESHKLKF 208          

HSP 2 Score: 101.293 bits (251), Expect = 1.746e-24
Identity = 55/124 (44.35%), Postives = 81/124 (65.32%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW--NVGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            I SKI S+ N +H+P GG VKI  + ++ ++V +KCGSK  IKH PGGG+V+I ++K++ +    +K  S  N++H+P GG + I+N KLE+     SKVGS+ N+ H P GG V I S  L +
Sbjct:   86 IKSKICSIDNIKHQPKGGKVKIENKPLDVTHVVSKCGSKDKIKHAPGGGNVQIVSKKIDLSH-VTSKCGSKDNLKHKPGGGHISIENHKLEFKDKAQSKVGSMDNVDHMPGGGVVKIESHKLKF 208          

HSP 3 Score: 63.5438 bits (153), Expect = 1.298e-11
Identity = 38/96 (39.58%), Postives = 59/96 (61.46%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  N+++K  S  NIKH+P GG V+I N+ L+      +K  S   I+H P GG+V+I + K++  +V SK GS  N+KHKP GG++ I +  L +
Sbjct:   82 DLKNIKSKICSIDNIKHQPKGGKVKIENKPLDVTH-VVSKCGSKDKIKHAPGGGNVQIVSKKIDLSHVTSKCGSKDNLKHKPGGGHISIENHKLEF 176          

HSP 4 Score: 62.7734 bits (151), Expect = 2.953e-11
Identity = 30/70 (42.86%), Postives = 46/70 (65.71%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSN-VEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVN 921
            +TSK GS  N +H+PGGG++ I   K+ F +  ++K GS  N+ H PGGG V+I + KL+F   A+A+ +
Sbjct:  148 VTSKCGSKDNLKHKPGGGHISIENHKLEFKDKAQSKVGSMDNVDHMPGGGVVKIESHKLKFRESARARTD 217          
BLAST of Microtubule-associated protein 4 vs. Ensembl Medaka
Match: mapta (microtubule-associated protein tau [Source:NCBI gene;Acc:101160113])

HSP 1 Score: 126.716 bits (317), Expect = 7.084e-32
Identity = 60/111 (54.05%), Postives = 83/111 (74.77%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGG 1047
            + SKIGS  N +H+PGGG V+I E+K++ SNV+AKCGSK NIKH+PGGG V+I ++K++ +    +K  S  NI H+P GG+++I + KLE+ V SK+GSL NIKH P GG
Sbjct:  222 VRSKIGSTENIKHQPGGGKVQILEQKLDLSNVQAKCGSKDNIKHQPGGGKVQIVHKKIDLST-VTSKCGSKANIHHKPGGGNIEIKSEKLEFKVQSKIGSLDNIKHVPGGG 331          

HSP 2 Score: 90.1225 bits (222), Expect = 3.072e-19
Identity = 49/96 (51.04%), Postives = 65/96 (67.71%), Query Frame = 1
Query:  796 NFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +  NV +K GS +NIKH+PGGG V+I  +KL+ +   QAK  S  NI+HQP GG V+I + K++ + V SK GS ANI HKP GGN+ I SE L +
Sbjct:  218 DLKNVRSKIGSTENIKHQPGGGKVQILEQKLDLSN-VQAKCGSKDNIKHQPGGGKVQIVHKKIDLSTVTSKCGSKANIHHKPGGGNIEIKSEKLEF 312          
BLAST of Microtubule-associated protein 4 vs. Ensembl Medaka
Match: mapta (microtubule-associated protein tau [Source:NCBI gene;Acc:101160113])

HSP 1 Score: 126.716 bits (317), Expect = 2.820e-31
Identity = 65/121 (53.72%), Postives = 86/121 (71.07%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            + SKIGS  N +H+PGGG V+I E+K++ SNV+AKCGSK NIKH+PGGG V+I ++KL+ +   Q++  S  NI+H P GG VKI   +L++ NV SK GS  NIKH P GGNV I  + L
Sbjct:  235 VRSKIGSTENIKHQPGGGKVQILEQKLDLSNVQAKCGSKDNIKHQPGGGKVQILDKKLDLSS-VQSRCGSKDNIKHTPGGGKVKILEQRLDFSNVQSKCGSKDNIKHVPGGGNVQIYEKKL 354          

