Neuronal acetylcholine receptor subunit alpha-4

Overview
NameNeuronal acetylcholine receptor subunit alpha-4
Smed IDSMED30031159
Length (bp)2010
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuronal acetylcholine receptor subunit alpha-4 (SMED30031159) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-4 (SMED30031159) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuronal acetylcholine receptor subunit alpha-4 (SMED30031159) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-4 (SMED30031159) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031159

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30031159SMESG000069967.1 dd_Smed_v4_6939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031159SMESG000069967.1 dd_Smed_v4_6939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30031159SMESG000069967.1 dd_Smed_v4_6939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30031159SMESG000069967.1 dd_Smed_v4_6939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30031159SMESG000069967.1 dd_Smed_v4_6939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031159SMESG000069967.1 dd_Smed_v4_6939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30031159SMESG000069967.1 dd_Smed_v4_6939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031159SMESG000069967.1 Contig41942newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031159SMESG000069967.1 Contig41942uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30031159SMESG000069967.1 dd_Smed_v6_6939_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30031159SMESG000069967.1 Contig41942newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30031159SMESG000069967.1 Contig41942uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit [Source:HGNC Symbol;Acc:HGNC:1957])

HSP 1 Score: 206.453 bits (524), Expect = 2.356e-58
Identity = 134/401 (33.42%), Postives = 231/401 (57.61%), Query Frame = 1
Query:  199 GEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYA--DERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGMKQVISSASSEK--LHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSN 1386
             E +L  ++ +DY +   I RPV NV D V++ + +++ Q++ +DE NQI+  N+W K  W D  L WNP ++   E +R+P  KIW PDIVLYN A  D ++ +K   +  + Y G + W+PPAIFKS+C ID++ FPFD+Q+C +KFGSW+Y   K+D+ L    S +++ DY ES EW I+  P  +  +K        PD+T+ L ++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L ++ ET PS S  +P +G Y    MI +TLS  +++ V+N+++R      +P W++   +N   +++ M +  S+  + +    L  +E+ N  N   R + K   E        +     H+  K++    NL+ SSS+
Sbjct:   34 AEHRLFERLFEDYNE---IIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKAL--LKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIG--SSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSN-LNCFSRAESKGCKEGYPC-QDGMCGYCHHRRIKISNFSANLTRSSSS 425          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit [Source:HGNC Symbol;Acc:HGNC:1957])

HSP 1 Score: 206.453 bits (524), Expect = 2.356e-58
Identity = 134/401 (33.42%), Postives = 231/401 (57.61%), Query Frame = 1
Query:  199 GEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYA--DERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGMKQVISSASSEK--LHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSN 1386
             E +L  ++ +DY +   I RPV NV D V++ + +++ Q++ +DE NQI+  N+W K  W D  L WNP ++   E +R+P  KIW PDIVLYN A  D ++ +K   +  + Y G + W+PPAIFKS+C ID++ FPFD+Q+C +KFGSW+Y   K+D+ L    S +++ DY ES EW I+  P  +  +K        PD+T+ L ++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L ++ ET PS S  +P +G Y    MI +TLS  +++ V+N+++R      +P W++   +N   +++ M +  S+  + +    L  +E+ N  N   R + K   E        +     H+  K++    NL+ SSS+
Sbjct:   34 AEHRLFERLFEDYNE---IIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKAL--LKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIG--SSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSN-LNCFSRAESKGCKEGYPC-QDGMCGYCHHRRIKISNFSANLTRSSSS 425          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit [Source:HGNC Symbol;Acc:HGNC:1957])

HSP 1 Score: 205.682 bits (522), Expect = 3.670e-58
Identity = 134/401 (33.42%), Postives = 231/401 (57.61%), Query Frame = 1
Query:  199 GEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYA--DERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGMKQVISSASSEK--LHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSN 1386
             E +L  ++ +DY    +I RPV NV D V++ + +++ Q++ +DE NQI+  N+W K  W D  L WNP ++   E +R+P  KIW PDIVLYN A  D ++ +K   +  + Y G + W+PPAIFKS+C ID++ FPFD+Q+C +KFGSW+Y   K+D+ L    S +++ DY ES EW I+  P  +  +K        PD+T+ L ++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L ++ ET PS S  +P +G Y    MI +TLS  +++ V+N+++R      +P W++   +N   +++ M +  S+  + +    L  +E+ N  N   R + K   E        +     H+  K++    NL+ SSS+
Sbjct:   34 AEHRLFERLFEDY---NEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKAL--LKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIG--SSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSN-LNCFSRAESKGCKEGYPC-QDGMCGYCHHRRIKISNFSANLTRSSSS 425          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 200.675 bits (509), Expect = 2.958e-56
Identity = 134/381 (35.17%), Postives = 209/381 (54.86%), Query Frame = 1
Query:  184 YASMSGE--KKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRK-GVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPIS 1317
            + S+ GE  +KL  +++K+Y     + RPV N    + V + L+L+QIM +DEKNQ+LT N+W + +W D  L WN   +  V+ VR P  +IW PDI+LYN ADER        V VN  G   ++PP IFKS+C ID+  FPFD Q C LKFGSW+Y G  LD+Q+     E DI  Y  + EW ++  P +R            PD+TF + ++R + Y+   L++PCVL+S L L++F LP +S  K+ LG+ + ++ ++ + L+AE  P+ S SVP +  Y+   MI++ LS  +++IV+  +        +P W R   +N  +  L MK+             + +++ +  H +R+    + E     P P S
Sbjct:   18 HVSLQGEFQRKLYKELVKNYNP---LERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQM----QEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRP-----------GEDKVRPACQHKQRRCSLASVEMSAVAPPPAS 380          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Match: AC243734.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 200.675 bits (509), Expect = 2.958e-56
Identity = 134/381 (35.17%), Postives = 209/381 (54.86%), Query Frame = 1
Query:  184 YASMSGE--KKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRK-GVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPIS 1317
            + S+ GE  +KL  +++K+Y     + RPV N    + V + L+L+QIM +DEKNQ+LT N+W + +W D  L WN   +  V+ VR P  +IW PDI+LYN ADER        V VN  G   ++PP IFKS+C ID+  FPFD Q C LKFGSW+Y G  LD+Q+     E DI  Y  + EW ++  P +R            PD+TF + ++R + Y+   L++PCVL+S L L++F LP +S  K+ LG+ + ++ ++ + L+AE  P+ S SVP +  Y+   MI++ LS  +++IV+  +        +P W R   +N  +  L MK+             + +++ +  H +R+    + E     P P S
Sbjct:   18 HVSLQGEFQRKLYKELVKNYNP---LERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQM----QEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRP-----------GEDKVRPACQHKQRRCSLASVEMSAVAPPPAS 380          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: acr-16 (Acetylcholine receptor subunit alpha-type acr-16 [Source:UniProtKB/Swiss-Prot;Acc:P48180])

HSP 1 Score: 193.356 bits (490), Expect = 4.431e-54
Identity = 115/316 (36.39%), Postives = 183/316 (57.91%), Query Frame = 1
Query:  202 EKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQ--PDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            E++L   ++++Y     + RPV N  + V V   +AL QI+ +DEKNQ++ VN W  YTW D  L+W+   + N+ +VR P  KIW PD++LYN  D          + V   G + W+PP IFK +C IDI  FPFD Q C+ KFGSWTY G KLD+Q        DI +Y  + EW +      R   +   D   +  PD+ F+L ++R + Y+ + L++PC+L +L+TL+ F LPP++  K+ L + + ++    L +++E +P  S +VP LG ++   MI++T ST  ++ V+NL++R  +  ++  W R
Sbjct:   23 ERRLYEDLMRNYNN---LERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWNDYNLVWDKAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSTGLVHWVPPGIFKISCKIDIQWFPFDEQKCFFKFGSWTYDGYKLDLQ--PATGGFDISEYISNGEWALPLTTVERN--EKFYDCCPEPYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRTPETHDMGPWTR 331          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: acr-9 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q18556])

HSP 1 Score: 194.126 bits (492), Expect = 6.124e-54
Identity = 116/332 (34.94%), Postives = 197/332 (59.34%), Query Frame = 1
Query:  175 LADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMP--PDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQL----YENFSE--IDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRK 1146
            L +  S + E +L+  +  +Y       RPV N  + +VV   + L QI+ +DEKNQ++T+  W +Y W D  L W+P  +  ++++R+P   + IW PD++LYN ADE       V   V+Y G ++ +PP I K +C IDI+ FPFD Q C+LKFGSWTY G+ +D+++     +N S+  ID+  Y ++ EW +L  PAR     N+ D    P L F+LI++R + Y+   L++P  L+SL+T++ F LPP++  K+ L + I ++    L ++A+ TP  S +VP +G ++   M++++ S   +++V+NL+ R  +   +  +LR+
Sbjct:   19 LTEVHSSADEYRLLADLRHNYDPYE---RPVANASEPLVVSVKIYLQQILDVDEKNQVITLVAWIEYQWTDYKLKWDPSEYGGIKDIRIPGNANAIWKPDVLLYNSADENFDSTYPVNYVVSYTGDVLQVPPGILKLSCKIDITYFPFDDQICHLKFGSWTYSGNFIDLRINGPEGKNISDEGIDVQYYVQNGEWNLLAVPARH--ETNIFDEQPYPSLFFYLIIQRRTLYYGLNLIIPSFLISLMTVLGFTLPPDAGEKITLEITILLSVCFFLSMVADMTPPTSEAVPLIGAFFSCCMLVVSASVVFTVLVLNLHNRKPETHEMSPFLRE 345          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: acr-19 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:B3WFZ2])

HSP 1 Score: 193.356 bits (490), Expect = 1.592e-53
Identity = 110/304 (36.18%), Postives = 178/304 (58.55%), Query Frame = 1
Query:  202 EKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQP--DLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFR 1107
            E++L  K+ ++Y K   + RPVRN  + VVV  G+   QI+ +DEK+QI+  NVW + +W D  L W+P  F N++EVR+P + IW PD++LYN  D++      V   V Y G + W+PPAI +S+C IDI+ FPFD Q C +KFGSWTY G   D+      + I    Y  + EW +L   ++R +     +   +P  D+TF + ++R + Y+ + L++PC+L+S L L+ F LP +   K+ LG+ IF++  + + ++AE  P  S ++P +  Y+   M  +  S   ++I +N + R
Sbjct:   25 ERRLYAKLAENYNK---LARPVRNESEAVVVLLGMDYQQILDIDEKHQIMNSNVWLRMSWTDHYLTWDPSEFGNIKEVRLPINNIWKPDVLLYNSVDQQFDSTWPVNAVVLYTGNVTWIPPAIIRSSCAIDIAYFPFDTQHCTMKFGSWTYSGFFTDLI----NTTISPATYKPNGEWELLGLTSQRSIF--FYECCPEPYYDVTFTVSIRRRTLYYGFNLLLPCMLISSLALLSFTLPADCGEKLNLGVTIFMSLCVFMIMVAEAMPQTSDALPLIQIYFSCIMFQVGASVVATVIALNFHHR 319          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: acr-19 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:B3WFZ2])

HSP 1 Score: 193.356 bits (490), Expect = 1.723e-53
Identity = 110/304 (36.18%), Postives = 178/304 (58.55%), Query Frame = 1
Query:  202 EKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQP--DLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFR 1107
            E++L  K+ ++Y K   + RPVRN  + VVV  G+   QI+ +DEK+QI+  NVW + +W D  L W+P  F N++EVR+P + IW PD++LYN  D++      V   V Y G + W+PPAI +S+C IDI+ FPFD Q C +KFGSWTY G   D+      + I    Y  + EW +L   ++R +     +   +P  D+TF + ++R + Y+ + L++PC+L+S L L+ F LP +   K+ LG+ IF++  + + ++AE  P  S ++P +  Y+   M  +  S   ++I +N + R
Sbjct:   31 ERRLYAKLAENYNK---LARPVRNESEAVVVLLGMDYQQILDIDEKHQIMNSNVWLRMSWTDHYLTWDPSEFGNIKEVRLPINNIWKPDVLLYNSVDQQFDSTWPVNAVVLYTGNVTWIPPAIIRSSCAIDIAYFPFDTQHCTMKFGSWTYSGFFTDLI----NTTISPATYKPNGEWELLGLTSQRSIF--FYECCPEPYYDVTFTVSIRRRTLYYGFNLLLPCMLISSLALLSFTLPADCGEKLNLGVTIFMSLCVFMIMVAEAMPQTSDALPLIQIYFSCIMFQVGASVVATVIALNFHHR 325          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Match: acr-25 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q65XS8])

