DnaJ homolog subfamily C member 7

Overview
NameDnaJ homolog subfamily C member 7
Smed IDSMED30031156
Length (bp)1712
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DnaJ homolog subfamily C member 7 (SMED30031156) t-SNE clustered cells

Violin plots show distribution of expression levels for DnaJ homolog subfamily C member 7 (SMED30031156) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DnaJ homolog subfamily C member 7 (SMED30031156) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DnaJ homolog subfamily C member 7 (SMED30031156) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031156

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30031156SMESG000079969.1 SMESG000075593.1 SMESG000075584.1 Contig340uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30031156SMESG000079969.1 SMESG000075593.1 SMESG000075584.1 Contig340newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30031156SMESG000056009.1 Contig340uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30031156SMESG000056009.1 Contig340newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30031156SMESG000075593.1 SMESG000075584.1 dd_Smed_v4_1811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Human
Match: DNAJC7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:HGNC Symbol;Acc:HGNC:12392])

HSP 1 Score: 323.168 bits (827), Expect = 9.507e-104
Identity = 197/478 (41.21%), Postives = 278/478 (58.16%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFF---------SSGCGNAGFKMN 1539
             E  +  GN YY++ +Y  A   YT AID  P  AS+Y NR+A  +ML R+ +A  DA++S  L+   ++  +R GKC L+LG    A  +FQ++   D  N++ Q   +    V           EK+D+R  +FC++R LE +P     K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + ++KA   F   L+ +PDH  A  A R  K L   KE+GN   +   Y+ A E+YT+AL IDPN+ + NAKLY NR    SKL +  +A+ DC  A++LD  Y+KA  RR  C +  ++YEEA R+ EK+ +   + E+ +LLK  +L +K+SK+ D Y +LGV K+A+E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A+++LSDP+KK  YDSG D+DE                DP  +F+AFF         +SG GN  F+  
Sbjct:   28 AETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQ-SVASDILRMDST--NADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDE--------EGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG 494          

HSP 2 Score: 50.447 bits (119), Expect = 7.636e-6
Identity = 33/101 (32.67%), Postives = 51/101 (50.50%), Query Frame = 1
Query:  781 PDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGL 1083
            P+ +  Q+A R  +     KE+GN       Y +A   YT+A+++ P     NA  Y NR+ TL  L R+ EAL D  +++ LD  +V+   R   C + L
Sbjct:   16 PELLDDQEAKREAE---TFKEQGNAYYAKKDYNEAYNYYTKAIDMCPK----NASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSL 109          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Human
Match: DNAJC7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:HGNC Symbol;Acc:HGNC:12392])

HSP 1 Score: 301.982 bits (772), Expect = 3.121e-96
Identity = 174/400 (43.50%), Postives = 247/400 (61.75%), Query Frame = 1
Query:  226 PNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDE 1425
            P  AS+Y NR+A  +ML R+ +A  DA++S  L+   ++  +R GKC L+LG    A  +FQ++   D  N++ Q   +    V           EK+D+R  +FC++R LE +P     K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + ++KA   F   L+ +PDH  A  A R  K L   KE+GN   +   Y+ A E+YT+AL IDPN+ + NAKLY NR    SKL +  +A+ DC  A++LD  Y+KA  RR  C +  ++YEEA R+ EK+ +   + E+ +LLK  +L +K+SK+ D Y +LGV K+A+E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A+++LSDP+KK  YDSG D+DE
Sbjct:    3 PKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQ-SVASDILRMDST--NADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDE 399          

HSP 2 Score: 54.299 bits (129), Expect = 3.914e-7
Identity = 32/94 (34.04%), Postives = 49/94 (52.13%), Query Frame = 1
Query:  145 RRNGNKYYSQGNYKAALESYTAAIDTEPN----VASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQK 414
            + +GNK + +GNYK A E YT A+  +PN     A  Y NR  VN  L +  DA  D   + +L+   IK  +R  +C ++   + EA   ++K
Sbjct:  204 KEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEK 297          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Human
Match: DNAJC7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:HGNC Symbol;Acc:HGNC:12392])

HSP 1 Score: 301.982 bits (772), Expect = 3.121e-96
Identity = 174/400 (43.50%), Postives = 247/400 (61.75%), Query Frame = 1
Query:  226 PNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDE 1425
            P  AS+Y NR+A  +ML R+ +A  DA++S  L+   ++  +R GKC L+LG    A  +FQ++   D  N++ Q   +    V           EK+D+R  +FC++R LE +P     K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + ++KA   F   L+ +PDH  A  A R  K L   KE+GN   +   Y+ A E+YT+AL IDPN+ + NAKLY NR    SKL +  +A+ DC  A++LD  Y+KA  RR  C +  ++YEEA R+ EK+ +   + E+ +LLK  +L +K+SK+ D Y +LGV K+A+E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A+++LSDP+KK  YDSG D+DE
Sbjct:    3 PKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQ-SVASDILRMDST--NADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDE 399          

HSP 2 Score: 54.299 bits (129), Expect = 3.914e-7
Identity = 32/94 (34.04%), Postives = 49/94 (52.13%), Query Frame = 1
Query:  145 RRNGNKYYSQGNYKAALESYTAAIDTEPN----VASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQK 414
            + +GNK + +GNYK A E YT A+  +PN     A  Y NR  VN  L +  DA  D   + +L+   IK  +R  +C ++   + EA   ++K
Sbjct:  204 KEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEK 297          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Human
Match: DNAJC7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:HGNC Symbol;Acc:HGNC:12392])

HSP 1 Score: 167.548 bits (423), Expect = 2.629e-47
Identity = 100/254 (39.37%), Postives = 143/254 (56.30%), Query Frame = 1
Query:  226 PNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLER 987
            P  AS+Y NR+A  +ML R+ +A  DA++S  L+   ++  +R GKC L+LG    A  +FQ++   D  N++ Q   +    V           EK+D+R  +FC++R LE +P     K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + ++KA   F   L+ +PDH  A  A R  K L   KE+GN   +   Y+ A E+YT+AL IDPN+ + NAKLY NR    SK  R
Sbjct:    3 PKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQ-SVASDILRMDST--NADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKETR 253          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Human
Match: DNAJC7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:HGNC Symbol;Acc:HGNC:12392])

HSP 1 Score: 154.836 bits (390), Expect = 1.596e-42
Identity = 91/240 (37.92%), Postives = 132/240 (55.00%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGN 852
             E  +  GN YY++ +Y  A   YT AID  P  AS+Y NR+A  +ML R+ +A  DA++S  L+   ++  +R GKC L+LG    A  +FQ++   D  N++ Q   +    V           EK+D+R  +FC++R LE +P     K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + ++KA   F   L+ +PDH  A  A R  K L   KE+GN
Sbjct:   15 AETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQ-SVASDILRMDST--NADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGN 251          

HSP 2 Score: 49.2914 bits (116), Expect = 7.967e-6
Identity = 29/83 (34.94%), Postives = 43/83 (51.81%), Query Frame = 1
Query:  835 LKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGL 1083
             KE+GN       Y +A   YT+A+++ P     NA  Y NR+ TL  L R+ EAL D  +++ LD  +V+   R   C + L
Sbjct:   18 FKEQGNAYYAKKDYNEAYNYYTKAIDMCPK----NASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSL 96          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Celegans
Match: dnj-7 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:P91189])

HSP 1 Score: 97.0561 bits (240), Expect = 3.843e-21
Identity = 106/434 (24.42%), Postives = 189/434 (43.55%), Query Frame = 1
Query:  130 TGEE---HRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHD-EVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSK-LLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVD 1416
            T EE   H   G+++ ++  +  AL  Y AAI+ +P        R+   L + R   A  D ++  EL+PD     ++ G   L  G    AE  F     +DS+N+++Q     +   +    Q ++     D       +   +EI      L   + + L       +A   +  + + +TDS   T+ ++     LY +  L+++ +  +  LK +PDH      Y++ +K+ +  E     V    +    E   + ++ DP    ++N     NR     +     EA+++C++ L  DP     +  R    I  + Y+ A  + +K  +  P    +K  L+  K    ++ + D Y +LGV ++A++ EI K YRK A   HPD  S  DE  +   E+KF ++  A  VL D  K++ +D GVD
Sbjct:   22 TAEEVAKHLELGSQFLARAQFADALTQYHAAIELDPKSYQAIYRRATTYLAMGRGKAAIVDLERVLELKPDFYGARIQRGNILLKQGELEAAEADFNIVLNHDSSNNDVQEKTALIEQHRQLRHQIKSAYAGGDCATVEEYINHIIEIQVWDASLYRMRAKCLEERGELKKAIHDMRIVSKLSTDS---TDTMFETSKLLYTVGDLEESLNVIRECLKLNPDHKSCYPFYKKLRKVVKSLESMKKKVENSDWMACLEEGQKTMKFDPTPSVQLNVFRITNR--CQREAGHISEAIAECNEILNDDPSDADILCERAEAHILDEDYDSAIEDYQKATEVNPDHREAKEGLEHAKRLKTQAGKRDYYKILGVKRNASKREITKAYRKLAQKWHPDNFS--DEEEKKKAEKKFIDIAAAKEVLQDEEKRRQFDQGVD 448          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Celegans
Match: dnj-28 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q9N3E0])