HSP 2 Score: 123.25 bits (308), Expect = 4.013e-30
Identity = 62/123 (50.41%), Postives = 88/123 (71.54%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + S+ GS  N +H PGGG VKI E++++FSNV++KCGSK NIKH PGGG+V+I+ +KL+ +   Q++  S  N+ H P GG+V+I + K++ + V SK GS ANI HKP GGN+ I SE L +
Sbjct:  297 VQSRCGSKDNIKHTPGGGKVKILEQRLDFSNVQSKCGSKDNIKHVPGGGNVQIYEKKLDLSS-VQSRCGSKDNLGHVPGGGNVQIVHKKIDLSTVTSKCGSKANIHHKPGGGNIEIKSEKLEF 418          

HSP 3 Score: 118.627 bits (296), Expect = 1.831e-28
Identity = 58/122 (47.54%), Postives = 86/122 (70.49%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SK GS  N +H PGGGNV+I+E+K++ S+V+++CGSK N+ H PGGG+V+I ++K++ +    +K  S  NI H+P GG+++I + KLE+ V SK+GSL NIKH P GG   I S  L +
Sbjct:  328 VQSKCGSKDNIKHVPGGGNVQIYEKKLDLSSVQSRCGSKDNLGHVPGGGNVQIVHKKIDLST-VTSKCGSKANIHHKPGGGNIEIKSEKLEFKVQSKIGSLDNIKHVPGGGAKRIESHKLTF 448          
BLAST of Microtubule-associated protein 4 vs. Ensembl Medaka
Match: mapta (microtubule-associated protein tau [Source:NCBI gene;Acc:101160113])

HSP 1 Score: 127.102 bits (318), Expect = 3.182e-31
Identity = 65/121 (53.72%), Postives = 86/121 (71.07%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            + SKIGS  N +H+PGGG V+I E+K++ SNV+AKCGSK NIKH+PGGG V+I ++KL+ +   Q++  S  NI+H P GG VKI   +L++ NV SK GS  NIKH P GGNV I  + L
Sbjct:  266 VRSKIGSTENIKHQPGGGKVQILEQKLDLSNVQAKCGSKDNIKHQPGGGKVQILDKKLDLSS-VQSRCGSKDNIKHTPGGGKVKILEQRLDFSNVQSKCGSKDNIKHVPGGGNVQIYEKKL 385          

HSP 2 Score: 123.635 bits (309), Expect = 4.572e-30
Identity = 62/123 (50.41%), Postives = 88/123 (71.54%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + S+ GS  N +H PGGG VKI E++++FSNV++KCGSK NIKH PGGG+V+I+ +KL+ +   Q++  S  N+ H P GG+V+I + K++ + V SK GS ANI HKP GGN+ I SE L +
Sbjct:  328 VQSRCGSKDNIKHTPGGGKVKILEQRLDFSNVQSKCGSKDNIKHVPGGGNVQIYEKKLDLSS-VQSRCGSKDNLGHVPGGGNVQIVHKKIDLSTVTSKCGSKANIHHKPGGGNIEIKSEKLEF 449          

HSP 3 Score: 118.627 bits (296), Expect = 2.011e-28
Identity = 58/122 (47.54%), Postives = 86/122 (70.49%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SK GS  N +H PGGGNV+I+E+K++ S+V+++CGSK N+ H PGGG+V+I ++K++ +    +K  S  NI H+P GG+++I + KLE+ V SK+GSL NIKH P GG   I S  L +
Sbjct:  359 VQSKCGSKDNIKHVPGGGNVQIYEKKLDLSSVQSRCGSKDNLGHVPGGGNVQIVHKKIDLST-VTSKCGSKANIHHKPGGGNIEIKSEKLEFKVQSKIGSLDNIKHVPGGGAKRIESHKLTF 479          
BLAST of Microtubule-associated protein 4 vs. Ensembl Medaka
Match: mapta (microtubule-associated protein tau [Source:NCBI gene;Acc:101160113])

HSP 1 Score: 126.716 bits (317), Expect = 3.187e-31
Identity = 65/121 (53.72%), Postives = 86/121 (71.07%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            + SKIGS  N +H+PGGG V+I E+K++ SNV+AKCGSK NIKH+PGGG V+I ++KL+ +   Q++  S  NI+H P GG VKI   +L++ NV SK GS  NIKH P GGNV I  + L
Sbjct:  253 VRSKIGSTENIKHQPGGGKVQILEQKLDLSNVQAKCGSKDNIKHQPGGGKVQILDKKLDLSS-VQSRCGSKDNIKHTPGGGKVKILEQRLDFSNVQSKCGSKDNIKHVPGGGNVQIYEKKL 372          