HSP 1 Score: 192.586 bits (488), Expect = 2.642e-53
Identity = 106/318 (33.33%), Postives = 184/318 (57.86%), Query Frame = 1
Query:  190 SMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            +   E  L T++L+DY+    + RP+ N  + V+VK GL L QI+ +DEKNQ++ VN W K++WVD  L W P+++  V ++R    ++WTPD+++YN AD +   +    + V   G + WMPP +++ +C I +  FPFD Q C+LKFGSWT+ G KL++++ +N    DI +Y ++ EW +     +R +           DL F  +++R + Y+A+ L++PC+L+++LTLV F  PP++  KM L + I ++  +    +AE +P  S +VPFL  ++ + +         + + +N + R  K   + +  R
Sbjct:   22 TQKSEGDLYTELLEDYEP---LERPIENSSEAVMVKMGLVLQQIVDVDEKNQVVDVNAWLKFSWVDYSLKWKPEDYGGVTDLRFRKGQLWTPDVLMYNSADPQFDSRYASNLLVYPNGLVNWMPPGLYRLSCKIQVVWFPFDVQECFLKFGSWTFDGTKLNLEIDDN--GFDISNYMQNGEWTLEGTTVKRNIQYYQCCPEPYYDLVFTFVIRRRALYYAFNLILPCILITMLTLVGFTFPPDAGEKMSLQITIMLSICIFQNYVAELSPPTSEAVPFLSAFFAVCLFTCACCVTATTLALNFHHRTGKSHQMNNTFR 334          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0300594)

HSP 1 Score: 220.32 bits (560), Expect = 1.548e-61
Identity = 128/336 (38.10%), Postives = 202/336 (60.12%), Query Frame = 1
Query:  142 WIFVIFPSYITLADYASMSG--EKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            WIF++   Y+ L+    ++G  EK+L+  +L  Y     + RPV N  D + + +GL L+QI+ +DEKNQ+L  NVW K  W D  L WN  ++  V+++R+PP +IW PD+++YN ADE         V V   G  +++PP IFKSTC IDI+ FPFD Q C +KFGSWTY G +LD+QL +     DI  Y  + EW +L  P +R  +          D+TF +I++R + Y+ + L++PCVL++ + L+ F LPP+S  K+ LG+ I ++ ++ L ++AET P+ S +VP LG Y+   M ++  S   +I+++N + R      + +W+R
Sbjct:  293 WIFLLI--YLNLSAKVCLAGYHEKRLLHDLLDPYNT---LERPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDETGG-DISSYVLNGEWELLGVPGKRNEIYYNCCPEPYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIR 622          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0080594)

HSP 1 Score: 220.32 bits (560), Expect = 1.548e-61
Identity = 128/336 (38.10%), Postives = 202/336 (60.12%), Query Frame = 1
Query:  142 WIFVIFPSYITLADYASMSG--EKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            WIF++   Y+ L+    ++G  EK+L+  +L  Y     + RPV N  D + + +GL L+QI+ +DEKNQ+L  NVW K  W D  L WN  ++  V+++R+PP +IW PD+++YN ADE         V V   G  +++PP IFKSTC IDI+ FPFD Q C +KFGSWTY G +LD+QL +     DI  Y  + EW +L  P +R  +          D+TF +I++R + Y+ + L++PCVL++ + L+ F LPP+S  K+ LG+ I ++ ++ L ++AET P+ S +VP LG Y+   M ++  S   +I+++N + R      + +W+R
Sbjct:  293 WIFLLI--YLNLSAKVCLAGYHEKRLLHDLLDPYNT---LERPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDETGG-DISSYVLNGEWELLGVPGKRNEIYYNCCPEPYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIR 622          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0309867)

HSP 1 Score: 220.32 bits (560), Expect = 1.548e-61
Identity = 128/336 (38.10%), Postives = 202/336 (60.12%), Query Frame = 1
Query:  142 WIFVIFPSYITLADYASMSG--EKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            WIF++   Y+ L+    ++G  EK+L+  +L  Y     + RPV N  D + + +GL L+QI+ +DEKNQ+L  NVW K  W D  L WN  ++  V+++R+PP +IW PD+++YN ADE         V V   G  +++PP IFKSTC IDI+ FPFD Q C +KFGSWTY G +LD+QL +     DI  Y  + EW +L  P +R  +          D+TF +I++R + Y+ + L++PCVL++ + L+ F LPP+S  K+ LG+ I ++ ++ L ++AET P+ S +VP LG Y+   M ++  S   +I+++N + R      + +W+R
Sbjct:  293 WIFLLI--YLNLSAKVCLAGYHEKRLLHDLLDPYNT---LERPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDETGG-DISSYVLNGEWELLGVPGKRNEIYYNCCPEPYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIR 622          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0474155)

HSP 1 Score: 219.935 bits (559), Expect = 3.292e-61
Identity = 128/336 (38.10%), Postives = 204/336 (60.71%), Query Frame = 1
Query:  142 WIFVIFPSYITLADYASMSG--EKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            WIF++   Y+ L+    ++G  EK+L+  +L  Y     + RPV N  D + + +GL L+QI+ +DEKNQ+L  NVW K  W D  L WN  ++  V+++R+PP +IW PD+++YN ADE         V V   G  +++PP IFKSTC IDI+ FPFD Q C +KFGSWTY G +LD+QL ++ +  DI  Y  + EW +L  P +R  +          D+TF +I++R + Y+ + L++PCVL++ + L+ F LPP+S  K+ LG+ I ++ ++ L ++AET P+ S +VP LG Y+   M ++  S   +I+++N + R      + +W+R
Sbjct:  293 WIFLLI--YLNLSAKVCLAGYHEKRLLHDLLDPYNT---LERPVLNESDPLQLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQL-QDETGGDISSYVLNGEWELLGVPGKRNEIYYNCCPEPYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIR 622          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Match: nAChRalpha7 (gene:FBgn0086778 transcript:FBtr0301835)

HSP 1 Score: 211.46 bits (537), Expect = 6.669e-60
Identity = 122/325 (37.54%), Postives = 193/325 (59.38%), Query Frame = 1
Query:  169 ITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            I +   A+   EK+L+  +L +Y     + RPV N  D + + +GL L+QI+ +DEKNQ+L  N+W K  W D  L WN   F  V ++R+PP ++W PD+++YN ADE         V V   G  +++PP IFKSTC IDI+ FPFD Q C +KFGSWTY G +LD+QL +     DI  +  + EW +L  P +R  +          D+TF ++++R + Y+ + L+VPCVL++ + L+ F LPP+S  K+ LG+ I ++ ++ L ++AET P+ S +VP LG Y+   M ++  S   +I+++N + R      + +W+R
Sbjct:   50 IMIPACAAGPHEKRLLHALLDNYNS---LERPVVNESDPLQLSFGLTLMQIIDVDEKNQLLITNIWLKLEWNDMNLRWNSSEFGGVRDLRIPPHRLWKPDVLMYNSADEGFDGTYATNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQDEAGG-DISSFITNGEWDLLGVPGKRNEIYYNCCPEPYIDITFAILIRRKTLYYFFNLIVPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNPDTHEMSEWIR 370          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: si:ch73-380n15.2 (si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-161])

HSP 1 Score: 211.846 bits (538), Expect = 1.951e-60
Identity = 130/339 (38.35%), Postives = 200/339 (59.00%), Query Frame = 1
Query:  133 VIVWIFVIFPSYITLADYASMSGE--KKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
             IV+   IF SYI      S+ GE  +KL  +++++Y +   + RPV N    +VV+ GL L+QI+ +DEKNQ+L  N W +  W D  L WNP N+  V+ +R P ++IWTPDI+LYN ADER        V VN  G   ++PP I KSTC ID+  FPFD Q C LKFGSWT+ G  LD+Q+      +DI  Y  + EW ++  P +R  L         PD+TF + ++R + Y+   L++PCVL+S L L++F LP +S  K+ LG+ + ++ ++ + L+AE  P+ S SVP +  Y+   M+++ LS  ++++V+  +    +   +P W+R
Sbjct:    3 CIVYFLSIFLSYI-----GSLQGEYQRKLYKELMENYNR---LERPVLNDSAPIVVELGLTLLQIIDVDEKNQVLITNAWLQLGWTDVYLSWNPDNYPGVQTLRFPSNQIWTPDILLYNSADERFDATFHTNVLVNASGACQYIPPGILKSTCYIDVRWFPFDIQKCDLKFGSWTHNGWLLDLQM----QAVDISTYIPNGEWDLVGVPGKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGLSVVVTVLVLQFHHHDPQGGKMPRWVR 329          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: si:ch73-380n15.2 (si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-161])

HSP 1 Score: 211.846 bits (538), Expect = 2.207e-60
Identity = 131/342 (38.30%), Postives = 201/342 (58.77%), Query Frame = 1
Query:  124 LIGVIVWIFVIFPSYITLADYASMSGE--KKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            L   IV+   IF SYI      S+ GE  +KL  +++++Y +   + RPV N    +VV+ GL L+QI+ +DEKNQ+L  N W +  W D  L WNP N+  V+ +R P ++IWTPDI+LYN ADER        V VN  G   ++PP I KSTC ID+  FPFD Q C LKFGSWT+ G  LD+Q+      +DI  Y  + EW ++  P +R  L         PD+TF + ++R + Y+   L++PCVL+S L L++F LP +S  K+ LG+ + ++ ++ + L+AE  P+ S SVP +  Y+   M+++ LS  ++++V+  +    +   +P W+R
Sbjct:    7 LPNCIVYFLSIFLSYI-----GSLQGEYQRKLYKELMENYNR---LERPVLNDSAPIVVELGLTLLQIIDVDEKNQVLITNAWLQLGWTDVYLSWNPDNYPGVQTLRFPSNQIWTPDILLYNSADERFDATFHTNVLVNASGACQYIPPGILKSTCYIDVRWFPFDIQKCDLKFGSWTHNGWLLDLQM----QAVDISTYIPNGEWDLVGVPGKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGLSVVVTVLVLQFHHHDPQGGKMPRWVR 336          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: chrna4b (cholinergic receptor, nicotinic, alpha 4b [Source:ZFIN;Acc:ZDB-GENE-090505-3])

HSP 1 Score: 213.001 bits (541), Expect = 6.803e-60
Identity = 130/339 (38.35%), Postives = 206/339 (60.77%), Query Frame = 1
Query:  145 IFVIFPSYITLADYASMS-----GEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRK 1146
            +F +   ++ LA   SMS      E++L+  +  +Y K   + RPV N+ D V+V +GL++ Q++ +DEKNQ++T NVW K  W D  L WNP+ + NV  +R+P + IW PDIVLYN AD            V Y GRI W PPAI+KS+C ID++ FPFD Q+C +KFGSWTY  D+  I L    S++D +DY ES EW+I++      + K        PD+T+  I++R   ++   L++PC+L+S LT+++F+LP E   K+ L +++ ++ ++ L L+ E  PS S  +P +G Y    MI +TLS  +++ V+N++ R  +  ++P W+R+
Sbjct:    7 VFFLLCVHLQLAYVFSMSPAHAHAEERLLQSLFINYNK---LSRPVANISDVVLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWNDYKLRWNPEEYENVTSIRIPSEIIWRPDIVLYNNADGDFAVTHLTKAQVFYNGRIKWKPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTY--DRAKIDLISMASDVDQMDYWESGEWVIINAVGTYNIKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECAEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSSRTHSMPHWVRQ 340          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: si:ch73-380n15.2 (si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-161])

HSP 1 Score: 210.305 bits (534), Expect = 7.380e-60
Identity = 129/339 (38.05%), Postives = 200/339 (59.00%), Query Frame = 1
Query:  133 VIVWIFVIFPSYITLADYASMSGE--KKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
             IV+   IF S+I      S+ GE  +KL  +++++Y +   + RPV N    +VV+ GL L+QI+ +DEKNQ+L  N W +  W D  L WNP N+  V+ +R P ++IWTPDI+LYN ADER        V VN  G   ++PP I KSTC ID+  FPFD Q C LKFGSWT+ G  LD+Q+      +DI  Y  + EW ++  P +R  L         PD+TF + ++R + Y+   L++PCVL+S L L++F LP +S  K+ LG+ + ++ ++ + L+AE  P+ S SVP +  Y+   M+++ LS  ++++V+  +    +   +P W+R
Sbjct:    5 CIVYFLSIFLSHI-----GSLQGEYQRKLYKELMENYNR---LERPVLNDSAPIVVELGLTLLQIIDVDEKNQVLITNAWLQLGWTDVYLSWNPDNYPGVQTLRFPSNQIWTPDILLYNSADERFDATFHTNVLVNASGACQYIPPGILKSTCYIDVRWFPFDIQKCDLKFGSWTHNGWLLDLQM----QAVDISTYIPNGEWDLVGVPGKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGLSVVVTVLVLQFHHHDPQGGKMPRWVR 331          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 209.149 bits (531), Expect = 2.367e-59
Identity = 126/338 (37.28%), Postives = 203/338 (60.06%), Query Frame = 1
Query:  139 VWIFVIFPSYI--TLAD-YASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            +W+ ++   ++   L+D +     E KL  K+   Y K     RPVRN+ D V+VK+GL++ Q++ +DEKNQ++T NVW K  W D  L WNP  F NV  +R+P + IW PDIVLYN AD            + + G++ W+PPAI+KS+C ID++ FPFD Q+C +KFGSWTY   K+D++  E    +D+ DY ES EW I++        K    +   PD+T+F I++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L L+ E  PS S  +P +G Y    MI +TLS  +++ V+N++ R     ++P W+ 
Sbjct:   13 LWMLILIADHVQPVLSDGWIHAHAEDKLFHKLFIGYNKWS---RPVRNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPSEFDNVTSIRVPSEMIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVSWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQIEG--TVDLKDYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHSMPRWVH 345          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: ENSXETT00000021532.1 (cholinergic receptor, nicotinic alpha 7 [Source:NCBI gene;Acc:100493611])