HSP 1 Score: 89.3521 bits (220), Expect = 1.122e-18
Identity = 103/430 (23.95%), Postives = 178/430 (41.40%), Query Frame = 1
Query:  154 GNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKE---KKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLE--RWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQL----DPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVD 1416
            GN  +    Y  AL  Y  AI+  P +      R+   L   R      D       +PD      +     L +G    A   F+    + ++    Q   EKL ++   I+Q    K      D  + +      LE  P    L +Y+ +  ++  +    K ++  M      S  NTE L+      Y +  +  +    +  LK +PDH     +Y+  KK+ +  +     +   ++ K  E   + LE    ++E+  ++   R +     E     EA+  C + LE D   V+ + +R    +  + Y+ A  + EK  +    D ++  ++  K   KR+K+L    D Y +LGV ++AN+ EI K YRK A   HPD  +  DE  +   E+KF ++  A  VLS+  K++ +D+G D
Sbjct:   31 GNALFVNRQYSDALTHYHKAIELNPTMYQAIFRRATTYLAFGRSKPGLADLDTVLSQKPDFAGARQQRASVLLKMGQLERAAADFRYLIDHSASQETSQEAQEKLELISEHINQVEMLKSWITNGDCNNVIESTTHLLETQPWDASLYIYRAKCYVAEDK---VKSAIHDMKHAAKLSSDNTELLFEMSELEYKVADVRDSLGSIRECLKLNPDHKKCYTSYKSLKKIVKSLDSMKASIEQQEWTKCLETGEKLLE---KNEEIPIRMNIFRLMCQCNREDGNLGEAIQQCTRVLEFDDSDVETLIQRAEAYMADEEYDMAIADYEKAEE---WDSSNDAVRTGKDQAKRAKELVGKRDYYKILGVRRNANKREITKAYRKMAQKWHPD--NFQDEKEKKKAEKKFIDIAAAKEVLSNEEKRRAFDNGQD 449          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Celegans
Match: dnj-13 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q20774])

HSP 1 Score: 70.0922 bits (170), Expect = 8.170e-13
Identity = 49/118 (41.53%), Postives = 62/118 (52.54%), Query Frame = 1
Query: 1201 DPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDS----GV-DIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSS----GCGNAG 1527
            D Y VLG+ K A + EIKK YRK AL +HPD++  A        E KFKE+  AY VLSD +KK++YD     G+ +     G    GG      GDPM +F +FF      G G  G
Sbjct:    4 DYYKVLGISKGATDDEIKKAYRKMALKYHPDKNKEA------GAENKFKEIAEAYDVLSDDKKKKIYDQFGEEGLKEGGPGAGGGGGGGMHYEFRGDPMNIFSSFFGGSDPFGAGGPG 115          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Celegans
Match: dnj-13 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q20774])

HSP 1 Score: 70.0922 bits (170), Expect = 8.170e-13
Identity = 49/118 (41.53%), Postives = 62/118 (52.54%), Query Frame = 1
Query: 1201 DPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDS----GV-DIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSS----GCGNAG 1527
            D Y VLG+ K A + EIKK YRK AL +HPD++  A        E KFKE+  AY VLSD +KK++YD     G+ +     G    GG      GDPM +F +FF      G G  G
Sbjct:    4 DYYKVLGISKGATDDEIKKAYRKMALKYHPDKNKEA------GAENKFKEIAEAYDVLSDDKKKKIYDQFGEEGLKEGGPGAGGGGGGGMHYEFRGDPMNIFSSFFGGSDPFGAGGPG 115          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Celegans
Match: dnj-16 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q22028])

HSP 1 Score: 68.1662 bits (165), Expect = 5.026e-12
Identity = 37/70 (52.86%), Postives = 51/70 (72.86%), Query Frame = 1
Query: 1195 QLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYD 1404
            ++D Y +LGV K A+E+EIK  YRK AL +HPDR+ +      HA+E+ FK+V+ AYSVLSDP K++ YD
Sbjct:   32 EMDFYQLLGVEKMASEAEIKSAYRKLALKYHPDRNPN----DAHAQEE-FKKVSIAYSVLSDPNKRRQYD 96          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0080867)

HSP 1 Score: 305.449 bits (781), Expect = 1.482e-97
Identity = 176/477 (36.90%), Postives = 280/477 (58.70%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEI---QSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEA-KISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFF---SSGCGNAGFKMNF 1542
             EE ++ GN  Y   NY+ AL+ YT AI   P+ A++Y NR+A  +ML  Y  A  DA+ +  ++P   K  VR+ KC L LG     E   +     +S ++ +   Q+  +KL  ++  I   +A  + K YR+ +F ++  L+++P   + +L K E L  L R  EA  I++  M   TT +    +A+Y+RGLCLYY ++LDK   HF+  L   PDH  ++Q   +CK+L ++KE GNML ++ +Y +A  +YT AL+ID ++ ++N+KL +NR+L  +++    EA++DC++ LEL+ QY+KA+  R  C   L+++EE+  + E   +   + E  ++L++ K A+K+SK+ D Y +LG+ ++A++ EIKK YRK+AL+HHPDRH+++    R  EE KFKEV  AY++LSD  KK  YDSG DI+E                DP ++F+ FF     G  N+ F   F
Sbjct:    5 AEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATI---QANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSA----DAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPEIKRMLREAKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRYDSGQDIEE----------QEQADFDPNQMFRTFFQFNGGGRNNSSFNFEF 464          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0333488)

HSP 1 Score: 305.449 bits (781), Expect = 1.482e-97
Identity = 176/477 (36.90%), Postives = 280/477 (58.70%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEI---QSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEA-KISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFF---SSGCGNAGFKMNF 1542
             EE ++ GN  Y   NY+ AL+ YT AI   P+ A++Y NR+A  +ML  Y  A  DA+ +  ++P   K  VR+ KC L LG     E   +     +S ++ +   Q+  +KL  ++  I   +A  + K YR+ +F ++  L+++P   + +L K E L  L R  EA  I++  M   TT +    +A+Y+RGLCLYY ++LDK   HF+  L   PDH  ++Q   +CK+L ++KE GNML ++ +Y +A  +YT AL+ID ++ ++N+KL +NR+L  +++    EA++DC++ LEL+ QY+KA+  R  C   L+++EE+  + E   +   + E  ++L++ K A+K+SK+ D Y +LG+ ++A++ EIKK YRK+AL+HHPDRH+++    R  EE KFKEV  AY++LSD  KK  YDSG DI+E                DP ++F+ FF     G  N+ F   F
Sbjct:    5 AEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATI---QANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSA----DAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPEIKRMLREAKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRYDSGQDIEE----------QEQADFDPNQMFRTFFQFNGGGRNNSSFNFEF 464          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0333486)

HSP 1 Score: 305.449 bits (781), Expect = 1.843e-97
Identity = 176/477 (36.90%), Postives = 280/477 (58.70%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEI---QSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEA-KISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFF---SSGCGNAGFKMNF 1542
             EE ++ GN  Y   NY+ AL+ YT AI   P+ A++Y NR+A  +ML  Y  A  DA+ +  ++P   K  VR+ KC L LG     E   +     +S ++ +   Q+  +KL  ++  I   +A  + K YR+ +F ++  L+++P   + +L K E L  L R  EA  I++  M   TT +    +A+Y+RGLCLYY ++LDK   HF+  L   PDH  ++Q   +CK+L ++KE GNML ++ +Y +A  +YT AL+ID ++ ++N+KL +NR+L  +++    EA++DC++ LEL+ QY+KA+  R  C   L+++EE+  + E   +   + E  ++L++ K A+K+SK+ D Y +LG+ ++A++ EIKK YRK+AL+HHPDRH+++    R  EE KFKEV  AY++LSD  KK  YDSG DI+E                DP ++F+ FF     G  N+ F   F
Sbjct:   19 AEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATI---QANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTTSA----DAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPEIKRMLREAKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRYDSGQDIEE----------QEQADFDPNQMFRTFFQFNGGGRNNSSFNFEF 478          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0080866)

HSP 1 Score: 305.449 bits (781), Expect = 4.464e-97
Identity = 180/479 (37.58%), Postives = 281/479 (58.66%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEI---QSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEA-KISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEE--ADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFF---SSGCGNAGFKMNF 1542
             EE ++ GN  Y   NY+ AL+ YT AI   P+ A++Y NR+A  +ML  Y  A  DA+ +  ++P   K  VR+ KC L LG     E   +     +S ++ +   Q+  +KL  ++  I   +A  + K YR+ +F ++  L+++P   + +L K E L  L R  EA  I++  M   TT    + +A+Y+RGLCLYY ++LDK   HF+  L   PDH  ++Q   +CK+L ++KE GNML ++ +Y +A  +YT AL+ID ++ ++N+KL +NR+L  +++    EA++DC++ LEL+ QY+KA+  R  C   L+++EE  AD E     +K P  E  ++L++ K A+K+SK+ D Y +LG+ ++A++ EIKK YRK+AL+HHPDRH+++    R  EE KFKEV  AY++LSD  KK  YDSG DI+E                DP ++F+ FF     G  N+ F   F
Sbjct:   49 AEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATI---QANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTT----SADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTP--EIKRMLREAKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRYDSGQDIEE----------QEQADFDPNQMFRTFFQFNGGGRNNSSFNFEF 508          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Fly
Match: Tpr2 (gene:FBgn0032586 transcript:FBtr0333487)