HSP 2 Score: 123.635 bits (309), Expect = 4.155e-30
Identity = 62/123 (50.41%), Postives = 88/123 (71.54%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + S+ GS  N +H PGGG VKI E++++FSNV++KCGSK NIKH PGGG+V+I+ +KL+ +   Q++  S  N+ H P GG+V+I + K++ + V SK GS ANI HKP GGN+ I SE L +
Sbjct:  315 VQSRCGSKDNIKHTPGGGKVKILEQRLDFSNVQSKCGSKDNIKHVPGGGNVQIYEKKLDLSS-VQSRCGSKDNLGHVPGGGNVQIVHKKIDLSTVTSKCGSKANIHHKPGGGNIEIKSEKLEF 436          

HSP 3 Score: 118.627 bits (296), Expect = 1.920e-28
Identity = 58/122 (47.54%), Postives = 86/122 (70.49%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + SK GS  N +H PGGGNV+I+E+K++ S+V+++CGSK N+ H PGGG+V+I ++K++ +    +K  S  NI H+P GG+++I + KLE+ V SK+GSL NIKH P GG   I S  L +
Sbjct:  346 VQSKCGSKDNIKHVPGGGNVQIYEKKLDLSSVQSRCGSKDNLGHVPGGGNVQIVHKKIDLST-VTSKCGSKANIHHKPGGGNIEIKSEKLEFKVQSKIGSLDNIKHVPGGGAKRIESHKLTF 466          
BLAST of Microtubule-associated protein 4 vs. Ensembl Medaka
Match: mapta (microtubule-associated protein tau [Source:NCBI gene;Acc:101160113])

HSP 1 Score: 125.946 bits (315), Expect = 3.265e-31
Identity = 65/121 (53.72%), Postives = 86/121 (71.07%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVSEPL 1074
            + SKIGS  N +H+PGGG V+I E+K++ SNV+AKCGSK NIKH+PGGG V+I ++KL+ +   Q++  S  NI+H P GG VKI   +L++ NV SK GS  NIKH P GGNV I  + L
Sbjct:  192 VRSKIGSTENIKHQPGGGKVQILEQKLDLSNVQAKCGSKDNIKHQPGGGKVQILDKKLDLS-SVQSRCGSKDNIKHTPGGGKVKILEQRLDFSNVQSKCGSKDNIKHVPGGGNVQIYEKKL 311          

HSP 2 Score: 122.479 bits (306), Expect = 5.222e-30
Identity = 62/123 (50.41%), Postives = 88/123 (71.54%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            + S+ GS  N +H PGGG VKI E++++FSNV++KCGSK NIKH PGGG+V+I+ +KL+ +   Q++  S  N+ H P GG+V+I + K++ + V SK GS ANI HKP GGN+ I SE L +
Sbjct:  254 VQSRCGSKDNIKHTPGGGKVKILEQRLDFSNVQSKCGSKDNIKHVPGGGNVQIYEKKLDLS-SVQSRCGSKDNLGHVPGGGNVQIVHKKIDLSTVTSKCGSKANIHHKPGGGNIEIKSEKLEF 375          

HSP 3 Score: 115.931 bits (289), Expect = 9.439e-28
Identity = 55/111 (49.55%), Postives = 82/111 (73.87%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGG 1047
            + SK GS  N +H PGGGNV+I+E+K++ S+V+++CGSK N+ H PGGG+V+I ++K++ +    +K  S  NI H+P GG+++I + KLE+ V SK+GSL NIKH P GG
Sbjct:  285 VQSKCGSKDNIKHVPGGGNVQIYEKKLDLSSVQSRCGSKDNLGHVPGGGNVQIVHKKIDLST-VTSKCGSKANIHHKPGGGNIEIKSEKLEFKVQSKIGSLDNIKHVPGGG 394          
BLAST of Microtubule-associated protein 4 vs. Planmine SMEST
Match: SMESG000068843.1 (SMESG000068843.1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 337/338 (99.70%), Postives = 337/338 (99.70%), Query Frame = 1
Query:  205 MTDISIRSPSIENGIENFHKESVPTENNFPVPIGSRPTAIPRLSSAATPRPSHNADSNGKTNKSKIPFSSLNVKPNRPKSVGSYIKTPTQESDNFREFLTSPTYSKRSSRDPNLLQSSLNADVRLRSNAKSLNRYDRATSEEMAGRITSMESSYSEKTNNSGSAASNNYVITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFNKPNLPPEEIAKINKKSKRDESRDGLPTASRSCSNSICSDRSN 1218
            MTDISIRS SIENGIENFHKESVPTENNFPVPIGSRPTAIPRLSSAATPRPSHNADSNGKTNKSKIPFSSLNVKPNRPKSVGSYIKTPTQESDNFREFLTSPTYSKRSSRDPNLLQSSLNADVRLRSNAKSLNRYDRATSEEMAGRITSMESSYSEKTNNSGSAASNNYVITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFNKPNLPPEEIAKINKKSKRDESRDGLPTASRSCSNSICSDRSN
Sbjct:    1 MTDISIRSSSIENGIENFHKESVPTENNFPVPIGSRPTAIPRLSSAATPRPSHNADSNGKTNKSKIPFSSLNVKPNRPKSVGSYIKTPTQESDNFREFLTSPTYSKRSSRDPNLLQSSLNADVRLRSNAKSLNRYDRATSEEMAGRITSMESSYSEKTNNSGSAASNNYVITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFNKPNLPPEEIAKINKKSKRDESRDGLPTASRSCSNSICSDRSN 338          
BLAST of Microtubule-associated protein 4 vs. Planmine SMEST
Match: SMESG000011360.1 (SMESG000011360.1)