HSP 1 Score: 208.764 bits (530), Expect = 3.660e-59
Identity = 128/323 (39.63%), Postives = 196/323 (60.68%), Query Frame = 1
Query:  187 ASMSGE--KKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQP--DLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
             S+ GE  +KL  +++K+Y     + RPV N    + V +G++L+QIM +DEKNQ+LT N+W +  W+D  L WN   +  V+ VR P  +IW PDI+LYN ADER        V VN  G   ++PP IFKS+C ID+  FPFD Q C LKFGSWTY G  LD+Q+ E+    DI +Y  + EW ++  P +R   +N  +   +P  D+TF +I++R + Y+   L++PCVL+S L L++F LP +S  K+ LG+ + ++ ++ + L+AE  P+ S SVP +  Y+   MI++ LS  +++IV+  +       N+P W R
Sbjct:   21 VSLQGEYQRKLYKELMKNYNP---LERPVLNDSHPLTVYFGMSLMQIMDVDEKNQVLTTNIWLQMQWIDYYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDASFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDIQKCNLKFGSWTYGGWSLDLQMLES----DISEYISNGEWDLVGVPGKRS--ENYYECCKEPYLDVTFTIIMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPHGGNMPKWTR 334          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: CHRNA2 (cholinergic receptor, nicotinic alpha 2 [Source:NCBI gene;Acc:100495873])

HSP 1 Score: 206.838 bits (525), Expect = 1.845e-58
Identity = 154/545 (28.26%), Postives = 273/545 (50.09%), Query Frame = 1
Query:  112 CHMRLIGVIVWIFVIFPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRK-GVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWV 1743
            C  R + ++ WI     + ++  +      E++L  ++   Y    +  RPV N  D V+VK+GL++ Q++ +DEKNQ++T NVW K  W D  L WNP ++ NV  +R+P + IW PDIVLYN AD            + + G++ W+PPAI+KS+C ID++ FPFD QSC +KFGSWTY    LD++  E    +D+ DY ES EW I++   +    K        PD+T++ I++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L L+ E  PS S  +P +G Y    MI +TLS  +++ V+N++ R      +P W+R   ++   + L MK+  +            E+K S +  K   E +  +            A  ++      +++++  + + Q R+ Y   N  V+       S  PR+S                                    ++ +S+ LL  ++ +  + +  +   +  +D    + ++W+ VAMV+DR+F W+
Sbjct:    4 CMGRTLSILCWIITF--TTVSCMERTRTHAEERLFKRLFTGY---NRWSRPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADGEFAITHMTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDKAWLDLESMER--NVDLKDYWESGEWAIVNAVGKYNSKKYDCCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPLWVRSVFLDHIPRWLFMKRPPAPVEEVVSQYDAPELKLSTS--KYWMETDVDDK----------WAEPEAELQTCHVRHMTTHNQSLQYRYDY---NHHVSG----GQSQTPRHS----------------------------------STETAESSFLLSPSVLKALEGVHYIANHLRAEDADFSVKEDWKYVAMVIDRIFLWM 488          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: CHRNA2 (cholinergic receptor, nicotinic alpha 2 [Source:NCBI gene;Acc:100495873])

HSP 1 Score: 204.142 bits (518), Expect = 1.207e-57
Identity = 123/344 (35.76%), Postives = 202/344 (58.72%), Query Frame = 1
Query:  112 CHMRLIGVIVWIFVIFPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            C  R + ++ WI     + ++  +      E++L  ++   Y    +  RPV N  D V+VK+GL++ Q++ +DEKNQ++T NVW K  W D  L WNP ++ NV  +R+P + IW PDIVLYN AD            + + G++ W+PPAI+KS+C ID++ FPFD QSC +KFGSWTY    LD++  E    +D+ DY ES EW I++   +    K        PD+T++ I++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L L+ E  PS S  +P +G Y    MI +TLS  +++ V+N++ R      +P W+R
Sbjct:    4 CMGRTLSILCWIITF--TTVSCMERTRTHAEERLFKRLFTGY---NRWSRPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADGEFAITHMTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDKAWLDLESMER--NVDLKDYWESGEWAIVNAVGKYNSKKYDCCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPLWVR 340          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 198.749 bits (504), Expect = 8.134e-56
Identity = 125/369 (33.88%), Postives = 215/369 (58.27%), Query Frame = 1
Query:  175 LADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRK-GVNATSKILGM----KQVISSASSEKLHLIKSEIKNSRNHIKRQ 1266
            L  +   + E +L   +LK Y       RPV NV D V++ + +++ Q++ +DE NQI+  N+W ++ W D  L WNP ++  +E +R+P  +IW PDIVLYN A             V Y G + W+PPAIFKS+C ID++ FPFD+Q+C LKFGSWTY  DK  I L    S+I++ ++ ES EW+I++ P  +  +K         D+T+ L ++R   ++   +++PC+L+S LT+++F+LP +   K+ L M++ ++ ++ L ++ E  PS S  +P +G Y    MI +TLS  +++ V+N+++R  K   +P W+++  ++   K++ M    KQ  +      L +  SEI++ ++ +  Q
Sbjct:   11 LLGFFCSNVEHRLYEDLLKSYNPYI---RPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTY--DKAKINLVMIGSKINLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDISSSEIRSCQDQLFYQ 374          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 198.749 bits (504), Expect = 9.162e-56
Identity = 125/369 (33.88%), Postives = 215/369 (58.27%), Query Frame = 1
Query:  175 LADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRK-GVNATSKILGM----KQVISSASSEKLHLIKSEIKNSRNHIKRQ 1266
            L  +   + E +L   +LK Y       RPV NV D V++ + +++ Q++ +DE NQI+  N+W ++ W D  L WNP ++  +E +R+P  +IW PDIVLYN A             V Y G + W+PPAIFKS+C ID++ FPFD+Q+C LKFGSWTY  DK  I L    S+I++ ++ ES EW+I++ P  +  +K         D+T+ L ++R   ++   +++PC+L+S LT+++F+LP +   K+ L M++ ++ ++ L ++ E  PS S  +P +G Y    MI +TLS  +++ V+N+++R  K   +P W+++  ++   K++ M    KQ  +      L +  SEI++ ++ +  Q
Sbjct:   16 LLGFFCSNVEHRLYEDLLKSYNPYI---RPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTY--DKAKINLVMIGSKINLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHLLPKVMFMTRPEKQPYALKPQAYLDISSSEIRSCQDQLFYQ 379          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna9 (cholinergic receptor, nicotinic, alpha polypeptide 9 [Source:MGI Symbol;Acc:MGI:1202403])

HSP 1 Score: 206.838 bits (525), Expect = 6.418e-59
Identity = 168/533 (31.52%), Postives = 253/533 (47.47%), Query Frame = 1
Query:  163 SYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKGV-NATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIV 1758
            S I   + A+    +KL + + +DY       RPV +    + V   + L QI  +DE+NQILT  +W + TW D  L W+   +  ++ +R+P D +W PDIVLYN AD+   E  +  V + Y G I W  PAI KS+C +D++ FPFD Q C L FGSWTY G+++DI  +      D+ D+ E  EW +   PA + V+     +   PD+TF L+LKR S+++   L++PCVL+S L  + F+LP  S  K+ LG+ I +A ++   ++AE  P AS +VP +G YY   M LIT ST L+I+V+N++F   + R +P W +  +    S+IL +  V  S  S +                 Q+ ++ T+    +P      +R+K      E++ L  +   YQ       QNTD                     SY  RY                                 L KN+  I K LK       +    N    EW+ VA V+DR F W++F +V
Sbjct:   18 SGIKAVETANGKYAQKLFSDLFEDYSNAL---RPVEDTDAVLNVTLQVTLSQIKDMDERNQILTAYLWIRQTWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDSPAITKSSCVVDVTYFPFDSQQCNLTFGSWTYNGNQVDI--FNALDSGDLSDFIEDVEWEVQGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMP-ASENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWAKVVILKYMSRILFVYDVGESCLSPR---------------HSQEPEQITKVYGKLPGSNLKASRNKDLSRKKELRKLLKNDLGYQGGIP---QNTD---------------------SYCARYEA-------------------------------LTKNIEYIAKCLK-------DHKATNSKGSEWKKVAKVIDRFFMWIFFAMV 467          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 201.445 bits (511), Expect = 5.216e-57
Identity = 132/404 (32.67%), Postives = 228/404 (56.44%), Query Frame = 1
Query:  187 ASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLK-NMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGMKQVISSA--SSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSN 1386
            ++   E +L   + +DY    +I RPV NV   V++++ +++ Q++ +DE NQI+  N+W K  W D  L W P ++  VE +R+P +KIW PDIVLYN AD            + Y G + W+PPAIFKS+C ID++ FPFD+Q+C +KFGSW+Y   K+D+ L    S +++ DY ES EW I+  P  +  +K N  +   Q D+T+ L ++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L ++ ET PS S  +P +G Y    MI +TLS  +++ V+N+++R      +P W++   +N   +++ M +  S+   + +  +   +E+ N  N   R   K   E              H+  K++    NL+ SSS+
Sbjct:   24 SASEAEHRLFQYLFEDY---NEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIG--SSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQ-DITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTEEDAPKTRNFYGAELSN-LNCFSRADSKSCKEGYPC-QDGTCGYCHHRRVKISNFSANLTRSSSS 419          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 201.445 bits (511), Expect = 9.803e-57
Identity = 132/404 (32.67%), Postives = 228/404 (56.44%), Query Frame = 1
Query:  187 ASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLK-NMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGMKQVISSA--SSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSN 1386
            ++   E +L   + +DY    +I RPV NV   V++++ +++ Q++ +DE NQI+  N+W K  W D  L W P ++  VE +R+P +KIW PDIVLYN AD            + Y G + W+PPAIFKS+C ID++ FPFD+Q+C +KFGSW+Y   K+D+ L    S +++ DY ES EW I+  P  +  +K N  +   Q D+T+ L ++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L ++ ET PS S  +P +G Y    MI +TLS  +++ V+N+++R      +P W++   +N   +++ M +  S+   + +  +   +E+ N  N   R   K   E              H+  K++    NL+ SSS+
Sbjct:   29 SASEAEHRLFQYLFEDY---NEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIG--SSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQ-DITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTEEDAPKTRNFYGAELSN-LNCFSRADSKSCKEGYPC-QDGTCGYCHHRRVKISNFSANLTRSSSS 424          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 201.445 bits (511), Expect = 9.952e-57
Identity = 132/404 (32.67%), Postives = 228/404 (56.44%), Query Frame = 1
Query:  187 ASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLK-NMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGMKQVISSA--SSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSN 1386
            ++   E +L   + +DY    +I RPV NV   V++++ +++ Q++ +DE NQI+  N+W K  W D  L W P ++  VE +R+P +KIW PDIVLYN AD            + Y G + W+PPAIFKS+C ID++ FPFD+Q+C +KFGSW+Y   K+D+ L    S +++ DY ES EW I+  P  +  +K N  +   Q D+T+ L ++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L ++ ET PS S  +P +G Y    MI +TLS  +++ V+N+++R      +P W++   +N   +++ M +  S+   + +  +   +E+ N  N   R   K   E              H+  K++    NL+ SSS+
Sbjct:   24 SASEAEHRLFQYLFEDY---NEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIG--SSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQ-DITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTEEDAPKTRNFYGAELSN-LNCFSRADSKSCKEGYPC-QDGTCGYCHHRRVKISNFSANLTRSSSS 419          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 201.83 bits (512), Expect = 1.059e-56
Identity = 123/340 (36.18%), Postives = 201/340 (59.12%), Query Frame = 1
Query:  127 IGVIVWIFVIFPSYITLADYASMS-GEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            I + +W  ++ P+   LA   S +  E +L   +   Y +     RPV N  D V+V++GL++ Q++ +DEKNQ++T NVW K  W D  L W+P  F N+  +R+P + IW PDIVLYN AD            + + G + W+PPAI+KS+C ID++ FPFD Q+C +KFGSWTY   K+D++  E    +D+ DY ES EW I++        K        PD+T++ +++R   ++   L++PC+L+S LT+++F+LP E   K+ L +++ ++ ++ L L+ E  PS S  +P +G Y    MI +TLS  +++ V+N++ R     N+P+W+R
Sbjct:   12 IHLYLWCLLLMPA--VLAQQGSHTHAEDRLFKHLFGGYNRWA---RPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMER--TVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVR 344          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|P09482|ACHA4_CHICK (Neuronal acetylcholine receptor subunit alpha-4 OS=Gallus gallus OX=9031 GN=CHRNA4 PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.035e-59
Identity = 133/345 (38.55%), Postives = 210/345 (60.87%), Query Frame = 1
Query:  154 IFPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGMKQ 1185
            IFP++  +   A    E++L+ K+   Y    K  RPV N+ D V+V++GL++ Q++ +DEKNQ++T NVW K  W D  L W+P+ + NV  +R+P + IW PDIVLYN AD            + Y GRI WMPPAI+KS+C ID++ FPFD Q+C +KFGSWTY  DK  I L    S +D +DY ES EW+I++        K        PD+T+  I++R   ++   L++PC+L+S LT+++F+LP E   K+ L +++ ++ ++ L L+ E  PS S  +P +G Y    MI +TLS  +++ V+N++ R  +   +PDW+R+  ++   ++L MK+
Sbjct:   18 IFPAFGHVETRAH--AEERLLKKLFSGY---NKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPQEYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRIKWMPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTY--DKAKIDLVSMHSHVDQLDYWESGEWVIINAVGNYNSKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPRTHTMPDWVRRVFLDIVPRLLFMKR 355          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|Q07263|ACHA3_BOVIN (Neuronal acetylcholine receptor subunit alpha-3 OS=Bos taurus OX=9913 GN=CHRNA3 PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 6.362e-58
Identity = 132/404 (32.67%), Postives = 236/404 (58.42%), Query Frame = 1
Query:  187 ASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYA--DERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRK-GVNATSKILGMKQVISS-ASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSN 1386
            ++   E +L  ++ +DY    +I RPV NV D V++++ +++ Q++ +DE NQI+  N+W K  W D  L WNP ++   E +R+P +KIW PDIVLYN A  D ++ +K   +  + Y G + W+PPAIFKS+C ID++ FPFD+Q+C +KFGSW+Y   K+D+ L    S +++ DY ES EW I+  P  +  +K        PD+T+ L ++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L ++ ET PS S  +P +G Y    MI +TLS  +++ V+N+++R      +P W++   +N   +++ M +  S+  ++++     S   ++ N   R + K   E        +     H+ +K++    NL+ SSS+
Sbjct:   20 STSDAEHRLFERLFEDY---NEIIRPVANVSDPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYDGAEFMRVPAEKIWKPDIVLYNNAVGDFQVDDKTKAL--LKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIG--SSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPAWVKTIFLNLLPRVMFMTRPASNEGNTQRPRPFYSAELSNLNCFSRIESKVCKEGYPC-QDGLCGYCHHRRAKISNFSANLTRSSSS 415          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|P43144|ACHA9_RAT (Neuronal acetylcholine receptor subunit alpha-9 OS=Rattus norvegicus OX=10116 GN=Chrna9 PE=1 SV=2)