HSP 1 Score: 305.449 bits (781), Expect = 4.464e-97
Identity = 180/479 (37.58%), Postives = 281/479 (58.66%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEI---QSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEA-KISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEE--ADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFF---SSGCGNAGFKMNF 1542
             EE ++ GN  Y   NY+ AL+ YT AI   P+ A++Y NR+A  +ML  Y  A  DA+ +  ++P   K  VR+ KC L LG     E   +     +S ++ +   Q+  +KL  ++  I   +A  + K YR+ +F ++  L+++P   + +L K E L  L R  EA  I++  M   TT    + +A+Y+RGLCLYY ++LDK   HF+  L   PDH  ++Q   +CK+L ++KE GNML ++ +Y +A  +YT AL+ID ++ ++N+KL +NR+L  +++    EA++DC++ LEL+ QY+KA+  R  C   L+++EE  AD E     +K P  E  ++L++ K A+K+SK+ D Y +LG+ ++A++ EIKK YRK+AL+HHPDRH+++    R  EE KFKEV  AY++LSD  KK  YDSG DI+E                DP ++F+ FF     G  N+ F   F
Sbjct:   49 AEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLRQLEATI---QANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVMKLDTT----SADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTP--EIKRMLREAKFALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHKKSRYDSGQDIEE----------QEQADFDPNQMFRTFFQFNGGGRNNSSFNFEF 508          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Zebrafish
Match: dnajc7 (DnaJ (Hsp40) homolog, subfamily C, member 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2483])

HSP 1 Score: 321.242 bits (822), Expect = 1.442e-103
Identity = 197/472 (41.74%), Postives = 275/472 (58.26%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFF---SSGCGNAGFKMN 1539
             E  +  GN YY + +Y  A   YT AID  P  AS+Y NR+A  +ML RY +A  D++++  L+   +K  +R GKC L LG    A    QK    + +NS+ Q  ++    +           EK+D+R  +FC++R L+ +      K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + +DKA   F   L+ +PDH  A+ A R  K L   KEEGN   +   YE+A E+YT+AL IDPN+ + NAKLY NR+   SKL +  +A+ DC KA++LD  Y+KA  RR  C +  ++YEEA R+ EK+ +   + E+  LLK  +L +K+SK+ D Y VLGV K+A E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A++VLSDP+KK  YDSG D+++                D   +F+AFF   +SG GN  F+  
Sbjct:   13 AEGFKEQGNAYYVKKDYAEAFNFYTKAIDLCPKNASYYGNRAATLMMLSRYREALEDSQQAVRLDDSFMKGHMREGKCHLLLGNAMAAIRCLQKVLEREPDNSQAQQEMKNAESILEYERMAEISFEKRDFRMVVFCMDRVLDSASACHRFKVLKAECLALLGRYPEAQ-SVASDILRMDST--NGDALYVRGLCLYYEDCIDKAVQFFVQALRMAPDHEKARLACRNAKALKAKKEEGNKAFKEGSYEEAYELYTEALTIDPNNIKTNAKLYCNRATVGSKLNKLEQAIEDCTKAIKLDETYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKNLLKNAQLELKKSKRKDYYKVLGVDKNATEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTVLSDPKKKTRYDSGHDLED---------DDMNMDFDANNIFKAFFGGPASGPGNFFFQFG 472          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Zebrafish
Match: dnajc7 (DnaJ (Hsp40) homolog, subfamily C, member 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2483])

HSP 1 Score: 320.857 bits (821), Expect = 8.805e-103
Identity = 197/472 (41.74%), Postives = 275/472 (58.26%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFF---SSGCGNAGFKMN 1539
             E  +  GN YY + +Y  A   YT AID  P  AS+Y NR+A  +ML RY +A  D++++  L+   +K  +R GKC L LG    A    QK    + +NS+ Q  ++    +           EK+D+R  +FC++R L+ +      K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + +DKA   F   L+ +PDH  A+ A R  K L   KEEGN   +   YE+A E+YT+AL IDPN+ + NAKLY NR+   SKL +  +A+ DC KA++LD  Y+KA  RR  C +  ++YEEA R+ EK+ +   + E+  LLK  +L +K+SK+ D Y VLGV K+A E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A++VLSDP+KK  YDSG D+++                D   +F+AFF   +SG GN  F+  
Sbjct:   57 AEGFKEQGNAYYVKKDYAEAFNFYTKAIDLCPKNASYYGNRAATLMMLSRYREALEDSQQAVRLDDSFMKGHMREGKCHLLLGNAMAAIRCLQKVLEREPDNSQAQQEMKNAESILEYERMAEISFEKRDFRMVVFCMDRVLDSASACHRFKVLKAECLALLGRYPEAQ-SVASDILRMDST--NGDALYVRGLCLYYEDCIDKAVQFFVQALRMAPDHEKARLACRNAKALKAKKEEGNKAFKEGSYEEAYELYTEALTIDPNNIKTNAKLYCNRATVGSKLNKLEQAIEDCTKAIKLDETYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKNLLKNAQLELKKSKRKDYYKVLGVDKNATEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTVLSDPKKKTRYDSGHDLED---------DDMNMDFDANNIFKAFFGGPASGPGNFFFQFG 516          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Zebrafish
Match: dnajc7 (DnaJ (Hsp40) homolog, subfamily C, member 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2483])

HSP 1 Score: 315.464 bits (807), Expect = 1.065e-100
Identity = 187/431 (43.39%), Postives = 261/431 (60.56%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDE 1425
             E  +  GN YY + +Y  A   YT AID  P  AS+Y NR+A  +ML RY +A  D++++  L+   +K  +R GKC L LG    A    QK    + +NS+ Q  ++    +           EK+D+R  +FC++R L+ +      K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + +DKA   F   L+ +PDH  A+ A R  K L   KEEGN   +   YE+A E+YT+AL IDPN+ + NAKLY NR+   SKL +  +A+ DC KA++LD  Y+KA  RR  C +  ++YEEA R+ EK+ +   + E+  LLK  +L +K+SK+ D Y VLGV K+A E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A++VLSDP+KK  YDSG D+++
Sbjct:   57 AEGFKEQGNAYYVKKDYAEAFNFYTKAIDLCPKNASYYGNRAATLMMLSRYREALEDSQQAVRLDDSFMKGHMREGKCHLLLGNAMAAIRCLQKVLEREPDNSQAQQEMKNAESILEYERMAEISFEKRDFRMVVFCMDRVLDSASACHRFKVLKAECLALLGRYPEAQ-SVASDILRMDST--NGDALYVRGLCLYYEDCIDKAVQFFVQALRMAPDHEKARLACRNAKALKAKKEEGNKAFKEGSYEEAYELYTEALTIDPNNIKTNAKLYCNRATVGSKLNKLEQAIEDCTKAIKLDETYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKNLLKNAQLELKKSKRKDYYKVLGVDKNATEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTVLSDPKKKTRYDSGHDLED 484          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Zebrafish
Match: dnajc3a (DnaJ (Hsp40) homolog, subfamily C, member 3a [Source:ZFIN;Acc:ZDB-GENE-030131-1264])

HSP 1 Score: 138.272 bits (347), Expect = 1.030e-34
Identity = 137/477 (28.72%), Postives = 220/477 (46.12%), Query Frame = 1
Query:  136 EEHRRNGNKYYSQGNYKAALESYTAAIDTEP-NVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQ---KSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPN--HDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSK-LLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSSGCGNAGFKMNFH 1545
            E H   G K  + G    AL  + AA+D EP N  +FY  R+ V L + +   A  D  K  EL+PD     ++ G   L  G  +EAE  F+   KS        E QS L+K   ++  + Q ++  + ++Y  A   ++  ++      + +  + E  I +    +A   L++  +  +D   NT+A Y      Y +   + + +  +  LK   DH      Y++ KKL++  +    L++  KY  A   Y   ++ +PN  H  +NAK        LSK ++   A+S C + L  DPQ V A+  R   L+  D+YEEA ++ +   +   +D   K  L++ +  +K+SK+ D Y +LGV ++A + EI K YRK A   HPD  +  D   +   E+KF ++  A  VL+DP  +  +D G   D +   S  GG    H     E FQ F   G G   FK  F+
Sbjct:   38 ENHLEMGKKLLAAGQLADALSHFHAAVDGEPKNYMAFYR-RATVYLAMGKSKSALPDLSKVIELKPDFTSARLQRGNLLLKHGKLDEAESDFKKVLKSNPSSREEQEAQSQLKKSDEIQRLVSQAQSDFKHREYSSAASHLDIIIDTCVWDVDSREMRAECFIQMGELGKAISDLKAASKLKSD---NTQAFYKLSTIYYDLGDHEMSLNEVRECLKLDQDHKQCFSHYKQVKKLNKQIQSAEELIQQEKYSDAVSKYESVMKTEPNVPHFTLNAKERMCH--CLSKDQQTARAISVCSEVLNTDPQNVNALKDRAEALLQDDQYEEAIKDFQSAKEYSENDRQIKEGLERAQRLLKQSKKRDYYKILGVKRTAQKKEILKAYRKLAQQWHPD--NFQDAEEKKKAEKKFIDIAQAKEVLTDPEMRSKFDQGE--DPMDPESQQGGGHHHHFHGGWENFQGFNPFGSGPFNFKFGFN 504          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Zebrafish
Match: dnajc3a (DnaJ (Hsp40) homolog, subfamily C, member 3a [Source:ZFIN;Acc:ZDB-GENE-030131-1264])