HSP 1 Score: 70.4774 bits (171), Expect = 7.410e-13
Identity = 48/151 (31.79%), Postives = 78/151 (51.66%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW--------LKFNKPNLPPEE----IAKI 1128
            + +KI    N  H PGGG  +I+ R  ++S +E K   ++N KH PGGG  +I+++ L+++   +AK+    N +H P GG  +I +   +++ +  K+    N KH P GG   I S+ L +         K N  + P EE    +AKI
Sbjct:  283 VEAKIPFKDNEDHVPGGGGTRIYSRTSDYSGIEPKIPFRENEKHVPGGGTTKIYSQNLDYS-GVEAKIPFKDNEDHVPGGGGTRIYSRTSDYSGIEPKIPFRENEKHVPGGGTTKIYSQNLDYSGVEAKIPFKDNADHTPGEEAQRSLAKI 432          

HSP 2 Score: 69.707 bits (169), Expect = 1.254e-12
Identity = 42/118 (35.59%), Postives = 62/118 (52.54%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVS 1065
            + SKI    N RH PGGG  KI+ R  ++S +E K   + N KH PGGG   I++   +++   + K+    N +H P GG  KI +  L+++ V +K+    N  H P GG   I S
Sbjct:  190 VESKIPFHDNARHSPGGGTTKIYSRTSDYSGIEPKIPFRDNEKHVPGGGRTRIYSRTSDYS-GIEPKIPFRDNEDHTPGGGTTKIFSQNLDYSGVEAKIPFKDNEDHVPGGGGTRIYS 306          

HSP 3 Score: 68.1662 bits (165), Expect = 4.855e-12
Identity = 43/118 (36.44%), Postives = 62/118 (52.54%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVS 1065
            I  KI    N  H PGGG  KIF + +++S VEAK   K N  H PGGG   I++   +++   + K+   +N +H P GG  KI +  L+++ V +K+    N  H P GG   I S
Sbjct:  252 IEPKIPFRDNEDHTPGGGTTKIFSQNLDYSGVEAKIPFKDNEDHVPGGGGTRIYSRTSDYS-GIEPKIPFRENEKHVPGGGTTKIYSQNLDYSGVEAKIPFKDNEDHVPGGGGTRIYS 368          

HSP 4 Score: 67.781 bits (164), Expect = 5.076e-12
Identity = 40/123 (32.52%), Postives = 65/123 (52.85%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            I  KI    N +H PGGG  +I+ R  ++S +E K   + N  H PGGG  +I ++ L+++   +AK+    N +H P GG  +I +   +++ +  K+    N KH P GG   I S+ L +
Sbjct:  221 IEPKIPFRDNEKHVPGGGRTRIYSRTSDYSGIEPKIPFRDNEDHTPGGGTTKIFSQNLDYS-GVEAKIPFKDNEDHVPGGGGTRIYSRTSDYSGIEPKIPFRENEKHVPGGGTTKIYSQNLDY 342          