HSP 1 Score: 206.068 bits (523), Expect = 8.455e-58
Identity = 165/519 (31.79%), Postives = 248/519 (47.78%), Query Frame = 1
Query:  205 KKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKGV-NATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIV 1758
            +KL + + +DY       RPV +    + V   + L QI  +DE+NQILT  +W + TW D  L W+   +  ++ +R+P D +W PDIVLYN AD+   E  +  V + Y G I W  PAI KS+C +D++ FPFD Q C L FGSWTY G+++DI  +      D+ D+ E  EW +   PA + V+     +   PD+TF L+LKR S+++   L++PCVL+S L  + F+LP  S  K+ LG+ I +A ++   ++AE  P AS +VP +G YY   M LIT ST L+I+V+N++F   + R +P W +  +    S+IL +  V  S  S +                 Q+ ++ T+    +P      +R+K      E++ L  +   YQ       QNTD                     SY  RY                                 L KN+  I K LK       +    N    EW+ VA V+DR F W++F +V
Sbjct:   32 QKLFSDLFEDYSSAL---RPVEDTDAVLNVTLQVTLSQIKDMDERNQILTAYLWIRQTWHDAYLTWDRDQYDRLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDSPAITKSSCVVDVTYFPFDSQQCNLTFGSWTYNGNQVDI--FNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMP-ASENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWAKVVILKYMSRILFVYDVGESCLSPR---------------HSQEPEQVTKVYSKLPESNLKTSRNKDLSRKKEVRKLLKNDLGYQGGIP---QNTD---------------------SYCARYEA-------------------------------LTKNIEYIAKCLK-------DHKATNSKGSEWKKVAKVIDRFFMWIFFAMV 467          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|P32297|ACHA3_HUMAN (Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4)

HSP 1 Score: 206.453 bits (524), Expect = 1.131e-57
Identity = 134/401 (33.42%), Postives = 231/401 (57.61%), Query Frame = 1
Query:  199 GEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYA--DERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGMKQVISSASSEK--LHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSN 1386
             E +L  ++ +DY +   I RPV NV D V++ + +++ Q++ +DE NQI+  N+W K  W D  L WNP ++   E +R+P  KIW PDIVLYN A  D ++ +K   +  + Y G + W+PPAIFKS+C ID++ FPFD+Q+C +KFGSW+Y   K+D+ L    S +++ DY ES EW I+  P  +  +K        PD+T+ L ++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L ++ ET PS S  +P +G Y    MI +TLS  +++ V+N+++R      +P W++   +N   +++ M +  S+  + +    L  +E+ N  N   R + K   E        +     H+  K++    NL+ SSS+
Sbjct:   34 AEHRLFERLFEDYNE---IIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKAL--LKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIG--SSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSN-LNCFSRAESKGCKEGYPC-QDGMCGYCHHRRIKISNFSANLTRSSSS 425          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Match: sp|P09480|ACHA2_CHICK (Neuronal acetylcholine receptor subunit alpha-2 OS=Gallus gallus OX=9031 GN=CHRNA2 PE=2 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 5.745e-57
Identity = 125/340 (36.76%), Postives = 200/340 (58.82%), Query Frame = 1
Query:  124 LIGVIVWIFVIFPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            +I ++VW FV   +            E +L   +   Y +     RPV N  D V+VK+GL++ Q++ +DEKNQ++T NVW K  W D  L WNP++F NV  +R+P + IW PDIVLYN AD            +   G++ W+PPAI+KS+C ID++ FPFD Q+C +KFGSWTY   K+D++  E+   +D+ DY ES EW I++   R    K        PD+TF+ +++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L L+ E  PS S  +P +G Y    MI +TLS  +++ V+N++ R      +P W+R
Sbjct:    8 IIPLLVWCFVTLQAATREQKQPHGFAEDRLFKHLFTGYNRWS---RPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPEDFDNVTSIRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSNGKVKWVPPAIYKSSCSIDVTYFPFDQQNCKMKFGSWTYDKAKIDLENMEH--HVDLKDYWESGEWAIINAIGRYNSKKYDCCTEIYPDITFYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPSTHTMPHWVR 342          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A5K4F4B2 (Putative nachr subunit OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 1.047e-141
Identity = 275/611 (45.01%), Postives = 394/611 (64.48%), Query Frame = 1
Query:  136 IVWIFVIFPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKGVNATSKILGMKQV---ISSASSEKLHLIKSEIKNS--RNHIKRQQEKETTESRETIPTPISPRAR------------------------HKSSKMAMEMQNLS----GSSSNYQTRF--------QYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVXXXXXXXXXXXXXXKSMDQILEEYARKYE 1845
            ++WI++I    + + ++   S EK+LI +++ +Y+K GKIGRPV+N +D VVV YGL+L Q++ LDEKNQILT+NVWAKYTW+D++L W+P N+SN+ EVR+PP  IWTPDIVL+NYADERL EKRDVM++V+Y+GR+ W PPAIFKS C IDI NFPFD+Q C+LKF SWTY  ++LD+Q  +N +E+DI  YT SNEW ++ +PA RFV+ + +     PDLTFFL LKRN A++ YLLV PCVLLS++T VIFWLPP+ PAKMIL MNIFVAFSLLL++LA +TPSAST VP+LGY+YCLNM L++LSTF S IV++L+F+  K +++P WL K V   + +L + ++   + + +++KL  ++++IKN+  +  +K +   +T  S + +P P +P++                         + +    ++ Q LS    GS  +Y T           YP QN       Y  H  IP   +    S E         +  A        K +  +++S  S I LE NL ++  ALK LM KIA+KD   +  +EWR+V M +DRLF W Y  +VI++G+ LL PRG   ++++I+  +   Y+
Sbjct:    4 LLWIWLI--CLVFIPEHVIPSSEKRLIKQLIDNYEKAGKIGRPVKNTKDRVVVGYGLSLFQLLDLDEKNQILTINVWAKYTWIDQLLRWDPANYSNIREVRIPPSVIWTPDIVLHNYADERLKEKRDVMLNVDYMGRVFWSPPAIFKSNCPIDIKNFPFDYQHCFLKFASWTYNSEQLDLQFLDNRTEVDIDQYTSSNEWSLVARPAYRFVMLSDECGKEIPDLTFFLFLKRNPAFYGYLLVFPCVLLSVITTVIFWLPPQIPAKMILSMNIFVAFSLLLKILAVSTPSASTIVPYLGYFYCLNMTLLSLSTFASTIVVHLHFQRVKSKHVPPWLIKVVRFFATLLHVSKLEPPVVADANQKLSAVEAQIKNAKMKQSVKSENLLDTWSSNQQLP-PSNPQSNLIHSVGVETQWDYNKISSPEEYLLNPNELSVLQKQQLSMLSDGSRISYCTSVNGCQFSSHHYPNQN-------YLQHKSIPWGDYAMNQSNE---------SGTAKIHDKMLKKFKQSKQQSRGSTIKLEFNLGDLCNALKQLMLKIAKKDEIAQRDREWRLVLMTIDRLFCWFYSTVVIVAGVYLLFPRGRSHTVNEIIAMHQEAYD 595          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A5K4F410 (Putative nachr subunit OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 434.876 bits (1117), Expect = 6.681e-141
Identity = 272/591 (46.02%), Postives = 383/591 (64.81%), Query Frame = 1
Query:  196 SGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKGVNATSKILGMKQV---ISSASSEKLHLIKSEIKNS--RNHIKRQQEKETTESRETIPTPISPRAR------------------------HKSSKMAMEMQNLS----GSSSNYQTRF--------QYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVXXXXXXXXXXXXXXKSMDQILEEYARKYE 1845
            S EK+LI +++ +Y+K GKIGRPV+N +D VVV YGL+L Q++ LDEKNQILT+NVWAKYTW+D++L W+P N+SN+ EVR+PP  IWTPDIVL+NYADERL EKRDVM++V+Y+GR+ W PPAIFKS C IDI NFPFD+Q C+LKF SWTY  ++LD+Q  +N +E+DI  YT SNEW ++ +PA RFV+ + +     PDLTFFL LKRN A++ YLLV PCVLLS++T VIFWLPP+ PAKMIL MNIFVAFSLLL++LA +TPSAST VP+LGY+YCLNM L++LSTF S IV++L+F+  K +++P WL K V   + +L + ++   + + +++KL  ++++IKN+  +  +K +   +T  S + +P P +P++                         + +    ++ Q LS    GS  +Y T           YP QN       Y  H  IP   +    S E         +  A        K +  +++S  S I LE NL ++  ALK LM KIA+KD   +  +EWR+V M +DRLF W Y  +VI++G+ LL PRG   ++++I+  +   Y+
Sbjct:   35 SSEKRLIKQLIDNYEKAGKIGRPVKNTKDRVVVGYGLSLFQLLDLDEKNQILTINVWAKYTWIDQLLRWDPANYSNIREVRIPPSVIWTPDIVLHNYADERLKEKRDVMLNVDYMGRVFWSPPAIFKSNCPIDIKNFPFDYQHCFLKFASWTYNSEQLDLQFLDNRTEVDIDQYTSSNEWSLVARPAYRFVMLSDECGKEIPDLTFFLFLKRNPAFYGYLLVFPCVLLSVITTVIFWLPPQIPAKMILSMNIFVAFSLLLKILAVSTPSASTIVPYLGYFYCLNMTLLSLSTFASTIVVHLHFQRVKSKHVPPWLIKVVRFFATLLHVSKLEPPVVADANQKLSAVEAQIKNAKMKQSVKSENLLDTWSSNQQLP-PSNPQSNLIHSVGVETQWDYNKISSPEEYLLNPNELSVLQKQQLSMLSDGSRISYCTSVNGCQFSSHHYPNQN-------YLQHKSIPWGDYAMNQSNE---------SGTAKIHDKMLKKFKQSKQQSRGSTIKLEFNLGDLCNALKQLMLKIAKKDEIAQRDREWRLVLMTIDRLFCWFYSTVVIVAGVYLLFPRGRSHTVNEIIAMHQEAYD 608          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A095AWG0 (Neuronal acetylcholine receptor subunit alpha-4 OS=Schistosoma haematobium OX=6185 GN=MS3_07391 PE=3 SV=1)