HSP 1 Score: 138.272 bits (347), Expect = 1.030e-34
Identity = 137/477 (28.72%), Postives = 220/477 (46.12%), Query Frame = 1
Query:  136 EEHRRNGNKYYSQGNYKAALESYTAAIDTEP-NVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQ---KSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPN--HDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSK-LLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSSGCGNAGFKMNFH 1545
            E H   G K  + G    AL  + AA+D EP N  +FY  R+ V L + +   A  D  K  EL+PD     ++ G   L  G  +EAE  F+   KS        E QS L+K   ++  + Q ++  + ++Y  A   ++  ++      + +  + E  I +    +A   L++  +  +D   NT+A Y      Y +   + + +  +  LK   DH      Y++ KKL++  +    L++  KY  A   Y   ++ +PN  H  +NAK        LSK ++   A+S C + L  DPQ V A+  R   L+  D+YEEA ++ +   +   +D   K  L++ +  +K+SK+ D Y +LGV ++A + EI K YRK A   HPD  +  D   +   E+KF ++  A  VL+DP  +  +D G   D +   S  GG    H     E FQ F   G G   FK  F+
Sbjct:   38 ENHLEMGKKLLAAGQLADALSHFHAAVDGEPKNYMAFYR-RATVYLAMGKSKSALPDLSKVIELKPDFTSARLQRGNLLLKHGKLDEAESDFKKVLKSNPSSREEQEAQSQLKKSDEIQRLVSQAQSDFKHREYSSAASHLDIIIDTCVWDVDSREMRAECFIQMGELGKAISDLKAASKLKSD---NTQAFYKLSTIYYDLGDHEMSLNEVRECLKLDQDHKQCFSHYKQVKKLNKQIQSAEELIQQEKYSDAVSKYESVMKTEPNVPHFTLNAKERMCH--CLSKDQQTARAISVCSEVLNTDPQNVNALKDRAEALLQDDQYEEAIKDFQSAKEYSENDRQIKEGLERAQRLLKQSKKRDYYKILGVKRTAQKKEILKAYRKLAQQWHPD--NFQDAEEKKKAEKKFIDIAQAKEVLTDPEMRSKFDQGE--DPMDPESQQGGGHHHHFHGGWENFQGFNPFGSGPFNFKFGFN 504          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Xenopus
Match: dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:NCBI gene;Acc:448421])

HSP 1 Score: 313.538 bits (802), Expect = 1.668e-100
Identity = 193/466 (41.42%), Postives = 270/466 (57.94%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSSGCGNAGF 1530
             E  +  GN +Y++ +Y  A   YT AID     AS+Y NR+A  +ML +Y +A  DA++S  L+   +K   R GKC L+LG    A   FQK    +  N + +  L+    V        A  EK+D+R  +FC++R LE++P     K+ K E L  L RYP+A+ S+ S I +   +  N +ALY+RGLCLYY + ++KA   F   LK +PDH  A+ A R  K L   KEEGN   +   Y+ A  +Y++AL IDPN+ + NAKLY NR    +KL++  EA+ DC  A++LD  Y+KA  RR  C    + YEEA R+ EK+ +   + E+ +LLK  +L +K+SK+ D Y +LGV K+A+E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A++VLSD +KK  YDSG D++E                D   +F+AFFS   G  GF
Sbjct:    5 AEACKEKGNVFYAKKDYNEAYNYYTKAIDWSRKNASYYGNRAATLMMLSKYREALEDAQQSVRLDDAFVKGHQREGKCHLSLGNAMAATRCFQKVVELEPKNEQARKELKNAAAVLEYERIAEADFEKRDFRKVVFCMDRSLELAPACHRFKILKAECLALLGRYPDAQ-SVASDILRMDAT--NADALYVRGLCLYYEDCIEKAVQFFVQALKMAPDHQKARLACRNAKALKAKKEEGNQAFKDGNYDLAHRLYSEALCIDPNNIKTNAKLYCNRGTVNAKLKKLNEAIEDCTNAIKLDDTYIKAYLRRAQCYTDTELYEEAVRDYEKVYQTESTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSAATAEVQKEEEKKFKEVGEAFTVLSDAKKKARYDSGQDLEE--------DGLNMGDFDANNIFKAFFS---GPGGF 456          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Xenopus
Match: dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:NCBI gene;Acc:448421])

HSP 1 Score: 313.153 bits (801), Expect = 2.542e-100
Identity = 193/466 (41.42%), Postives = 270/466 (57.94%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSSGCGNAGF 1530
             E  +  GN +Y++ +Y  A   YT AID     AS+Y NR+A  +ML +Y +A  DA++S  L+   +K   R GKC L+LG    A   FQK    +  N + +  L+    V        A  EK+D+R  +FC++R LE++P     K+ K E L  L RYP+A+ S+ S I +   +  N +ALY+RGLCLYY + ++KA   F   LK +PDH  A+ A R  K L   KEEGN   +   Y+ A  +Y++AL IDPN+ + NAKLY NR    +KL++  EA+ DC  A++LD  Y+KA  RR  C    + YEEA R+ EK+ +   + E+ +LLK  +L +K+SK+ D Y +LGV K+A+E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A++VLSD +KK  YDSG D++E                D   +F+AFFS   G  GF
Sbjct:    8 AEACKEKGNVFYAKKDYNEAYNYYTKAIDWSRKNASYYGNRAATLMMLSKYREALEDAQQSVRLDDAFVKGHQREGKCHLSLGNAMAATRCFQKVVELEPKNEQARKELKNAAAVLEYERIAEADFEKRDFRKVVFCMDRSLELAPACHRFKILKAECLALLGRYPDAQ-SVASDILRMDAT--NADALYVRGLCLYYEDCIEKAVQFFVQALKMAPDHQKARLACRNAKALKAKKEEGNQAFKDGNYDLAHRLYSEALCIDPNNIKTNAKLYCNRGTVNAKLKKLNEAIEDCTNAIKLDDTYIKAYLRRAQCYTDTELYEEAVRDYEKVYQTESTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSAATAEVQKEEEKKFKEVGEAFTVLSDAKKKARYDSGQDLEE--------DGLNMGDFDANNIFKAFFS---GPGGF 459          

HSP 2 Score: 51.9878 bits (123), Expect = 2.066e-6
Identity = 34/113 (30.09%), Postives = 56/113 (49.56%), Query Frame = 1
Query:  817 CKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSK 1155
            C++    KE+GN+      Y +A   YT+A++        NA  Y NR+ TL  L ++ EAL D  +++ LD  +VK   R   C + L     A R  +K+ +  P +E ++
Sbjct:    5 CQEAEACKEKGNVFYAKKDYNEAYNYYTKAIDWSRK----NASYYGNRAATLMMLSKYREALEDAQQSVRLDDAFVKGHQREGKCHLSLGNAMAATRCFQKVVELEPKNEQAR 113          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Xenopus
Match: dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:NCBI gene;Acc:448421])

HSP 1 Score: 313.153 bits (801), Expect = 4.524e-100
Identity = 193/466 (41.42%), Postives = 270/466 (57.94%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSSGCGNAGF 1530
             E  +  GN +Y++ +Y  A   YT AID     AS+Y NR+A  +ML +Y +A  DA++S  L+   +K   R GKC L+LG    A   FQK    +  N + +  L+    V        A  EK+D+R  +FC++R LE++P     K+ K E L  L RYP+A+ S+ S I +   +  N +ALY+RGLCLYY + ++KA   F   LK +PDH  A+ A R  K L   KEEGN   +   Y+ A  +Y++AL IDPN+ + NAKLY NR    +KL++  EA+ DC  A++LD  Y+KA  RR  C    + YEEA R+ EK+ +   + E+ +LLK  +L +K+SK+ D Y +LGV K+A+E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A++VLSD +KK  YDSG D++E                D   +F+AFFS   G  GF
Sbjct:   29 AEACKEKGNVFYAKKDYNEAYNYYTKAIDWSRKNASYYGNRAATLMMLSKYREALEDAQQSVRLDDAFVKGHQREGKCHLSLGNAMAATRCFQKVVELEPKNEQARKELKNAAAVLEYERIAEADFEKRDFRKVVFCMDRSLELAPACHRFKILKAECLALLGRYPDAQ-SVASDILRMDAT--NADALYVRGLCLYYEDCIEKAVQFFVQALKMAPDHQKARLACRNAKALKAKKEEGNQAFKDGNYDLAHRLYSEALCIDPNNIKTNAKLYCNRGTVNAKLKKLNEAIEDCTNAIKLDDTYIKAYLRRAQCYTDTELYEEAVRDYEKVYQTESTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSAATAEVQKEEEKKFKEVGEAFTVLSDAKKKARYDSGQDLEE--------DGLNMGDFDANNIFKAFFS---GPGGF 480          

HSP 2 Score: 51.9878 bits (123), Expect = 1.837e-6
Identity = 34/113 (30.09%), Postives = 56/113 (49.56%), Query Frame = 1
Query:  817 CKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSK 1155
            C++    KE+GN+      Y +A   YT+A++        NA  Y NR+ TL  L ++ EAL D  +++ LD  +VK   R   C + L     A R  +K+ +  P +E ++
Sbjct:   26 CREAEACKEKGNVFYAKKDYNEAYNYYTKAIDWSRK----NASYYGNRAATLMMLSKYREALEDAQQSVRLDDAFVKGHQREGKCHLSLGNAMAATRCFQKVVELEPKNEQAR 134          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Xenopus
Match: dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:NCBI gene;Acc:448421])