HSP 5 Score: 55.0694 bits (131), Expect = 7.335e-8
Identity = 31/107 (28.97%), Postives = 56/107 (52.34%), Query Frame = 1
Query:  763 GGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            GG  K+F + +++S VE+K     N +H PGGG  +I++   +++   + K+    N +H P GG  +I +   +++ +  K+    N  H P GG   I S+ L +
Sbjct:  175 GGTTKVFSQSIDYSGVESKIPFHDNARHSPGGGTTKIYSRTSDYS-GIEPKIPFRDNEKHVPGGGRTRIYSRTSDYSGIEPKIPFRDNEDHTPGGGTTKIFSQNLDY 280          
BLAST of Microtubule-associated protein 4 vs. Planmine SMEST
Match: SMESG000011197.1 (SMESG000011197.1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.405e-12
Identity = 28/61 (45.90%), Postives = 41/61 (67.21%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFN 897
            I SKIGSL N  H+PGGG  K+F   +++S V +K GS  N  HK GGG+ ++ NE ++++
Sbjct:    6 IQSKIGSLDNAAHQPGGGTTKVFNENIDYSGVASKSGSLDNAAHKAGGGEKKVFNEVVKYD 66          

HSP 2 Score: 46.9802 bits (110), Expect = 7.283e-7
Identity = 25/62 (40.32%), Postives = 36/62 (58.06%), Query Frame = 1
Query:  898 RKAQAKVNSLKNIEHQPLGGDVKIDNLKLEW-NVGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            +K Q+K+ SL N  HQP GG  K+ N  +++  V SK GSL N  HK  GG   + +E + +
Sbjct:    4 KKIQSKIGSLDNAAHQPGGGTTKVFNENIDYSGVASKSGSLDNAAHKAGGGEKKVFNEVVKY 65          
BLAST of Microtubule-associated protein 4 vs. Planmine SMEST
Match: SMESG000052262.1 (SMESG000052262.1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.558e-12
Identity = 48/151 (31.79%), Postives = 78/151 (51.66%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW--------LKFNKPNLPPEE----IAKI 1128
            + +KI    N  H PGGG  +I+ R  ++S +E K   ++N KH PGGG  +I+++ L+++   +AK+    N +H P GG  +I +   +++ +  K+    N KH P GG   I S+ L +         K N  + P EE    +AKI
Sbjct:  192 VEAKIPFKDNEDHVPGGGGTRIYSRTSDYSGIEPKIPFRENEKHVPGGGTTKIYSQNLDYS-GVEAKIPFKDNEDHVPGGGGTRIYSRTSDYSGIEPKIPFRENEKHVPGGGTTKIYSQNLDYSGVEAKIPFKDNADHTPGEEAQRSLAKI 341          

HSP 2 Score: 68.9366 bits (167), Expect = 1.645e-12
Identity = 40/118 (33.90%), Postives = 64/118 (54.24%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVS 1065
            + SK+GSL N  H PGGG  +I+ +  +++ VEAK   + N  H PGGG   I++   +++    AK+    N  + P GG  K+ +  ++++ V SK+    N +H P GG   I S
Sbjct:    6 VNSKVGSLENADHVPGGGRTRIYSQTSDYTGVEAKIPFRDNENHVPGGGRTRIYSRTSDYS-GIDAKIPFHDNELYTPSGGTTKVFSQSIDYSGVESKIPFHDNARHSPGGGTTKIYS 122          

HSP 3 Score: 67.3958 bits (163), Expect = 4.347e-12
Identity = 42/118 (35.59%), Postives = 62/118 (52.54%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVS 1065
            + SKI    N RH PGGG  KI+ R  ++S +E K   + N KH PGGG   I++   +++   + K+    N +H P GG  KI +  L+++ V +K+    N  H P GG   I S
Sbjct:   99 VESKIPFHDNARHSPGGGTTKIYSRTSDYSGIEPKIPFRDNEKHVPGGGRTRIYSRTSDYS-GIEPKIPFRDNEDHTPGGGTTKIFSQNLDYSGVEAKIPFKDNEDHVPGGGGTRIYS 215          

HSP 4 Score: 65.855 bits (159), Expect = 1.739e-11
Identity = 40/123 (32.52%), Postives = 65/123 (52.85%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            I  KI    N +H PGGG  +I+ R  ++S +E K   + N  H PGGG  +I ++ L+++   +AK+    N +H P GG  +I +   +++ +  K+    N KH P GG   I S+ L +
Sbjct:  130 IEPKIPFRDNEKHVPGGGRTRIYSRTSDYSGIEPKIPFRDNEDHTPGGGTTKIFSQNLDYS-GVEAKIPFKDNEDHVPGGGGTRIYSRTSDYSGIEPKIPFRENEKHVPGGGTTKIYSQNLDY 251          