HSP 1 Score: 434.491 bits (1116), Expect = 7.685e-141
Identity = 274/614 (44.63%), Postives = 392/614 (63.84%), Query Frame = 1
Query:  136 IVWIFVIFPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKGVNATSKILGMKQV---ISSASSEKLHLIKSEIKNS--RNHIKRQQEKETTESRETIPTPISPRARHKSSK------------------------MAMEMQNLS----GSSSNYQT--------RFQYPRQNTDVTDIPYTAHSDIPRNSF---NPGYSYEYRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVXXXXXXXXXXXXXXKSMDQILEEYARKYE 1845
            ++WI+++    + + ++   S EK+LI +++ +Y+K GKIGRPV+N +D VVV YGL+L Q++ LDEKNQILT+NVWAKYTW+D++L W+P N+SN+ EVR+PP  IWTPDIVLYNYADERL EKRDVM++V+Y+GR+ W PPAIFKS C IDI NFPFD+Q C+LKF SWTY  ++LD+Q  +N +E+DI  YT SNEW ++ +PA RFV+ + +     PDLTFFL LKRN A++ YLLV PCVLLS++T VIFWLPP+ PAKMIL MNIFVAFSLLL++LA +TPSAST VP+LGY+YCLNM L++LSTF S IV++L+F+  K +++P WL K V   + +L + ++   + + +++KL +++++IKN+  +  IK +   +T  S + +P P +P++    S                           ++ Q LS    GS  +Y T           YP QN       Y     IP   +    P  S   +                   K    +++S +S I L  NL ++  ALK LM KIA+KD   +  +EWR+V M +DRLF W Y ++VI++G+ LL PRG   ++++I+  +   Y+
Sbjct:    4 LIWIWLV--CLVFIPEHVIPSSEKRLIKQLIDNYEKAGKIGRPVKNTKDRVVVGYGLSLFQLLDLDEKNQILTINVWAKYTWIDQLLRWDPANYSNIREVRIPPSVIWTPDIVLYNYADERLKEKRDVMLNVDYMGRVFWSPPAIFKSNCPIDIKNFPFDYQHCFLKFASWTYNSEQLDLQFLDNRTEVDIDQYTSSNEWSLVARPAYRFVMLSDECGKEIPDLTFFLFLKRNPAFYGYLLVFPCVLLSVITTVIFWLPPQIPAKMILSMNIFVAFSLLLKILAVSTPSASTIVPYLGYFYCLNMTLLSLSTFASTIVVHLHFQRVKSKHVPPWLIKVVRFFATLLHVSKLEPPVVADTNQKLSVVEAQIKNAKMKQSIKSENLLDTWSSNQQLP-PSNPQSNLIHSAGVETQWDYNKISSTEEYLLNPNELSVLQKQQLSMLSDGSQISYSTGVNGCQFPSHHYPNQN-------YLQQKSIPWGDYATNQPNKSGSVK------------IHDKLLKKFLQSKQQSRRSTIQLGFNLGDLCNALKQLMLKIAKKDEIAQRDREWRLVLMTIDRLFCWFYSIVVIVAGVYLLFPRGRSHTVNEIIAMHQEAYD 595          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A1I8G3D5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 2.690e-134
Identity = 232/374 (62.03%), Postives = 292/374 (78.07%), Query Frame = 1
Query:  175 LADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRE 1296
            +A+  ++S EK LI K+L DYK  G  GRPV+N  D V V++GL LIQI+ LDEKNQ+LT+ VW++++W D++L WN   ++ V EVR+P   +WTPDIVLYNYADERL E+R+VM+  N+ GR+IW+PPAI+KSTC +DI+NFPFD QSC+LKFGSWTY G KLDIQ Y+N S I   DY +SNEW I+  PA R V      N   PDLTFFL LKRN  + AYLLV+PCVLLS LTLVIFWLPPESPAKM+LGMNIFVAF LLL LLAE+TPSASTSVP++G+YYCLNM+LITLSTFLS+IVINLYFR DKR  LP WL+K +   +K+L M+QVI+ + +EKL LI+SEIK++R+H K++++    +  E
Sbjct:    8 IAESIALSDEKTLIKKILLDYKTAGVDGRPVQNTTDVVTVQFGLGLIQILDLDEKNQVLTIKVWSRFSWTDQLLQWNATQYNGVSEVRIPTRDVWTPDIVLYNYADERLKEQREVMIVTNHTGRVIWIPPAIYKSTCQVDITNFPFDQQSCHLKFGSWTYDGFKLDIQFYQNKSNISTDDYIQSNEWHIVALPATRNVKFYPCCNEPYPDLTFFLFLKRNPEFFAYLLVLPCVLLSSLTLVIFWLPPESPAKMLLGMNIFVAFFLLLLLLAESTPSASTSVPYIGFYYCLNMLLITLSTFLSVIVINLYFRGDKRNRLPGWLKKCIEFLAKMLCMRQVITKSETEKLRLIRSEIKHNRHHNKKKKQGRRAQVVE 381          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Match: A0A267GKY0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005119g9 PE=3 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 1.918e-131
Identity = 231/369 (62.60%), Postives = 289/369 (78.32%), Query Frame = 1
Query:  190 SMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRE 1296
            ++S EK LI K+L DYK  G  GRPV+N  D V V++GL LIQI+ LDEKNQ+LT+ VW++++W D++L WN   ++ V EVR+P   +WTPDIVLYNYADERL E+R+VM+  N+ GR+IW+PPAI+KSTC +DI+NFPFD QSC+LKFGSWTY G KLDIQ Y+N S I   DY +SNEW I+  PA R V      N   PDLTFFL LKRN  + AYLLV+PCVLLS LTLVIFWLPPESPAKM+LGMNIFVAF LLL LLAE+TPSASTSVP++G+YYCLNM+LITLSTFLS+IVINLYFR DKR  LP WL+K +   +K+L M+QVI+ + +EKL LI+SEIK++R+H K++++    +  E
Sbjct:   81 ALSDEKTLIKKILLDYKTAGVDGRPVQNTTDVVTVQFGLGLIQILDLDEKNQVLTIKVWSRFSWTDQLLQWNATQYNGVSEVRIPTRDVWTPDIVLYNYADERLKEQREVMIVTNHTGRVIWIPPAIYKSTCQVDITNFPFDQQSCHLKFGSWTYDGFKLDIQFYQNKSNISTDDYIQSNEWHIVALPATRNVKFYPCCNEPYPDLTFFLFLKRNPEFFAYLLVLPCVLLSSLTLVIFWLPPESPAKMLLGMNIFVAFFLLLLLLAESTPSASTSVPYIGFYYCLNMLLITLSTFLSVIVINLYFRGDKRNRLPGWLKKCIEFLAKMLCMRQVITKSETEKLRLIRSEIKHNRHHNKKKKQGRRAQVVE 449          

HSP 2 Score: 75.485 bits (184), Expect = 2.133e-10
Identity = 38/80 (47.50%), Postives = 59/80 (73.75%), Query Frame = 1
Query: 1606 LEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVXXXXXXXXXXXXXXKS-MDQILEEYARKY 1842
            +E +L EIR++++NLM ++A+KD   ++A+EWRMVA+VLDR+FFW Y VI+I +G  LL+P     S +++ +EEY   Y
Sbjct:  564 MESDLREIRRSIRNLMMRLAQKDATQKVAREWRMVALVLDRIFFWCYLVIIITAGFTLLMPTSPAASRIEETIEEYKADY 643          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 211.846 bits (538), Expect = 1.953e-60
Identity = 131/361 (36.29%), Postives = 210/361 (58.17%), Query Frame = 1
Query:  175 LADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRK-GVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNH 1254
            L D+     E +L  K+   Y K     RPVRN+ D V+VK+GL++ Q++ +DEKNQ++T NVW K  W D  L W P ++ NV  +R+P + IW PDIVLYN AD            + + G+++W+PPAI+KS+C ID++ FPFD Q+C +KFGSWTY   K+D++  EN   +D+ DY ES EW I++        K    +   PD+T+F I++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L L+ E  PS S  +P +G Y    MI +TLS  +++ V+N++ R      +P W++   +    + L MK+     +  +L L   E K   N 
Sbjct:   14 LCDWTHAHAEDQLFKKLFSGYNKWS---RPVRNITDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVLWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERIEN--TVDLKDYWESGEWAIVNAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPGWVQSIFLGFIPRWLFMKRPAPDQTRRRLLLNAQEKKQVPNQ 369          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: si:ch73-380n15.2 (si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-161])

HSP 1 Score: 211.46 bits (537), Expect = 3.849e-60
Identity = 128/331 (38.67%), Postives = 197/331 (59.52%), Query Frame = 1
Query:  157 FPSYITLADYASMSGE--KKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            FPS + +    S+ GE  ++L  ++L +Y +   + RPV N    +VV+ GL L+QI+ +DEKNQ+L  N W +  W D  L WNP N+  V+ +R P ++IWTPDI+LYN ADER        V VN  G   ++PP I KSTC ID+  FPFD Q C LKFGSWTY G  LD+Q+     E+DI  Y  + EW ++  P +R  L         PD+TF + ++R + Y+   L++PCVL+S L L++F LP +S  K+ LG+ + ++ ++ + L+AE  P+ S SVP +  Y+   M+++ LS  ++++V+  +    +   +P W+R
Sbjct:   28 FPSAVLMN---SLQGEHQRRLYKELLTNYNR---LERPVANDSAPLVVELGLTLLQIIDVDEKNQVLITNAWLQLGWTDVYLTWNPDNYPGVQNLRFPSNQIWTPDILLYNSADERFDATFHTNVLVNASGTCQYIPPGILKSTCYIDVRWFPFDVQKCDLKFGSWTYNGWLLDLQM----QEVDISTYIPNGEWDLVGVPGKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGLSVVVTVLVLQFHHHDPQGGKMPKWVR 348          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: chrna3 (neuronal acetylcholine receptor subunit alpha-3-like [Source:NCBI gene;Acc:103025148])

HSP 1 Score: 210.69 bits (535), Expect = 8.061e-60
Identity = 160/537 (29.80%), Postives = 273/537 (50.84%), Query Frame = 1
Query:  157 FPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYA--DERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILLEKNLS-EIRKALKNLMTKIAEKDRGNRIAKE----WRMVAMVLDRLFFWVY 1746
            F  ++    +AS   E +L + +   Y +     RPV NV D V+V++ +++ Q++ +DE NQI+  N+W ++ W D  L W+PK+F  VE +R+P ++IW PDIVLYN A  D ++ +K   ++  N  G + W+PPAIFKS+C ID++ FPFD+Q+C +KFGSWTY   K+D+ L    S I++ D+ ES EW+I+  P  +  +K         D+T+ L ++R   ++   +++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L ++ ET PS S  +P +G Y    MI +TLS  +++ V+N+++R  K   +P W+R+        LG+   +   +       + ++  S           +     T P  + PR     S     +     S S +  R    R N  +   P     D    +  P                    + +          +S    +L    LS E+R+A+++ +  IAE  R    AKE    W+ VAMV+DR+F WV+
Sbjct:    8 FLFFLLPGGWAS-EAEHRLFSVIFSSYNQYI---RPVENVSDPVIVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLRWDPKDFGGVEFIRVPSNRIWKPDIVLYNNAVGDFQVDDKTKALLRYN--GDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLIG--STINLKDFWESGEWMIIDAPGYKHDIKYNCCEEIYTDITYSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPCWVRR------VFLGLLPRVMFMTRPDRDPERPQVSGSSARSCTLHNSSSFPQHLTKPQSLPPRTHLLLSTELSTLSEAVKSGSGFLCR--EGRCNCCLRQQPGKIPLDSGVGALGPAGG--------SLGPVSGGLVGNGGGSSPCSSSESLDGGLLAFSALSPEVREAIES-VKYIAENMRLQNEAKEVQDDWKYVAMVIDRIFLWVF 519          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: chrna3 (neuronal acetylcholine receptor subunit alpha-3-like [Source:NCBI gene;Acc:103025148])