HSP 1 Score: 312.768 bits (800), Expect = 4.801e-100
Identity = 192/459 (41.83%), Postives = 268/459 (58.39%), Query Frame = 1
Query:  154 GNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSSGCGNAGF 1530
            GN +Y++ +Y  A   YT AID     AS+Y NR+A  +ML +Y +A  DA++S  L+   +K   R GKC L+LG    A   FQK    +  N + +  L+    V        A  EK+D+R  +FC++R LE++P     K+ K E L  L RYP+A+ S+ S I +   +  N +ALY+RGLCLYY + ++KA   F   LK +PDH  A+ A R  K L   KEEGN   +   Y+ A  +Y++AL IDPN+ + NAKLY NR    +KL++  EA+ DC  A++LD  Y+KA  RR  C    + YEEA R+ EK+ +   + E+ +LLK  +L +K+SK+ D Y +LGV K+A+E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A++VLSD +KK  YDSG D++E                D   +F+AFFS   G  GF
Sbjct:   18 GNVFYAKKDYNEAYNYYTKAIDWSRKNASYYGNRAATLMMLSKYREALEDAQQSVRLDDAFVKGHQREGKCHLSLGNAMAATRCFQKVVELEPKNEQARKELKNAAAVLEYERIAEADFEKRDFRKVVFCMDRSLELAPACHRFKILKAECLALLGRYPDAQ-SVASDILRMDAT--NADALYVRGLCLYYEDCIEKAVQFFVQALKMAPDHQKARLACRNAKALKAKKEEGNQAFKDGNYDLAHRLYSEALCIDPNNIKTNAKLYCNRGTVNAKLKKLNEAIEDCTNAIKLDDTYIKAYLRRAQCYTDTELYEEAVRDYEKVYQTESTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSAATAEVQKEEEKKFKEVGEAFTVLSDAKKKARYDSGQDLEE--------DGLNMGDFDANNIFKAFFS---GPGGF 462          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Xenopus
Match: dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:NCBI gene;Acc:448421])

HSP 1 Score: 312.768 bits (800), Expect = 7.238e-100
Identity = 192/462 (41.56%), Postives = 269/462 (58.23%), Query Frame = 1
Query:  145 RRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSSGCGNAGF 1530
            +  GN +Y++ +Y  A   YT AID     AS+Y NR+A  +ML +Y +A  DA++S  L+   +K   R GKC L+LG    A   FQK    +  N + +  L+    V        A  EK+D+R  +FC++R LE++P     K+ K E L  L RYP+A+ S+ S I +   +  N +ALY+RGLCLYY + ++KA   F   LK +PDH  A+ A R  K L   KEEGN   +   Y+ A  +Y++AL IDPN+ + NAKLY NR    +KL++  EA+ DC  A++LD  Y+KA  RR  C    + YEEA R+ EK+ +   + E+ +LLK  +L +K+SK+ D Y +LGV K+A+E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A++VLSD +KK  YDSG D++E                D   +F+AFFS   G  GF
Sbjct:   31 KEKGNVFYAKKDYNEAYNYYTKAIDWSRKNASYYGNRAATLMMLSKYREALEDAQQSVRLDDAFVKGHQREGKCHLSLGNAMAATRCFQKVVELEPKNEQARKELKNAAAVLEYERIAEADFEKRDFRKVVFCMDRSLELAPACHRFKILKAECLALLGRYPDAQ-SVASDILRMDAT--NADALYVRGLCLYYEDCIEKAVQFFVQALKMAPDHQKARLACRNAKALKAKKEEGNQAFKDGNYDLAHRLYSEALCIDPNNIKTNAKLYCNRGTVNAKLKKLNEAIEDCTNAIKLDDTYIKAYLRRAQCYTDTELYEEAVRDYEKVYQTESTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSAATAEVQKEEEKKFKEVGEAFTVLSDAKKKARYDSGQDLEE--------DGLNMGDFDANNIFKAFFS---GPGGF 478          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Mouse
Match: Dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:MGI Symbol;Acc:MGI:1928373])

HSP 1 Score: 325.094 bits (832), Expect = 9.883e-105
Identity = 183/431 (42.46%), Postives = 261/431 (60.56%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDE 1425
             E  +  GN YY++ +Y  A   YT AID  PN AS+Y NR+A  +ML R+ +A  DA++S  L+   ++  +R GKC L+LG    A  +FQ++   D  N++ Q   +    V           EK+D+R  +FC++R LE +P     K+ K E L  L RYPEA+     ++   +    N +ALY+RGLCLYY + ++KA   F   L+ +PDH  A  A R  K L   KE+GN   +   Y+ A E+YT+AL IDPN+ + NAKLY NR    SKL +  +A+ DC  A++LD  Y+KA  RR  C +  +++EEA R+ EK+ +   + E+ +LLK  +L +K+SK+ D Y +LGV K+A+E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A+++LSDP+KK  YDSG D+DE
Sbjct:   28 AESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPNNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAEVDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQFVASDILRMDS---TNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACVACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDE 455          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Mouse
Match: Dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:MGI Symbol;Acc:MGI:1928373])

HSP 1 Score: 165.236 bits (417), Expect = 1.473e-46
Identity = 101/282 (35.82%), Postives = 140/282 (49.65%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSK 978
             E  +  GN YY++ +Y  A   YT AID  PN AS+Y NR+A  +ML R+ +A  DA++S  L+       VR       + Y   AE+ F                                  EK+D+R  +FC++R LE +P     K+ K E L  L RYPEA+     ++   +    N +ALY+RGLCLYY + ++KA   F   L+ +PDH  A  A R  K L   KE+GN   +   Y+ A E+YT+AL IDPN+ + NAKLY NR    SK
Sbjct:   19 AESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPNNASYYGNRAATLMMLGRFREALGDAQQSVRLDDS----FVRFKNANAVMEYEKIAEVDF----------------------------------EKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQFVASDILRMDS---TNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACVACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSK 259          

HSP 2 Score: 50.0618 bits (118), Expect = 2.959e-6
Identity = 39/126 (30.95%), Postives = 59/126 (46.83%), Query Frame = 1
Query:  835 LKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKY----------PSDENSKLLKQTKLAM 1182
             KE+GN       Y +A   YT+A+++ PN    NA  Y NR+ TL  L R+ EAL D  +++ LD  +V+   +  N ++  ++  E D E     K            P+    K+LK   LAM
Sbjct:   22 FKEQGNAYYAKKDYNEAYNYYTKAIDMCPN----NASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVR--FKNANAVMEYEKIAEVDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAM 141          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Mouse
Match: Dnajc3 (DnaJ heat shock protein family (Hsp40) member C3 [Source:MGI Symbol;Acc:MGI:107373])

HSP 1 Score: 129.798 bits (325), Expect = 1.054e-31
Identity = 130/476 (27.31%), Postives = 219/476 (46.01%), Query Frame = 1
Query:  136 EEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSN-LEKLVVVKNGIDQFRAQK----EKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSK-LLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSSGCGNAGFKMNFH 1545
            E+H   G K  + G    AL  + AA+D +P+    Y  R+ V L + +   A  D  K   L+ D     ++ G   L  G  +EAE  F+K     SN SE +    E  +V  + + + R+Q     +  DY  A+  +++ LE+     EL+  + E  I      +A   L++  +  +D   NTEA Y      Y +   + + S  +  LK   DH      Y++ KKL++L E    L+R  +Y  A   Y   ++ +P+  E   +         SK E+  EA+  C + L+++P  V A+  R    +  + Y+EA ++ E   +   +D+  +  L++ +  +K+S++ D Y +LGV ++A + EI K YRK AL  HPD  +  +E  +   E+KF ++  A  VLSDP  ++ +D G D  +       GG+      +  + F  F S G     F+  FH
Sbjct:   38 EKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIALKMDFTAARLQRGHLLLKQGKLDEAEDDFKK--VLKSNPSEQEEKEAESQLVKADEMQRLRSQALDAFDGADYTAAITFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASKLKSD---NTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSVAEYTVRSKERICHCFSKDEKPVEAIRICSEVLQMEPDNVNALKDRAEAYLIEEMYDEAIQDYEAAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPD--NFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHRSWNSWQGFNPFSSGG----PFRFKFH 502          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Mouse
Match: Dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:MGI Symbol;Acc:MGI:1928373])

HSP 1 Score: 80.8777 bits (198), Expect = 1.336e-17
Identity = 47/136 (34.56%), Postives = 72/136 (52.94%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALF 540
             E  +  GN YY++ +Y  A   YT AID  PN AS+Y NR+A  +ML R+ +A  DA++S  L+   ++  +R GKC L+LG    A  +FQ++   D  N++ Q   +    V           EK+D+R  +F
Sbjct:   12 AESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPNNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAEVDFEKRDFRKVVF 147          

HSP 2 Score: 55.8398 bits (133), Expect = 6.465e-9
Identity = 32/91 (35.16%), Postives = 48/91 (52.75%), Query Frame = 1
Query:  811 RRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGL 1083
            RR ++    KE+GN       Y +A   YT+A+++ PN    NA  Y NR+ TL  L R+ EAL D  +++ LD  +V+   R   C + L
Sbjct:    7 RRSREAESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPN----NASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSL 93          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Mouse
Match: Sgtb (small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta [Source:MGI Symbol;Acc:MGI:2444615])