HSP 5 Score: 65.855 bits (159), Expect = 1.819e-11
Identity = 43/118 (36.44%), Postives = 62/118 (52.54%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVS 1065
            I  KI    N  H PGGG  KIF + +++S VEAK   K N  H PGGG   I++   +++   + K+   +N +H P GG  KI +  L+++ V +K+    N  H P GG   I S
Sbjct:  161 IEPKIPFRDNEDHTPGGGTTKIFSQNLDYSGVEAKIPFKDNEDHVPGGGGTRIYSRTSDYS-GIEPKIPFRENEKHVPGGGTTKIYSQNLDYSGVEAKIPFKDNEDHVPGGGGTRIYS 277          

HSP 6 Score: 57.7658 bits (138), Expect = 7.122e-9
Identity = 36/123 (29.27%), Postives = 63/123 (51.22%), Query Frame = 1
Query:  715 ITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVSEPLPW 1080
            I +KI    N  + P GG  K+F + +++S VE+K     N +H PGGG  +I++   +++   + K+    N +H P GG  +I +   +++ +  K+    N  H P GG   I S+ L +
Sbjct:   68 IDAKIPFHDNELYTPSGGTTKVFSQSIDYSGVESKIPFHDNARHSPGGGTTKIYSRTSDYS-GIEPKIPFRDNEKHVPGGGRTRIYSRTSDYSGIEPKIPFRDNEDHTPGGGTTKIFSQNLDY 189          