HSP 1 Score: 203.756 bits (517), Expect = 4.744e-58
Identity = 122/340 (35.88%), Postives = 212/340 (62.35%), Query Frame = 1
Query:  133 VIVWIFVIFPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYA--DERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRK 1146
            ++ +IF+ F +      +AS   E +L + +   Y +     RPV NV D V+V++ +++ Q++ +DE NQI+  N+W ++ W D  L W+PK+F  VE +R+P ++IW PDIVLYN A  D ++ +K   ++  N  G + W+PPAIFKS+C ID++ FPFD+Q+C +KFGSWTY   K+D+ L    S I++ D+ ES EW+I+  P  +  +K         D+T+ L ++R   ++   +++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L ++ ET PS S  +P +G Y    MI +TLS  +++ V+N+++R  K   +P W+R+
Sbjct:    7 ILHYIFICFSA----GGWAS-EAEHRLFSVIFSSYNQYI---RPVENVSDPVIVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLRWDPKDFGGVEFIRVPSNRIWKPDIVLYNNAVGDFQVDDKTKALLRYN--GDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLIG--STINLKDFWESGEWMIIDAPGYKHDIKYNCCEEIYTDITYSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPCWVRR 334          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Match: chrna4b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:103025036])

HSP 1 Score: 206.838 bits (525), Expect = 9.391e-58
Identity = 124/337 (36.80%), Postives = 202/337 (59.94%), Query Frame = 1
Query:  136 IVWIFVIFPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRK 1146
            +V I  +   Y+     A    E++L+  +   Y K   + RPV N+ D V+V +GL++ Q++ +DEKNQ++T NVW K  W D  L WNP+ + NV  +R+P + IW PDIVLYN AD            + + GRI W PPAI+KS+C ID++ FPFD Q+C +KFGSWTY   K+D+   ++  ++D +DY ES EW+I++   +    K        PD+T+  I++R   ++   L++PC+L+S LT+++F+LP E   K+ L +++ ++ ++ L L+ E  PS S  +P +G Y    MI +TLS  +++ V+N++ R  +   +P W+R+
Sbjct:    9 LVLIICLQHGYVCTLTPARAHAEERLLQVLFSRYNK---LSRPVANISDVVLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWSDYKLRWNPEEYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAQLFHDGRIKWKPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDRAKIDLVSMDD--DVDQMDYWESGEWVIINAVGKYNTKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECAEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSSRTHRMPHWVRQ 340          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 213.001 bits (541), Expect = 9.158e-62
Identity = 117/296 (39.53%), Postives = 192/296 (64.86%), Query Frame = 1
Query:  259 RPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRK 1146
            RPV NV D V+V++ +++ Q++ LDE NQI+  N+W K+TW D    WNP  F  +E +R+P DKIW PDIVLYN AD     +      + Y G ++WMPPAIFKS+C ID++ FPFD+Q+C +KFGSWTY   K+D+ L    ++I++ D+ ES EW+I+  P  +  +K        PD+T+ + ++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L ++ ET PS S  +P +G Y    MI +TLS  ++I V+N+++R  +   +P+W+R+
Sbjct:   24 RPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLVG--TKINLKDFWESGEWVIIDVPGYKHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTMPNWVRR 317          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 197.208 bits (500), Expect = 2.202e-56
Identity = 125/330 (37.88%), Postives = 199/330 (60.30%), Query Frame = 1
Query:  202 EKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRN-LPDWLRK-GVNATSKILGMKQ 1185
            E +L+ +MLKDY+K     RPV  + DTV VK+GL + Q++ +DEKNQ++T NVW K  WVD  L WNP ++  +  +R+P   IW PDIVLY+ AD R          V + GRI W PPAI+KS+C ID++ FPFD Q+C +KFGSWTY G  +D+ +    S++D  +Y ++ EW  L+    + V   +  +   P +T+  +++R   ++   L+VPC+ LS LT+ +F+LP +   K+ L  ++ V+ ++ L ++ E  PS+S  +P +G Y    MI +TLS  +++ VIN++ R     + +  W+R+  ++   KIL M+ 
Sbjct:   35 EDRLLKRMLKDYQKWV---RPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDLIMVN--SDVDRGEYFDNGEWEFLNATGNKGV--RLDGHRFYPYITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVRQLFLHKLPKILCMRS 357          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 171.014 bits (432), Expect = 4.215e-46
Identity = 116/329 (35.26%), Postives = 183/329 (55.62%), Query Frame = 1
Query:  292 VKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGMKQVISSASSEKLHLIKS-----EIKNSRNHIK 1260
            V+Y      +   DEKNQ++T NVW K  W D  L W+P  + NV  +R+P + IW PDIVLYN AD            + + GR+ W PPAI+KS+C ID++ FPFD Q+C +KFGSWTY  DK  I L     ++D+ DY ES EW I+H        K        PD+T+  I++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L L+ E  PS S  +P +G Y    MI +TLS  +++ V+N++ R      +P W+R+  ++   + L M++        +L L ++      +   RNH K
Sbjct:    1 VRYAEFRTHLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTY--DKAKIDLVSMARDVDLKDYWESGEWAIVHAVGTYNTKKYDCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAMPRWVRRVFLDRVPRWLVMRRPPPQQRRSELLLARAARPPCALGGQRNHHK 327          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 154.066 bits (388), Expect = 1.394e-40
Identity = 121/389 (31.11%), Postives = 212/389 (54.50%), Query Frame = 1
Query:  178 ADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQ--LYENFSEID--IID---YTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRK-GVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISP 1320
            A    +  E+ L+  +    + K  + RP R     V V+ G+ L Q++SL      +T++     +W D  L W+P+N+ N+  +R+ P ++W PDI L N  D        V V V+Y G + W+PP+I++S+CG+ +  FPFD+Q+C + F S+TY   +++++  L E+  EI   IID   +  S EW I HKP+R+    N +D   Q D+TF+LI++R   ++   +VVPC+L+++  +  F+LPP++  KM L +++ +A ++ L LLA+  P  S  VP +  Y    M+++T    L++IV+NL+FR      +P W+R+  +++  K L +++      + KL ++       + H   +    T  S+  +  P SP
Sbjct:   16 AGVRGLEAEENLLKDLFVVQQYKTLV-RPARTATGRVTVRLGMTLSQLISLPACQPDMTLSRLISLSWEDPRLSWDPRNYDNLRSIRLSPKRVWLPDIALSNNNDGNFDFGLYVHVLVDYTGAVRWVPPSIYRSSCGMQVKYFPFDWQNCSMVFQSFTYDTSEINLEYALDEHRQEIRHIIIDESTFPVSGEWQIKHKPSRKNT--NPRDPLYQ-DITFYLIMERKPLFYIINIVVPCILITICAVFTFYLPPDAGEKMGLCISVLLALTVFLLLLADKVPETSLGVPVIVNYLMFTMVIVTACVILTVIVLNLHFRSPATHIMPYWVRRIFIHSLPKYLWIERPKKEELAPKLPVLTQH----QQHCHDEYFIRTPPSQALLLLPTSP 396          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 1.849e-38
Identity = 93/241 (38.59%), Postives = 142/241 (58.92%), Query Frame = 1
Query:  421 NVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
             V+ +R  P +IWTPDI+LYN ADER        V VNY G    +PP + KSTC ID+  FPFD Q C LKFGSWT+ G  +D+Q+ E     D   Y  + EW ++  P +R  L         PD+T+ L ++R + Y+   L+VPCVL+S L+L++F LP +S  K+ LG+ + ++ ++ + L+AE  P+ S SVP +G Y+   MI++  S  +++IV+  +      + +P W+R
Sbjct:    5 GVKNLRFQPHQIWTPDILLYNSADERFDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQMLEA----DTSGYIANGEWDLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVIVLQYHHHNPDGKKMPQWVR 241          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO32052 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW62])

HSP 1 Score: 191.045 bits (484), Expect = 9.125e-56
Identity = 108/268 (40.30%), Postives = 165/268 (61.57%), Query Frame = 1
Query:  256 GRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYAD---ERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNM 1050
             RPV +V+D VVVK GL L QI+ +DEKNQILT NVW +  W D +L WNP++F  V+ + + P+ +W PDI+LYN  D   E L +K D  V ++  G   W+ PAI K+ C +D+  FPFD Q C LKFGSWT+ G K+DIQL +  + +DI DY+E+ EW +   P RR V          P +TF L+++R + ++ Y +V+P  +++LL+L  F+LPP S  ++   + + ++ S+ + ++ E  P  S  VP +  ++  +M
Sbjct:    9 ARPVLHVKDPVVVKMGLMLKQIIDVDEKNQILTTNVWIRLYWKDHLLNWNPEDFGGVKSINVEPNNVWKPDILLYNPTDLRVESLYKKIDTKVILSSDGSAAWLSPAIIKTECKVDVRLFPFDVQYCDLKFGSWTHDGLKIDIQLRKT-TGVDIDDYSENREWFLKDAPGRRDVKLYNCCPEPYPTVTFTLVIRRRAMFYVYNMVLPTGMIALLSLFSFYLPPNSGERVSFVITVLLSMSVYMIMVTENMPQ-SADVPLVSKFFMASM 274          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 195.282 bits (495), Expect = 2.115e-55
Identity = 119/322 (36.96%), Postives = 190/322 (59.01%), Query Frame = 1
Query:  196 SGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERL---IEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQ-P--DLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLR 1143
            + EK+L+  + ++Y  +    RPV N  D V V++ L+LIQI++++ K+Q++TV+VW +  W + ML WN   +  +E V + P K+W PDI+LYN ADE     +EK    V  +  G   W  PA F STC I++  FPFD Q+C LKFGSWTY G++L +    +    D+  Y  + EW +L  PA+   L  +  N  + P  D+T +L ++R   Y+ + L++PC L++ LTL+ F+LPPES  K+ LG+ + +A ++ L L+AET PS S  +P LG Y+   M +  +S   + +++N + R      +P W++
Sbjct:   36 TAEKRLLADLFRNYDSEV---RPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGNRLTMTSTSD--SADLSKYVNNGEWHLLAMPAK---LNRVFYNCCKYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHRNPSTSPMPHWVK 349          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO32053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW63])

HSP 1 Score: 190.274 bits (482), Expect = 5.657e-55
Identity = 108/286 (37.76%), Postives = 172/286 (60.14%), Query Frame = 1
Query:  202 EKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADER---LIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNM 1050
            E  L+  +L++Y K     RPV NV D V +K G+ L Q++ L+E++QILT+NVW +  W D +L WNP +F  ++ + + PD++W PD++LYN  D R   L  K D  V VN+ G   W+ PAI KS C ID+  FPFD QSC L FGSWT+ G K+DI L +  S ID  +++++ EW +     RR V   +      P +T+ +IL+R + ++ + +V+P  +++LL+L  F+LPP S  ++   + + +A S+ L ++ E  P  ST +P +  ++  +M
Sbjct:    1 EPALLKYLLQNYSKDA---RPVLNVNDPVQLKLGIMLRQVIDLNERDQILTINVWIRQYWKDHLLKWNPDDFGGIKSINIAPDRVWKPDVLLYNRTDLRFGSLNNKIDTNVIVNHDGSTTWLAPAIIKSECKIDVRFFPFDVQSCELTFGSWTHDGLKIDIHLKQE-SGIDTENFSDNREWFLKGTSGRRDVKMYICCPEPYPTVTYTIILRRRAMFYVFNMVLPTGVIALLSLFSFYLPPNSGERVSFVITVLLAMSVYLIMVTENIPR-STDIPLVSKFFMASM 281          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO47969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKU6])