HSP 1 Score: 73.1738 bits (178), Expect = 1.325e-14
Identity = 42/107 (39.25%), Postives = 61/107 (57.01%), Query Frame = 1
Query:  781 PDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEA 1101
            P+ VG         K  QLK+EGN  ++   Y  A + YTQA+E+DPN    NA  Y NR+   SKL  + +A+ DC+KA+ +D +Y KA  R    L  ++++EEA
Sbjct:   79 PEDVG---------KADQLKDEGNNHMKEENYAAAVDCYTQAIELDPN----NAVYYCNRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEA 172          

HSP 2 Score: 52.373 bits (124), Expect = 1.898e-7
Identity = 28/92 (30.43%), Postives = 48/92 (52.17%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITF 408
             ++ +  GN +  + NY AA++ YT AI+ +PN A +Y NR+A    L  Y DA  D +K+  ++    K   R+G     +  + EA  ++
Sbjct:   85 ADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSY 176          
BLAST of DnaJ homolog subfamily C member 7 vs. UniProt/SwissProt
Match: sp|Q9QYI3|DNJC7_MOUSE (DnaJ homolog subfamily C member 7 OS=Mus musculus OX=10090 GN=Dnajc7 PE=1 SV=2)

HSP 1 Score: 325.094 bits (832), Expect = 6.913e-104
Identity = 183/431 (42.46%), Postives = 261/431 (60.56%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDE 1425
             E  +  GN YY++ +Y  A   YT AID  PN AS+Y NR+A  +ML R+ +A  DA++S  L+   ++  +R GKC L+LG    A  +FQ++   D  N++ Q   +    V           EK+D+R  +FC++R LE +P     K+ K E L  L RYPEA+     ++   +    N +ALY+RGLCLYY + ++KA   F   L+ +PDH  A  A R  K L   KE+GN   +   Y+ A E+YT+AL IDPN+ + NAKLY NR    SKL +  +A+ DC  A++LD  Y+KA  RR  C +  +++EEA R+ EK+ +   + E+ +LLK  +L +K+SK+ D Y +LGV K+A+E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A+++LSDP+KK  YDSG D+DE
Sbjct:   28 AESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPNNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAEVDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQFVASDILRMDS---TNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACVACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDE 455          
BLAST of DnaJ homolog subfamily C member 7 vs. UniProt/SwissProt
Match: sp|Q5R8D8|DNJC7_PONAB (DnaJ homolog subfamily C member 7 OS=Pongo abelii OX=9601 GN=DNAJC7 PE=2 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 2.451e-103
Identity = 197/478 (41.21%), Postives = 279/478 (58.37%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFF---------SSGCGNAGFKMN 1539
             E  +  GN YY++ +Y  A   YT AID  P  AS+Y NR+A  +ML R+ +A  DA++S  L+   ++  +R GKC L+LG    A  +FQ++   D  N++ Q   +    V           EK+D+R  +FC++R LE +P     K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + ++KA   F   L+ +PDH  A  A R  K L   KE+GN   +   Y+ A E+YT+AL IDPN+ + NAKLY NR    SKL +  +A+ DC  A++LD  Y+KA  RR  C +  ++YEEA R+ EK+ +   + E+ +LLK  +L +K+SK+ D Y +LGV K+A+E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A+++LSDP+KK  YDSG D+DE          +     DP  +F+AFF         +SG GN  F+  
Sbjct:   28 AETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGRLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQ-SVASDILRMDST--NADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKSAQLELKKSKRRDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDE--------EGTNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG 494          
BLAST of DnaJ homolog subfamily C member 7 vs. UniProt/SwissProt
Match: sp|Q99615|DNJC7_HUMAN (DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7 PE=1 SV=2)

HSP 1 Score: 323.168 bits (827), Expect = 4.565e-103
Identity = 197/478 (41.21%), Postives = 278/478 (58.16%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFF---------SSGCGNAGFKMN 1539
             E  +  GN YY++ +Y  A   YT AID  P  AS+Y NR+A  +ML R+ +A  DA++S  L+   ++  +R GKC L+LG    A  +FQ++   D  N++ Q   +    V           EK+D+R  +FC++R LE +P     K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + ++KA   F   L+ +PDH  A  A R  K L   KE+GN   +   Y+ A E+YT+AL IDPN+ + NAKLY NR    SKL +  +A+ DC  A++LD  Y+KA  RR  C +  ++YEEA R+ EK+ +   + E+ +LLK  +L +K+SK+ D Y +LGV K+A+E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A+++LSDP+KK  YDSG D+DE                DP  +F+AFF         +SG GN  F+  
Sbjct:   28 AETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQ-SVASDILRMDST--NADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDE--------EGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG 494          
BLAST of DnaJ homolog subfamily C member 7 vs. UniProt/SwissProt
Match: sp|Q54IP0|DNJC7_DICDI (DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum OX=44689 GN=dnajc7 PE=1 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 7.191e-75
Identity = 154/434 (35.48%), Postives = 244/434 (56.22%), Query Frame = 1
Query:  136 EEHRRNGNKYYSQGNYKAALESYTAAID-TEPNVASFYNNRSAVNLML---YRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKL---LKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVD 1416
            EE +  GN Y+ Q  Y  A+  YT AI+ +   +A++Y NR+A  L +       D+  D+ K+ ELE   IK   R  K  ++L  +++A     +   +D  N+E+     ++  ++  I     +K   +   +L  +E  L  S  + +L++ K  +LI LK+YP+A   + +++++  DS  N E LY+RGL LYY  +   A  HFQ+ L   PD+  ++ A +R + +   K+EGN   ++  Y+ A + +T+AL IDP  + +N++LY NR+  L  L R  EA++DC  A+ +DP Y KA  RR  C +  + YE+A R+ EK     P  EN +L   +K+ K+A K+S + D Y +LGV K A E+EIKK YRK AL +HPD+++   E  +   E+ FK++  AYSVLSD +KK+ YD G D
Sbjct:    4 EECKTQGNNYFKQSQYMDAIRCYTQAIELSNGTIAAYYGNRAAAYLAICTKSSLQDSIKDSLKAIELERSFIKGYTRASKAYIHLAQYDQAASIIVRGLVFDPRNNELLQEKNQIDSIQRTISSLTKEKALSNPSSSLNQIENVLSQSKYNTQLQVLKARVLIELKQYPQASNLMTTLLQE--DSR-NPEYLYVRGLSLYYQNNFPLALQHFQNSLTYDPDYSESRVALKRLRSIESKKKEGNEYFQSKNYQAAYDSFTEALSIDPKLETMNSQLYSNRAAALVHLNRISEAINDCTSAVTIDPNYGKAYIRRAQCQMKQENYEDAVRDYEKAQSLDP--ENGELQRNIKEAKIAHKKSLRKDYYKILGVSKEAGETEIKKAYRKLALQYHPDKNNQLPEEEKAQAEKMFKDIGEAYSVLSDEKKKRQYDMGQD 432          
BLAST of DnaJ homolog subfamily C member 7 vs. UniProt/SwissProt
Match: sp|Q9HGM9|DNJC7_SCHPO (DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC543.02c PE=4 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 2.104e-61
Identity = 153/475 (32.21%), Postives = 238/475 (50.11%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAID--TEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKS------TCYDSNNSEIQSNLE----------KLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKL-LKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAF 1500
             E+ +  GN +Y +  Y  A+++YT AID  ++  +A +Y+NR+A  + +  +  A  DAK+S  ++PD  K   R+ +    L   NEAE+  +           D     I S  +          ++ + +N +D  RAQK   D           L ++P + E                                     AL LRG  +YY     KA +HFQ  LK  PD   A+  +++ +KL   K +GN L R   Y+ A E Y++AL+IDP++ E  AKLY NR+  L +L+R  EALSD D AL +D  Y+K +  R      L+++EEA R+ +   +   SD N +  L++ +L +K+SK+ D Y +LGV K A + EIKK YRK AL++HPD+++   EA     E +FKEV  AY++LSDP  ++ +DSGVD++  +         G  G DP ++ +A+
Sbjct:   23 AEKQKAIGNAFYKEKKYAEAIKAYTEAIDLGSDSALAIYYSNRAATYMQIGEFELALCDAKQSDRIKPDVPKTQSRIRQAYEGLSILNEAEVYLKNKQAGLALNALDRLQRRIDSTTQPPMSWMYLKAQVYIFQNDMD--RAQKIAHD----------VLRLNPKNVE-------------------------------------ALVLRGKVMYYSGENAKAITHFQEALKLDPDCTTAKTLFKQVRKLENTKNQGNDLFRQGNYQDAYEKYSEALQIDPDNKETVAKLYMNRATVLLRLKRPEEALSDSDNALAIDSSYLKGLKVRAKAHEALEKWEEAVRDVQSAIELDASDANLRQELRRLQLELKKSKRKDHYKILGVSKEATDIEIKKAYRKLALVYHPDKNAGNLEA-----EARFKEVGEAYTILSDPESRRRFDSGVDLEPGM--------EGGAGMDPFDILRAY 435          
BLAST of DnaJ homolog subfamily C member 7 vs. TrEMBL
Match: A0A4S2LCN8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008198 PE=4 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 1.199e-117
Identity = 194/426 (45.54%), Postives = 271/426 (63.62%), Query Frame = 1
Query:  136 EEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGV 1413
            EE++ NGN  Y +  Y  A+E YT AI+ + + A  Y+NR+A  LML RY +AF DA KS +L P   K L+R  KC + LG   +A          D  N+E  S   +L +++   + +  Q    D R+AL  + +C++++PGS +  L K++LLI LKR  EAK  +E++++      A+ E LY RGLCL+Y++HLDKA SHFQHVL+  PDH   QQ+++RCK L +LK+EGN  +   +Y KA E YT AL IDP HD +NAKL  NR+     L ++  AL DC++A+ LDP YV+A  RR  C   L+ Y++A  E   +    PSDE+ + L+  K  + RSK+++ Y VLGV K+A+  EIK+ Y+K AL HHPDRH+HAD+ATR  +EQKFKEV  AYSVLSDP+K+Q YD G+
Sbjct:    9 EEYKTNGNSAYQKACYDEAVEWYTKAINVDGSNALLYSNRAAAYLMLTRYQEAFQDASKSVDLNPQYCKALIRYVKCCICLGKVEDARRVCSLIRELDPINTEFSSQAHQLDLLQQTYESYEHQLTIPDLRYALHLINKCIDMAPGSLDYNLKKVDLLIRLKRVSEAKRHVEAILKVHP---ASVEVLYYRGLCLFYLDHLDKAVSHFQHVLRLHPDHTETQQSFKRCKTLLRLKDEGNRYIHERRYSKAYETYTDALTIDPLHDAMNAKLLCNRACAGYNLGKYETALEDCNQAIALDPSYVRAHLRRAKCYSSLEMYDKAVEEWTAVVNMDPSDEHKQGLQMAKRELARSKEINYYKVLGVKKNASSDEIKQAYKKLALQHHPDRHTHADDATRQEQEQKFKEVGEAYSVLSDPQKRQQYDCGM 431          