HSP 7 Score: 55.8398 bits (133), Expect = 3.009e-8
Identity = 36/126 (28.57%), Postives = 63/126 (50.00%), Query Frame = 1
Query:  691 SAASNNYVITSKIGSLANTRHRPGGGNVKIFERKVNFSNVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLGGDVKIDNLKLEWN-VGSKVGSLANIKHKPCGGNVHIVS 1065
            S  S+   + +KI    N  H PGGG  +I+ R  ++S ++AK     N  + P GG  ++ ++ ++++   ++K+    N  H P GG  KI +   +++ +  K+    N KH P GG   I S
Sbjct:   29 SQTSDYTGVEAKIPFRDNENHVPGGGRTRIYSRTSDYSGIDAKIPFHDNELYTPSGGTTKVFSQSIDYS-GVESKIPFHDNARHSPGGGTTKIYSRTSDYSGIEPKIPFRDNEKHVPGGGRTRIYS 153          
The following BLAST results are available for this feature:
BLAST of Microtubule-associated protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP49.724e-3050.43microtubule associated protein 4 [Source:HGNC Symb... [more]
MAP41.333e-2850.43microtubule associated protein 4 [Source:HGNC Symb... [more]
MAPT1.006e-2748.39microtubule associated protein tau [Source:HGNC Sy... [more]
MAPT1.006e-2748.39microtubule associated protein tau [Source:HGNC Sy... [more]
MAPT1.006e-2748.39microtubule associated protein tau [Source:HGNC Sy... [more]
back to top
BLAST of Microtubule-associated protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptl-16.583e-2631.86Microtubule-associated protein [Source:UniProtKB/... [more]
ptl-16.583e-2631.86Microtubule-associated protein [Source:UniProtKB/... [more]
ptl-11.263e-2449.57Microtubule-associated protein [Source:UniProtKB/... [more]
ptl-11.263e-2449.57Microtubule-associated protein [Source:UniProtKB/... [more]
ptl-11.751e-2449.57Microtubule-associated protein [Source:UniProtKB/... [more]
back to top
BLAST of Microtubule-associated protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tau2.400e-2741.67gene:FBgn0266579 transcript:FBtr0344751[more]
tau2.400e-2741.67gene:FBgn0266579 transcript:FBtr0344750[more]
tau4.423e-2741.67gene:FBgn0266579 transcript:FBtr0344746[more]
tau4.710e-2734.60gene:FBgn0266579 transcript:FBtr0344741[more]
tau4.710e-2734.60gene:FBgn0266579 transcript:FBtr0344742[more]
back to top
BLAST of Microtubule-associated protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapta3.008e-3050.43microtubule-associated protein tau a [Source:ZFIN;... [more]
mapta7.618e-2948.39microtubule-associated protein tau a [Source:ZFIN;... [more]
maptb8.513e-2846.67microtubule-associated protein tau b [Source:ZFIN;... [more]
maptb1.122e-2656.52microtubule-associated protein tau b [Source:ZFIN;... [more]
maptb1.304e-2656.52microtubule-associated protein tau b [Source:ZFIN;... [more]
back to top
BLAST of Microtubule-associated protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbp2.004e-2745.53TATA-box binding protein [Source:Xenbase;Acc:XB-GE... [more]
tbp2.243e-2745.53TATA-box binding protein [Source:Xenbase;Acc:XB-GE... [more]
tbp1.014e-2646.28TATA-box binding protein [Source:Xenbase;Acc:XB-GE... [more]
tbp1.032e-2646.28TATA-box binding protein [Source:Xenbase;Acc:XB-GE... [more]
tbp1.105e-2646.28TATA-box binding protein [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Microtubule-associated protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map41.283e-3150.43microtubule-associated protein 4 [Source:MGI Symbo... [more]
Map42.202e-3148.44microtubule-associated protein 4 [Source:MGI Symbo... [more]
Map43.663e-3048.82microtubule-associated protein 4 [Source:MGI Symbo... [more]
Map49.420e-2948.82microtubule-associated protein 4 [Source:MGI Symbo... [more]
Mapt4.395e-2848.39microtubule-associated protein tau [Source:MGI Sym... [more]
back to top
BLAST of Microtubule-associated protein 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6TS35|TAU_SPECI4.030e-2748.39Microtubule-associated protein tau OS=Spermophilus... [more]
sp|Q9MYX8|TAU_PAPHA4.081e-2748.39Microtubule-associated protein tau OS=Papio hamadr... [more]
sp|O02828|TAU_CAPHI5.055e-2748.39Microtubule-associated protein tau OS=Capra hircus... [more]
sp|P57786|TAU_MACMU6.134e-2748.39Microtubule-associated protein tau OS=Macaca mulat... [more]
sp|P29172|TAU_BOVIN7.636e-2748.39Microtubule-associated protein tau OS=Bos taurus O... [more]
back to top
BLAST of Microtubule-associated protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PA022.935e-4647.29Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A564YC926.916e-4658.45Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A3P7D7481.672e-4556.94Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A183TB751.799e-4556.94Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A095AIH72.370e-4255.56Microtubule-associated protein (Fragment) OS=Schis... [more]
back to top
BLAST of Microtubule-associated protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapta9.118e-2950.83microtubule-associated protein tau a [Source:ZFIN;... [more]
maptb9.250e-2757.61microtubule-associated protein tau-like [Source:NC... [more]
maptb1.762e-2657.61microtubule-associated protein tau-like [Source:NC... [more]
ENSAMXT00000047795.13.133e-2653.61microtubule-associated protein 4-like [Source:NCBI... [more]
ENSAMXT00000045977.11.679e-2543.80pep primary_assembly:Astyanax_mexicanus-2.0:19:282... [more]
back to top
BLAST of Microtubule-associated protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000002181.16.238e-3056.52pep scaffold:Pmarinus_7.0:GL476563:68046:79774:-1 ... [more]
ENSPMAT00000003065.18.414e-2854.35pep scaffold:Pmarinus_7.0:GL477794:46732:52129:1 g... [more]
back to top
BLAST of Microtubule-associated protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microtubule-associated protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microtubule-associated protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mapta7.084e-3254.05microtubule-associated protein tau [Source:NCBI ge... [more]
mapta2.820e-3153.72microtubule-associated protein tau [Source:NCBI ge... [more]
mapta3.182e-3153.72microtubule-associated protein tau [Source:NCBI ge... [more]
mapta3.187e-3153.72microtubule-associated protein tau [Source:NCBI ge... [more]
mapta3.265e-3153.72microtubule-associated protein tau [Source:NCBI ge... [more]
back to top
BLAST of Microtubule-associated protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000068843.10.000e+099.70SMESG000068843.1[more]
SMESG000011360.17.410e-1331.79SMESG000011360.1[more]
SMESG000011197.11.405e-1245.90SMESG000011197.1[more]
SMESG000052262.11.558e-1231.79SMESG000052262.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031197 ID=SMED30031197|Name=Microtubule-associated protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1416bp
TGTAGGTGTGTTGTCGTGCTTCTGTTGCAACGTATGTGTGAGGAATTCTC
TCACATGAAACTGGCCAATCAAAACTCACAATTATTTGTTATGCTCTAAA
TTCTCTTCCATTTCTCATTCAAACAACAGGATCTGTTACGAATTTACTGA
ATTCAAACAAATAGTTATCTATTGATTAATTTGTGCATTGAAATTTTCAA
ATCAATGACAGATATATCAATTCGTAGTCCCAGTATTGAAAATGGAATCG
AGAACTTCCACAAAGAATCAGTGCCTACCGAAAACAATTTTCCAGTTCCC
ATTGGATCTCGTCCAACAGCGATACCTCGGTTGTCCTCAGCTGCTACTCC
TCGTCCTAGTCACAATGCCGACAGTAATGGTAAAACAAACAAATCAAAAA
TTCCATTCTCTTCATTAAATGTCAAGCCGAATCGGCCGAAATCGGTTGGA
AGCTATATTAAGACACCGACTCAAGAGTCGGATAATTTTCGTGAATTTTT
GACTTCTCCAACGTATTCAAAACGCTCTTCGAGAGATCCAAATTTGTTGC
AGAGTTCTTTAAATGCCGATGTTAGACTTCGATCGAATGCCAAATCTTTG
AATCGATATGACAGGGCTACGTCTGAAGAAATGGCTGGGAGAATAACTAG
CATGGAAAGCTCTTATTCAGAGAAAACAAATAACTCAGGAAGTGCAGCCA
GTAACAACTATGTCATCACATCAAAGATCGGATCCTTGGCCAACACTCGT
CACAGACCTGGTGGCGGAAATGTGAAGATTTTTGAGAGAAAAGTCAATTT
TTCAAATGTCGAGGCGAAATGTGGATCGAAAAAAAACATCAAACACAAAC
CAGGGGGTGGCGATGTGGAAATTCACAACGAAAAATTGGAATTCAACAGA
AAAGCTCAGGCTAAAGTAAATTCATTAAAAAATATAGAACATCAACCACT
AGGAGGAGATGTCAAGATTGATAATCTAAAATTGGAATGGAATGTTGGGA
GCAAAGTAGGTTCGTTGGCAAACATCAAGCATAAGCCATGTGGTGGTAAT
GTACATATTGTCAGTGAGCCGTTGCCATGGCTGAAATTCAACAAGCCAAA
TTTGCCTCCAGAAGAAATAGCAAAAATCAACAAAAAGTCCAAGAGAGATG
AATCGAGAGACGGTTTGCCTACGGCTTCTCGAAGTTGTTCAAACTCGATC
TGCAGTGACAGGTCGAATTGAACTGATTTGTTTGCGTCATTAATCCTCGC
AATTACAAGTTTTATTAGTTTTATTTCTACTTCTCTCATGGAAGGCTAAA
TTGCAATCTCATGTTGTGAAATATCATTCATCATTCTATCATATTCGTGT
ATTATATTTTTAAGAGTCTATTCCTGGAATATATACTCCATTTTATTTAA
TAAATTTTGCTGATGC
back to top