HSP 1 Score: 182.185 bits (461), Expect = 6.696e-52
Identity = 108/307 (35.18%), Postives = 180/307 (58.63%), Query Frame = 1
Query:  202 EKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLI---EKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQP--DLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFR 1107
            E++LI+ +L+ Y +     RPV N   T+ V +G+ ++QI++++ +NQI+  NVW +  W +E+L W+P N+  V+ VR+    +W PDIVLY+ AD       EK    V ++  G   W  PA F+STC ID++ FPFD Q+CY+KFGSWTY    +DIQ   + + +    Y +S EW ++     R     +     +P  D+T  + ++R   ++A+ L+ PC+++  + L+ F+LPPES  ++ L + + +A ++ L+L+AET P  S S+P LG +Y   M  I +S   +  V+N++ R
Sbjct:    1 EQRLISDLLQGYSRNA---RPVLNSNHTLKVFFGMEIVQIVNVENRNQIIQTNVWIRQRWDNELLTWHPSNYEGVQTVRLDAKSVWIPDIVLYDSADSVFSGGHEKYKTHVIISKDGSSAWFSPASFRSTCKIDVTYFPFDEQTCYMKFGSWTYTIADVDIQ--ASPAPVKSSKYLKSAEWDLMSATTSR--KSQIYACCPEPISDVTIAMTIRRKPLFYAFNLITPCMIMLTMILLGFFLPPESGERITLSITVLLAMAVFLQLVAETLPRNSESIPLLGRFYITIMTEIAVSLMATCWVLNIHHR 300          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Match: EDO43642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY59])

HSP 1 Score: 172.17 bits (435), Expect = 1.019e-48
Identity = 103/286 (36.01%), Postives = 167/286 (58.39%), Query Frame = 1
Query:  202 EKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYAD---ERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNM 1050
            E KL+  +  +Y       RPV     +V V+ G++L QI+ LDE+NQIL  N+W +  W + +L W+P +F N+  + + P ++W PD++LYN AD   +  +++    V + + G  +W+ P IFKSTC  D++ FPFD QSC LKFGSWTY G +L+I + EN ++I I  +  + EW +    A R V+         PD+TF L ++R + ++   +++PC L++ LTL+ + LPPES  ++ L +   +A ++ L L++E  P  +  VP +  YY   M
Sbjct:    2 ENKLLKDLFSNYNPSV---RPVLKATSSVTVQLGVSLHQIIDLDERNQILISNLWVRQKWNNPLLTWDPTHFGNLTSINVDPLRVWRPDLILYNNADRDTDGALDRFYTKVQLKFDGSSLWLAPIIFKSTCKFDVAYFPFDEQSCILKFGSWTYDGLRLNI-VPENGTDIGIDKFVSNGEWELTGVSANRNVMFYDCCVEPYPDVTFTLKIRRLTLFYYMNMLIPCFLITGLTLLSYILPPESGERITLVVTSLLAQAVYLLLVSEIMPPVAEVVPLISIYYTTAM 283          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: si:ch73-380n15.2 (neuronal acetylcholine receptor subunit alpha-7 [Source:NCBI gene;Acc:101162456])

HSP 1 Score: 213.772 bits (543), Expect = 6.016e-61
Identity = 132/356 (37.08%), Postives = 206/356 (57.87%), Query Frame = 1
Query:  127 IGVIVWIFVIFPSYITLADYASMSGE--KKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGMKQ 1185
            +G+ +W   +F          SM GE  +KL  ++L +Y +   + RPV N    ++V+ G  L+QI+ +DEKNQ+L  N W +  W D  L WNP+N+  V+ +R P D++WTPDI+LYN ADER        V VN  G   ++PP I KSTC ID+  FPFD Q C LKFGSWT+ G  LD+Q+     ++DI  Y  + EW ++  PA+R  L         PD+TF + ++R + Y+   L++PCVL+S L L++F LP +S  K+ LG+ + ++ ++ + L+AE  P+ S SVP +  Y+   M+++ +S  +++IV+  +        +P W+R   +N  +  L MKQ
Sbjct:   12 VGLYIWAAFLFK--------GSMQGEYQRKLYKELLANYNR---LERPVVNDSAAILVELGFTLLQIIDVDEKNQVLITNAWLQLHWTDIYLTWNPENYPGVQNLRFPSDQVWTPDILLYNSADERFDATFHTNVLVNASGHCQYIPPGILKSTCYIDVRWFPFDVQKCDLKFGSWTHNGWLLDLQML----DVDISTYISNGEWDLVGVPAKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGMSVVVTVIVLQFHHHDPHGGKMPKWVRVVLLNWCAWFLRMKQ 352          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: si:ch73-380n15.2 (neuronal acetylcholine receptor subunit alpha-7 [Source:NCBI gene;Acc:101162456])

HSP 1 Score: 212.231 bits (539), Expect = 2.905e-60
Identity = 129/336 (38.39%), Postives = 199/336 (59.23%), Query Frame = 1
Query:  187 ASMSGE--KKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGMKQ 1185
             SM GE  +KL  ++L +Y +   + RPV N    ++V+ G  L+QI+ +DEKNQ+L  N W +  W D  L WNP+N+  V+ +R P D++WTPDI+LYN ADER        V VN  G   ++PP I KSTC ID+  FPFD Q C LKFGSWT+ G  LD+Q+     ++DI  Y  + EW ++  PA+R  L         PD+TF + ++R + Y+   L++PCVL+S L L++F LP +S  K+ LG+ + ++ ++ + L+AE  P+ S SVP +  Y+   M+++ +S  +++IV+  +        +P W+R   +N  +  L MKQ
Sbjct:   48 GSMQGEYQRKLYKELLANYNR---LERPVVNDSAAILVELGFTLLQIIDVDEKNQVLITNAWLQLHWTDIYLTWNPENYPGVQNLRFPSDQVWTPDILLYNSADERFDATFHTNVLVNASGHCQYIPPGILKSTCYIDVRWFPFDVQKCDLKFGSWTHNGWLLDLQML----DVDISTYISNGEWDLVGVPAKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGMSVVVTVIVLQFHHHDPHGGKMPKWVRVVLLNWCAWFLRMKQ 376          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: chrna4b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101158195])

HSP 1 Score: 210.69 bits (535), Expect = 6.357e-59
Identity = 137/386 (35.49%), Postives = 226/386 (58.55%), Query Frame = 1
Query:  199 GEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGMKQVISSASSEKLHLIK--------SEIKNSRNHIKR--QQEKETTESRETIPTPISPR 1323
             E++L+  +   Y K   + RPV+N  DTV+V +GL++ Q++ +DEKNQ++T NVW K  W D  L WNP+++ NV  +R+P + IW PDIVLYN AD            + Y G+I WMPPAI+KS+C ID++ FPFD QSC +KFGSWTY  D+  I L    S++D +DY ES EW+I++   +    K         D+T++ I++R   ++   L++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L L+ E  PS S  +P +G Y    M+ +TLS  ++I V+N++ R  +   +P W+R+  ++   ++L MK+   +A      LI+        S   NS++       + ++ T+   ++P   SPR
Sbjct:   44 AEERLLQNLFARYNK---LSRPVQNTSDTVLVHFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPEDYENVTSIRIPSEIIWRPDIVLYNNADGDFAVTHLTKAHLFYDGQIKWMPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTY--DRAKIDLISMASDVDQMDYWESGEWVIVNAVGKYNTKKYECCAEIYADITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSQCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMVFVTLSIIITIFVLNVHHRSPQTHGMPHWVRRVFLDLVPRVLFMKRPPGTAKQHCKRLIEMMHCPTTISATGNSQSFWTGLDSELRQMTQVHNSLPKVDSPR 424          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: chrna3 (neuronal acetylcholine receptor subunit alpha-3 [Source:NCBI gene;Acc:101159658])

HSP 1 Score: 206.068 bits (523), Expect = 6.179e-58
Identity = 133/413 (32.20%), Postives = 237/413 (57.38%), Query Frame = 1
Query:  175 LADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYA--DERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGM-------KQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSS 1383
            L+       E KL + +  +Y +     RPV NV D V+V++ +++ Q++ +DE NQI+  N+W ++ W D  L WNPK F  VE +R+P ++IW PDIVLYN A  D ++ +K   ++  N  G + W+PPAIFKS+C ID++ FPFD+Q+C +KFGSWTY   K+D+ L    S I++ D+ ES EW I+  P  +  +K         D+T+ L ++R   ++   +++PC+L+S LT+++F+LP +   K+ L +++ ++ ++ L ++ ET PS S  +P +G Y    MI +TLS  +++ V+N+++R  K   +P W+R+  +    +++ M       ++V   +S + +HL    + +S       Q+ +      ++ + ++ R R  ++     + N SG S+
Sbjct:   19 LSGGTCSEAEHKLFSVIFSNYNQYI---RPVENVSDPVIVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLKWNPKEFGGVEFIRVPSNRIWKPDIVLYNNAVGDFQVDDKTKALLRFN--GDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLIG--STINLKDFWESGEWTIIDAPGYKHDIKYNCCEEIYTDITYSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPCWVRRVFLGLLPRVMFMTRPERDPEKVAVGSSVQTVHLRPCTVHSSGT----LQKHKARAPGSSMMSSLTNRQRILNNTELSNLNNRSGDSN 420          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Match: si:ch211-39a7.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101160921])

HSP 1 Score: 204.912 bits (520), Expect = 2.076e-57
Identity = 166/539 (30.80%), Postives = 260/539 (48.24%), Query Frame = 1
Query:  184 YASMSG--EKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQP--DLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKG-VNATSKILGMKQVISSASSEK----LHLIK-------SEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSK-------MAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRL 1731
            + S+ G  ++ L+  +LKDY +   + RPV N   T+ V + L+LIQIM +DEKNQ+LT N+W + TW D  L WN   +  V+ +R   D++WTPDI+LYN AD+         V VN  G   ++PP IF STC +D+  FPFD Q C LKFGSWTY G  LD+Q+     E DI  Y  + EW ++  P  R  +    D   +P  D+TF + ++R + Y+A  L++PCVLLS +TL++F LP +S  K+ LG+ + ++ ++ + L+AE  P+ S SVP +G Y+   MI++ +S   + +V+  +       N+P W++   +   +  L MK+   S   E+     HL +         I N  +H       ++    +T P  +     H  S        + M  Q++  SS         P Q       P  A S  P     P          A      A P   S+            +A + +  L  I + ++ +  +  E+D    +A +W+    V+DRL
Sbjct:   17 HVSLQGPHQRSLLKSLLKDYNR---MERPVANDSHTLTVHFTLSLIQIMDVDEKNQVLTSNMWLQMTWYDHYLQWNQSEYPGVKNLRFTSDQVWTPDILLYNSADDDFDSTFKTNVLVNSSGYAKYLPPGIFMSTCNVDVRWFPFDIQKCNLKFGSWTYDGWLLDLQMI----EADISSYMPNGEWDLIGVPGSRNEI--FYDCCKEPYTDVTFVITIRRRTLYYALNLLIPCVLLSSMTLLVFVLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASIMIIVGMSVIATTVVLQYHHHDPNGGNMPKWVQLVLLQWVAWFLRMKRPGESDDPERPPCAPHLRRCSSGSQSGSIPNPPDHTLHPLHPQSLAPLQTGPLHVGHPHLHTQSTTNNNGNLLYMGFQSIEDSSV-----LSEPVQRNVSAGPPRVAGSPPPH---LPSQFCSSPPPPASNMDTVACPSTVSSGGGFGGGVGGCSTAGIGDPQLQAILEEVRYMADRFREQDEAESVANQWKFAGAVIDRL 538          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000069967.1 (SMESG000069967.1)

HSP 1 Score: 1005.74 bits (2599), Expect = 0.000e+0
Identity = 576/577 (99.83%), Postives = 576/577 (99.83%), Query Frame = 1
Query:  118 MRLIGVIVWIFVIFPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVXXXXXXXXXXXXXXKSMDQILEEYARKYEK 1848
            MRLIGVIVWIFVIFPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSST KKQTQQKKSNQSAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMDQILEEYARKYEK
Sbjct:    1 MRLIGVIVWIFVIFPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSSTTKKQTQQKKSNQSAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMDQILEEYARKYEK 577          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000069967.1 (SMESG000069967.1)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 557/568 (98.06%), Postives = 560/568 (98.59%), Query Frame = 1
Query:  145 IFVIFPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVXXXXXXXXXXXXXXKSMDQILEEYARKYEK 1848
            I ++F   +   DYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSST KKQTQQKKSNQSAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMDQILEEYARKYEK
Sbjct:    3 ILIVFMILLLGVDYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSSTTKKQTQQKKSNQSAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMDQILEEYARKYEK 570          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000069967.1 (SMESG000069967.1)

HSP 1 Score: 966.066 bits (2496), Expect = 0.000e+0
Identity = 555/557 (99.64%), Postives = 555/557 (99.64%), Query Frame = 1
Query:  178 ADYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVXXXXXXXXXXXXXXKSMDQILEEYARKYEK 1848
             DYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSST KKQTQQKKSNQSAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMDQILEEYARKYEK
Sbjct:    7 VDYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSSTTKKQTQQKKSNQSAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMDQILEEYARKYEK 563          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000069967.1 (SMESG000069967.1)