HSP 2 Score: 66.2402 bits (160), Expect = 1.130e-7
Identity = 43/122 (35.25%), Postives = 67/122 (54.92%), Query Frame = 1
Query:  826 LSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEAD------REAEKLNKKYPSDENS-KLLKQT 1170
            + + K  GN   +   Y++A E YT+A+ +D +    NA LY NR+     L R+ EA  D  K+++L+PQY KA+ R V C I L + E+A       RE + +N ++ S  +   LL+QT
Sbjct:    8 VEEYKTNGNSAYQKACYDEAVEWYTKAINVDGS----NALLYSNRAAAYLMLTRYQEAFQDASKSVDLNPQYCKALIRYVKCCICLGKVEDARRVCSLIRELDPINTEFSSQAHQLDLLQQT 125          
BLAST of DnaJ homolog subfamily C member 7 vs. TrEMBL
Match: G7Y570 (DnaJ homolog subfamily C member 7 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_101183 PE=4 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 2.133e-117
Identity = 192/426 (45.07%), Postives = 270/426 (63.38%), Query Frame = 1
Query:  136 EEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGV 1413
            EE++ NGN  + +  Y  A+E YT AI+ + + A  Y+NR+A  LML RY +AF DA KS +L P   K L+R  KC + LG   +A          D  N+E  S   +L +++   + +  Q    D R+AL  + +C++++PGS +  L  ++LLI LKR  EAK  +E+++       A+ E LY RGLCL+Y++HLDKA SHFQHVL+  PDH   QQ+++RCK L +LK+EGN  +   +Y KA E YT AL +DP HD +NAKL  NR+     + ++  AL DC++A+ LDP YV+A  RR  C   L+ Y++A  E   +    PSDE+ + L+  K  + RSK+++ Y VLGV KSA+  EIK+ Y+K AL HHPDRH+HAD+ATR  +EQKFKEV  AYSVLSDP+K+Q YDSG+
Sbjct:    9 EEYKTNGNSAHQKACYDEAVEWYTKAINVDGSNALLYSNRAAAYLMLTRYQEAFQDASKSVDLNPQYCKGLIRYVKCCICLGKVADARRVCSLIRELDPTNTEFSSQAHQLDLLQQTYESYEHQLTIPDLRYALHLINKCIDMAPGSLDYNLKMVDLLIRLKRVSEAKRHVEAILRAHP---ASVEVLYYRGLCLFYLDHLDKAVSHFQHVLRLHPDHTETQQSFKRCKTLLRLKDEGNRYIHERRYSKAYETYTDALTVDPLHDAMNAKLLCNRACAGYNVRKYETALEDCNQAIALDPSYVRAHLRRAKCYSSLEMYDKAVEEWTAVVNMDPSDEHKQGLQMAKRELARSKEINYYKVLGVKKSASSDEIKQAYKKLALQHHPDRHTHADDATRQEQEQKFKEVGEAYSVLSDPQKRQQYDSGM 431          

HSP 2 Score: 60.077 bits (144), Expect = 7.909e-6
Identity = 41/122 (33.61%), Postives = 64/122 (52.46%), Query Frame = 1
Query:  826 LSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEAD------REAEKLNKKYPSDENS-KLLKQT 1170
            + + K  GN   +   Y++A E YT+A+ +D +    NA LY NR+     L R+ EA  D  K+++L+PQY K + R V C I L +  +A       RE +  N ++ S  +   LL+QT
Sbjct:    8 VEEYKTNGNSAHQKACYDEAVEWYTKAINVDGS----NALLYSNRAAAYLMLTRYQEAFQDASKSVDLNPQYCKGLIRYVKCCICLGKVADARRVCSLIRELDPTNTEFSSQAHQLDLLQQT 125          
BLAST of DnaJ homolog subfamily C member 7 vs. TrEMBL
Match: A0A5J4NQM6 (DnaJ subfamily C member 7 (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0013827 PE=4 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 3.995e-116
Identity = 189/426 (44.37%), Postives = 279/426 (65.49%), Query Frame = 1
Query:  136 EEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGV 1413
            E ++ +GN  Y +G Y+ A+  YT AID +   A  YNNRSA  LML +Y +AF DA KS +L P N K L+R  KC ++LG  ++A+         +  N ++ S L ++ +++     F  Q    D R A   + +C+EI+PGS    L +++LLI LKR+ EAK+ +E+++ KT +  A+ + LY RGLCL+Y++HLDKA SHFQHVL+  PD++ AQ++++R K L +LKEEGN  +   ++ +A E YT+AL IDP HD +NAKL  NR+     LE++  AL DCD A+ELD  Y+KA  RR  C   L+ +++A  E  K+ +  P++E+ + ++  + A+ RSK++D Y VLGV ++A+  EIK+ Y+K AL HHPDRH+HAD+ T+  +E KFKE+  AYSVLSD +K+QMYDSGV
Sbjct:   10 ESYKASGNLSYQKGAYQDAISWYTKAIDEDAGNALLYNNRSAAYLMLNKYSEAFQDASKSVQLNPTNCKALMRYVKCCISLGKLDQAKHACTTIRRLEPQNPDLLSQLHQIDLLQQTYHYFEKQLAIPDLRFAYHMITKCIEIAPGSLNYGLKQVDLLIKLKRFTEAKLRVEALL-KTNE--ASPDILYYRGLCLFYLDHLDKAVSHFQHVLRLHPDNLEAQKSFKRAKTLLRLKEEGNRYIHERRFSRADETYTEALTIDPLHDPMNAKLLCNRACARYNLEKFEAALQDCDHAIELDSAYLKAYVRRARCYTALELHDKAVEEWSKVVQMSPTNEHKQGMRAAEQALARSKEIDYYKVLGVKRNASFDEIKQAYKKCALQHHPDRHTHADDVTKQEQEHKFKEIGEAYSVLSDSQKRQMYDSGV 432          
BLAST of DnaJ homolog subfamily C member 7 vs. TrEMBL
Match: A0A419Q135 (DnaJ-like protein subfamily C member 7 OS=Clonorchis sinensis OX=79923 GN=Dnajc7 PE=4 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 5.739e-116
Identity = 193/426 (45.31%), Postives = 270/426 (63.38%), Query Frame = 1
Query:  136 EEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGV 1413
            EE++ NGN  + +  Y  A+E YT AI+ + + A  Y+NR+A  LML RY +AF DA KS +L P   K L+R  KC + LG   +A          D  N+E  S   +L +++   + +  Q    D R+AL  + +C++++PGS +  L  ++LLI LKR  EAK  +E+++       A+ E LY RGLCL+Y++HLDKA SHFQHVL+  PDH   QQ+++RCK L +LK+EGN  +   +Y KA E YT AL +DP HD +NAKL  NR+     L ++  AL DC++A+ LDP YV+A  RR  C   L+ Y++A  E   +    PSDE+ + L+  K  + RSK+++ Y VLGV KSA+  EIK+ Y+K AL HHPDRH+HAD+ATR  +EQKFKEV  AYSVLSDP+K+Q YDSG+
Sbjct:    9 EEYKTNGNSAHQKACYDEAVEWYTKAINVDGSNALLYSNRAAAYLMLTRYQEAFQDASKSVDLNPQYCKGLIRYVKCCICLGKVADARRVCSLIRELDPTNTEFSSQAHQLDLLQQTYESYEHQLTIPDLRYALHLINKCIDMAPGSLDYNLKMVDLLIRLKRVSEAKRHVEAILRAHP---ASVEVLYYRGLCLFYLDHLDKAVSHFQHVLRLHPDHTETQQSFKRCKTLLRLKDEGNRYIHERRYSKAYETYTDALTVDPLHDAMNAKLLCNRACAGYNLGKYETALEDCNQAIALDPSYVRAHLRRAKCYSSLEMYDKAVEEWTAVVNMDPSDEHKQGLQMAKRELARSKEINYYKVLGVKKSASSDEIKQAYKKLALQHHPDRHTHADDATRQEQEQKFKEVGEAYSVLSDPQKRQQYDSGM 431          
BLAST of DnaJ homolog subfamily C member 7 vs. TrEMBL
Match: A0A3Q0KMX6 (DNAj homolog subfamily C member, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 2.339e-115
Identity = 191/426 (44.84%), Postives = 270/426 (63.38%), Query Frame = 1
Query:  136 EEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANT-EALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSG 1410
            EE++  GN  Y QG Y  A+  YT  ID +      YNNRSA  LM+ + LDA+ DA +S  L+  N+K ++R  KC L LG  NEA+         +  N+E  S L+K+ ++      +  +    D+RHAL  + +C+E++P S    L ++ +LI LKR+ EAK    S++E    SH+++ + L+ RGLCLYY++HLDKA  HFQHVL+  PDH+  Q+AY+R K L + KEEGN  +   KY +A E YT+AL++DP+HD +NAKLY NR+  L  L+R+ EAL+DCD A+ L+P Y+KA  RR  C   L+ YE+A  E   + K   S EN K L+  K A+  S Q D Y +LG+ K+A+  +IK+ YRK ALL+HPDRH+ ADEAT   +E+KFKE+  AYS+LSDP K++ YD+G
Sbjct:   14 EEYKNQGNSCYKQGMYNEAIAWYTKGIDIDSTNVFLYNNRSAAYLMINKPLDAYKDASRSISLDSQNVKSILRGLKCCLILGDLNEAKRLCSMVRQLEPTNTEFSSLLQKIELLSETHRSYEDKLSTSDFRHALHLITKCIELAPASLSFNLQRLNILIQLKRFTEAK----SLVENLLHSHSSSVDLLFYRGLCLYYLDHLDKATIHFQHVLRLHPDHIETQKAYKRAKNLLKFKEEGNTFIHDHKYSQALEAYTKALKVDPSHDMINAKLYCNRACALFYLDRFEEALNDCDNAISLEPNYLKARIRRAKCYSSLEEYEKAVEEWTAVVKLDGSRENKKSLQAAKSALSVS-QRDYYKILGLKKNASSDDIKQAYRKSALLYHPDRHTSADEATVKEKERKFKEIGEAYSILSDPVKRRQYDNG 434          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Cavefish
Match: dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:NCBI gene;Acc:103043863])