protein sequence of SMED30031197-orf-1

>SMED30031197-orf-1 ID=SMED30031197-orf-1|Name=SMED30031197-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=339bp
MTDISIRSPSIENGIENFHKESVPTENNFPVPIGSRPTAIPRLSSAATPR
PSHNADSNGKTNKSKIPFSSLNVKPNRPKSVGSYIKTPTQESDNFREFLT
SPTYSKRSSRDPNLLQSSLNADVRLRSNAKSLNRYDRATSEEMAGRITSM
ESSYSEKTNNSGSAASNNYVITSKIGSLANTRHRPGGGNVKIFERKVNFS
NVEAKCGSKKNIKHKPGGGDVEIHNEKLEFNRKAQAKVNSLKNIEHQPLG
GDVKIDNLKLEWNVGSKVGSLANIKHKPCGGNVHIVSEPLPWLKFNKPNL
PPEEIAKINKKSKRDESRDGLPTASRSCSNSICSDRSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0015631tubulin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027324MAP2/MAP4/Tau
IPR001084MAP_tubulin-bd_rpt
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001084Microtubule associated protein, tubulin-binding repeatPFAMPF00418Tubulin-bindingcoord: 190..220
e-value: 1.6E-14
score: 53.6
coord: 221..252
e-value: 8.9E-11
score: 41.6
coord: 253..282
e-value: 8.6E-12
score: 44.9
coord: 171..189
e-value: 2.4E-7
score: 30.6
IPR001084Microtubule associated protein, tubulin-binding repeatPROSITEPS00229TAU_MAP_1coord: 176..188
IPR001084Microtubule associated protein, tubulin-binding repeatPROSITEPS51491TAU_MAP_2coord: 190..220
score: 11.529
IPR001084Microtubule associated protein, tubulin-binding repeatPROSITEPS51491TAU_MAP_2coord: 221..252
score: 10.077
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..32
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 322..338
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 41..79
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 308..338
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..79
IPR027324Microtubule associated protein MAP2/MAP4/TauPANTHERPTHR11501MICROTUBULE-ASSOCIATED PROTEINcoord: 263..290
coord: 147..261