HSP 1 Score: 956.822 bits (2472), Expect = 0.000e+0
Identity = 551/552 (99.82%), Postives = 551/552 (99.82%), Query Frame = 1
Query:  193 MSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVXXXXXXXXXXXXXXKSMDQILEEYARKYEK 1848
            MSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSST KKQTQQKKSNQSAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMDQILEEYARKYEK
Sbjct:    1 MSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSSTTKKQTQQKKSNQSAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMDQILEEYARKYEK 552          
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Match: SMESG000069967.1 (SMESG000069967.1)

HSP 1 Score: 937.562 bits (2422), Expect = 0.000e+0
Identity = 541/542 (99.82%), Postives = 541/542 (99.82%), Query Frame = 1
Query:  223 MLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYXXXXXXXXXXXXXXXXXXXPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMXXXXXXXXXXXXXXNLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVXXXXXXXXXXXXXXKSMDQILEEYARKYEK 1848
            MLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSST KKQTQQKKSNQSAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMDQILEEYARKYEK
Sbjct:    1 MLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPISPRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSSTTKKQTQQKKSNQSAILLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMDQILEEYARKYEK 542          
The following BLAST results are available for this feature:
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA32.356e-5833.42cholinergic receptor nicotinic alpha 3 subunit [So... [more]
CHRNA32.356e-5833.42cholinergic receptor nicotinic alpha 3 subunit [So... [more]
CHRNA33.670e-5833.42cholinergic receptor nicotinic alpha 3 subunit [So... [more]
CHRNA72.958e-5635.17cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC243734.12.958e-5635.17cholinergic receptor nicotinic alpha 7 subunit [So... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acr-164.431e-5436.39Acetylcholine receptor subunit alpha-type acr-16 ... [more]
acr-96.124e-5434.94AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-191.592e-5336.18AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-191.723e-5336.18AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-252.642e-5333.33AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha51.548e-6138.10gene:FBgn0028875 transcript:FBtr0300594[more]
nAChRalpha51.548e-6138.10gene:FBgn0028875 transcript:FBtr0080594[more]
nAChRalpha51.548e-6138.10gene:FBgn0028875 transcript:FBtr0309867[more]
nAChRalpha53.292e-6138.10gene:FBgn0028875 transcript:FBtr0474155[more]
nAChRalpha76.669e-6037.54gene:FBgn0086778 transcript:FBtr0301835[more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-380n15.21.951e-6038.35si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
si:ch73-380n15.22.207e-6038.30si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
chrna4b6.803e-6038.35cholinergic receptor, nicotinic, alpha 4b [Source:... [more]
si:ch73-380n15.27.380e-6038.05si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
chrna2a2.367e-5937.28cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021532.13.660e-5939.63cholinergic receptor, nicotinic alpha 7 [Source:NC... [more]
CHRNA21.845e-5828.26cholinergic receptor, nicotinic alpha 2 [Source:NC... [more]
CHRNA21.207e-5735.76cholinergic receptor, nicotinic alpha 2 [Source:NC... [more]
mppe18.134e-5633.88metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe19.162e-5633.88metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna96.418e-5931.52cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna35.216e-5732.67cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna39.803e-5732.67cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna39.952e-5732.67cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna21.059e-5636.18cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P09482|ACHA4_CHICK1.035e-5938.55Neuronal acetylcholine receptor subunit alpha-4 OS... [more]
sp|Q07263|ACHA3_BOVIN6.362e-5832.67Neuronal acetylcholine receptor subunit alpha-3 OS... [more]
sp|P43144|ACHA9_RAT8.455e-5831.79Neuronal acetylcholine receptor subunit alpha-9 OS... [more]
sp|P32297|ACHA3_HUMAN1.131e-5733.42Neuronal acetylcholine receptor subunit alpha-3 OS... [more]
sp|P09480|ACHA2_CHICK5.745e-5736.76Neuronal acetylcholine receptor subunit alpha-2 OS... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F4B21.047e-14145.01Putative nachr subunit OS=Schistosoma mansoni OX=6... [more]
A0A5K4F4106.681e-14146.02Putative nachr subunit OS=Schistosoma mansoni OX=6... [more]
A0A095AWG07.685e-14144.63Neuronal acetylcholine receptor subunit alpha-4 OS... [more]
A0A1I8G3D52.690e-13462.03Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GKY01.918e-13162.60Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna2a1.953e-6036.29cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
si:ch73-380n15.23.849e-6038.67si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
chrna38.061e-6029.80neuronal acetylcholine receptor subunit alpha-3-li... [more]
chrna34.744e-5835.88neuronal acetylcholine receptor subunit alpha-3-li... [more]
chrna4b9.391e-5836.80neuronal acetylcholine receptor subunit alpha-2 [S... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna39.158e-6239.53cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrnb3b2.202e-5637.88cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna2a4.215e-4635.26cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
chrnb1l1.394e-4031.11cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
ENSPMAT00000008550.11.849e-3838.59pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320529.125e-5640.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420542.115e-5536.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320535.657e-5537.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479696.696e-5235.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436421.019e-4836.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-380n15.26.016e-6137.08neuronal acetylcholine receptor subunit alpha-7 [S... [more]
si:ch73-380n15.22.905e-6038.39neuronal acetylcholine receptor subunit alpha-7 [S... [more]
chrna4b6.357e-5935.49neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna36.179e-5832.20neuronal acetylcholine receptor subunit alpha-3 [S... [more]
si:ch211-39a7.12.076e-5730.80neuronal acetylcholine receptor subunit alpha-7-li... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069967.10.000e+099.83SMESG000069967.1[more]
SMESG000069967.10.000e+098.06SMESG000069967.1[more]
SMESG000069967.10.000e+099.64SMESG000069967.1[more]
SMESG000069967.10.000e+099.82SMESG000069967.1[more]
SMESG000069967.10.000e+099.82SMESG000069967.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031159 ID=SMED30031159|Name=Neuronal acetylcholine receptor subunit alpha-4|organism=Schmidtea mediterranea sexual|type=transcript|length=2010bp
CCAGATTCTGTGCTATGGCAACGAGGTTGACTTAATTATTTTTTCTTATC
CATTGAAAATTGGAGAAATCAATATCAACTGAATATTTTGACTTCCTGTT
GAGTATTATTTTGTCATATGCGTCTCATCGGCGTGATAGTGTGGATATTT
GTCATTTTCCCTAGTTATATTACTCTGGCAGATTATGCATCCATGTCGGG
AGAGAAAAAGCTCATTACTAAAATGCTTAAAGATTATAAAAAGAAAGGCA
AAATAGGACGGCCGGTGAGAAACGTTCAAGATACAGTTGTGGTAAAATAC
GGCCTAGCTCTTATTCAGATTATGTCATTGGATGAAAAAAATCAAATTCT
TACGGTCAACGTTTGGGCGAAATATACTTGGGTCGATGAAATGCTAATAT
GGAATCCGAAAAACTTTTCAAACGTTGAAGAAGTTCGAATGCCTCCGGAT
AAAATCTGGACTCCAGATATCGTTCTCTATAATTATGCAGATGAACGACT
GATAGAAAAACGAGATGTGATGGTGTCTGTCAATTACATTGGAAGAATTA
TTTGGATGCCGCCGGCTATTTTCAAAAGCACATGTGGAATAGATATTTCC
AATTTCCCATTCGACTTTCAATCTTGTTATTTGAAATTTGGATCCTGGAC
TTACAAAGGCGATAAATTAGACATTCAGCTTTATGAGAACTTCTCAGAAA
TCGATATTATTGATTACACCGAGAGTAATGAATGGCTCATCTTGCATAAA
CCCGCCAGGCGGTTCGTTCTAAAAAACATGAAAGACAATACTAGCCAACC
AGATTTGACATTCTTTCTAATATTGAAAAGGAATTCAGCTTATCATGCGT
ACTTATTGGTGGTACCTTGTGTTCTATTGTCGTTACTGACGCTCGTTATA
TTTTGGCTTCCTCCTGAATCTCCAGCCAAAATGATATTAGGCATGAATAT
ATTTGTCGCATTCTCTCTCTTGCTACGATTGTTAGCAGAGACCACGCCGT
CAGCTTCGACCAGTGTTCCGTTTTTGGGATATTATTATTGTTTAAATATG
ATTCTCATCACTCTAAGTACTTTTCTCTCAATCATTGTTATCAATTTATA
TTTTCGGTGTGATAAAAGACGAAACCTCCCTGACTGGTTGCGAAAAGGCG
TTAACGCAACATCTAAAATTCTGGGAATGAAACAAGTTATTTCATCAGCC
AGTTCTGAAAAACTCCATTTGATAAAATCTGAGATCAAAAACTCGAGAAA
TCATATAAAACGACAACAGGAGAAAGAAACTACTGAGTCTCGTGAAACGA
TTCCAACTCCGATTTCTCCCCGTGCCAGGCATAAAAGTAGTAAAATGGCA
ATGGAAATGCAAAATCTTTCCGGCAGTAGTTCGAATTATCAAACTCGATT
TCAATATCCACGTCAGAACACTGATGTGACAGATATCCCTTATACTGCTC
ATAGTGATATTCCAAGGAATTCATTTAATCCCGGGTATTCTTATGAATAC
CGTTATTCCAATGCTCCTCCCCCAGCTGCTCCTGCCTCTCCTCTCCCTTC
TTCAACAATGAAAAAGCAAACTCAACAGAAAAAATCAAACCAATCCGCAA
TTCTTCTGGAAAAAAATCTTAGTGAAATTAGGAAAGCATTGAAAAATCTA
ATGACTAAAATAGCAGAAAAAGATAGAGGAAATCGAATAGCAAAAGAATG
GAGAATGGTAGCAATGGTGTTAGATAGACTGTTCTTTTGGGTTTATTTCG
TGATTGTCATCCTGTCTGGATTAATCCTCTTGTTGCCACGAGGTCTTCCC
AAAAGCATGGATCAAATCCTGGAGGAATATGCTAGAAAGTATGAAAAGTA
GAAATTGATCTCCTTTCTCTCATTATTCTGTGTAGTCAACTGATAATATT
TTTAGAGTTTTATTCATTATGATACGATTAAACCATAAAAAGATTTGTTC
GTTTTCAATTTTTCGTTTTTTTTTATCCAATCAGATTTCATTATTATGCT
GTTACGAGAT
back to top

protein sequence of SMED30031159-orf-1

>SMED30031159-orf-1 ID=SMED30031159-orf-1|Name=SMED30031159-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=578bp
MRLIGVIVWIFVIFPSYITLADYASMSGEKKLITKMLKDYKKKGKIGRPV
RNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNF
SNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPA
IFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDY
TESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVP
CVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSV
PFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSK
ILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPIS
PRARHKSSKMAMEMQNLSGSSSNYQTRFQYPRQNTDVTDIPYTAHSDIPR
NSFNPGYSYEYRYSNAPPPAAPASPLPSSTMKKQTQQKKSNQSAILLEKN
LSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILS
GLILLLPRGLPKSMDQILEEYARKYEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005216ion channel activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006201Neur_channel
IPR002394Nicotinic_acetylcholine_rcpt
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
IPR027361Acetylcholine_rcpt_TM
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 366..386
NoneNo IPR availableCOILSCoilCoilcoord: 494..514
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 244..395
e-value: 2.2E-26
score: 94.6
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 491..565
e-value: 8.4E-8
score: 34.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 468..492
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 374..408
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 374..392
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 476..492
NoneNo IPR availablePANTHERPTHR18945:SF401NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-4coord: 501..557
NoneNo IPR availablePANTHERPTHR18945:SF401NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-4coord: 28..385
NoneNo IPR availableCDDcd19051LGIC_TM_cationcoord: 242..349
e-value: 1.97521E-33
score: 121.316
NoneNo IPR availableCDDcd19033LGIC_ECD_nAChR_proto-likecoord: 57..239
e-value: 3.20877E-99
score: 296.89
NoneNo IPR availableTMHMMTMhelixcoord: 242..264
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 273..290
NoneNo IPR availableTMHMMTMhelixcoord: 538..560
NoneNo IPR availableTMHMMTMhelixcoord: 305..327
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 79..95
score: 35.77
coord: 156..170
score: 49.29
coord: 112..123
score: 52.94
coord: 234..246
score: 21.23
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 501..557
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 28..385
IPR002394Nicotinic acetylcholine receptorPRINTSPR00254NICOTINICRcoord: 136..154
score: 50.94
coord: 100..114
score: 33.11
coord: 118..130
score: 45.81
coord: 66..82
score: 47.84
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 247..554
e-value: 1.6E-36
score: 126.5
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 25..243
e-value: 2.7E-69
score: 234.8
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 28..239
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 29..239
e-value: 3.6E-59
score: 199.8
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 156..170
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 242..556