HSP 1 Score: 318.161 bits (814), Expect = 5.707e-102
Identity = 185/431 (42.92%), Postives = 264/431 (61.25%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDE 1425
             E ++  GN +Y +  Y  A   YT AID  P  AS+Y NR+A  +ML RY +A  D++++  L+   ++  +R GKC L+LG    A   FQK    + +NS+ Q  L+    +           +K+D+R  +FC++R LE +      K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + +DKA   F   L+ +PDH  A+ A R  K L   KEEGN   +   +E+A ++Y++AL IDPN+ + NAKLY NR+   SKL++  +A+ DC KA++LD  Y+KA  RR  C +  ++YEEA R+ EK+ +   + E+  LLK  +L +K+SK+ D Y VLGV KSA E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A++VLSDP+KK  YDSG D+++
Sbjct:   41 AEGYKEQGNAFYIKKEYSEAFNYYTKAIDVCPKNASYYGNRAATLMMLSRYREALEDSQQAVRLDDTFVRGHLREGKCHLSLGNAMAASRCFQKVLELEPDNSQAQQELKNAESILEYERMAEIGFDKRDFRMVVFCMDRALESASACHRFKVLKAECLALLGRYPEAQ-SVASDILRMDAT--NGDALYVRGLCLYYEDCIDKAVQFFIQALRMAPDHEKARLACRNAKALKAKKEEGNRAFKEGNFEEAYDLYSEALTIDPNNIKTNAKLYCNRATVGSKLKKLEQAIEDCTKAIKLDESYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKHLLKTAQLELKKSKRKDYYKVLGVDKSATEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTVLSDPKKKSRYDSGHDLED 468          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Cavefish
Match: dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:NCBI gene;Acc:103043863])

HSP 1 Score: 318.161 bits (814), Expect = 5.733e-102
Identity = 185/431 (42.92%), Postives = 264/431 (61.25%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDE 1425
             E ++  GN +Y +  Y  A   YT AID  P  AS+Y NR+A  +ML RY +A  D++++  L+   ++  +R GKC L+LG    A   FQK    + +NS+ Q  L+    +           +K+D+R  +FC++R LE +      K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + +DKA   F   L+ +PDH  A+ A R  K L   KEEGN   +   +E+A ++Y++AL IDPN+ + NAKLY NR+   SKL++  +A+ DC KA++LD  Y+KA  RR  C +  ++YEEA R+ EK+ +   + E+  LLK  +L +K+SK+ D Y VLGV KSA E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A++VLSDP+KK  YDSG D+++
Sbjct:   41 AEGYKEQGNAFYIKKEYSEAFNYYTKAIDVCPKNASYYGNRAATLMMLSRYREALEDSQQAVRLDDTFVRGHLREGKCHLSLGNAMAASRCFQKVLELEPDNSQAQQELKNAESILEYERMAEIGFDKRDFRMVVFCMDRALESASACHRFKVLKAECLALLGRYPEAQ-SVASDILRMDAT--NGDALYVRGLCLYYEDCIDKAVQFFIQALRMAPDHEKARLACRNAKALKAKKEEGNRAFKEGNFEEAYDLYSEALTIDPNNIKTNAKLYCNRATVGSKLKKLEQAIEDCTKAIKLDESYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKHLLKTAQLELKKSKRKDYYKVLGVDKSATEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTVLSDPKKKSRYDSGHDLED 468          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Cavefish
Match: ENSAMXT00000022001.2 (dnaJ homolog subfamily C member 7-like [Source:NCBI gene;Acc:103035736])

HSP 1 Score: 311.612 bits (797), Expect = 1.860e-99
Identity = 190/469 (40.51%), Postives = 271/469 (57.78%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSSGCGNAGFKMN 1539
             E  +  GN +Y + +Y  A   YT AID  P  AS+Y NR+A  +ML R+ +A  D++++  L+    K  +R GKC L+LG    A   FQK    D  N++     +    +           EK+D+R  +FC++R LE +    + K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + ++KA   F   L+ +PDH  A+ A R  K L   KEEGN   +   Y+ A ++Y++AL IDPN+ + NAKLY NR+    KL +  +A+ DC  A++LD  Y+KA  RR  C + +++YEEA R+ EK+     + E+  LLK  +L +K+SK+ D Y VLGV K+A E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A++VLSDP+KK  YDSG D+++ +         G    D   +F+AFF  G  N  F+ N
Sbjct:   38 AETFKEKGNAFYVKKDYSEAFNYYTKAIDASPKNASYYGNRAATLMMLSRFREALEDSQQAVRLDECFTKGHLREGKCHLSLGNAMAASRCFQKVLELDPTNTQALQEHKNAAALLEYEKMAEFGFEKRDFRKVVFCMDRALEFAGACHKFKIMKAECLALLGRYPEAQ-SVASDILRMDST--NADALYVRGLCLYYEDCIEKAVQFFIQALRMAPDHEKARLACRNAKALKAKKEEGNNAFKDRDYDAAYQLYSEALTIDPNNIKTNAKLYCNRATAGVKLNKREQAIEDCSSAIKLDESYIKAYLRRAQCYMDMEQYEEAVRDYEKVYHTEKTKEHKTLLKTAQLELKKSKRKDYYKVLGVNKAATEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTVLSDPKKKSRYDSGQDLEDDM---------GMGDFDANNIFKAFF-GGPQNFSFESN 493          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Cavefish
Match: dnajc3a (DnaJ heat shock protein family (Hsp40) member C3 [Source:NCBI gene;Acc:103030310])

HSP 1 Score: 142.51 bits (358), Expect = 3.150e-36
Identity = 128/474 (27.00%), Postives = 210/474 (44.30%), Query Frame = 1
Query:  136 EEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQ---KSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSK-LLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSSGCGNAGFKMNFH 1545
            E+H   G K  + G    AL  +  A+D +P     Y  R+ V L + +   A  D  K  EL+PD     ++ G   L  G  ++AE  F+   KS+       E Q+ L+K   ++  + Q R    + DY  A   ++  +E      + +  + E  I L    +A   L++  +   D   NT+A Y      Y +   + + +  +  LK  PDH      Y+R KKL++L      L++  +Y +A   Y   ++ DPN  +            LSK ++  +A+  C + L+ DP+ V A+  R    +  ++YEEA ++ E       +D+  K  L + +  +K+S++ D Y +LGV ++A + EI K YRK A   HPD  +  D   +   E+KF ++  A  VL+DP  +  +D G D  +       G     H     E FQ F   G G   FK  F+
Sbjct:   38 EQHLEMGKKLLAAGQLADALSHFHTAVDGDPKNYMAYYRRATVYLAMGKSKSALPDLSKVIELKPDFTSARLQRGNLLLKQGKLDDAESDFKKVLKSSPSSREEQEAQNQLKKSDEIQRLVTQARNDFSRNDYGPAASHLDIIIETCAWDVDSREMRAECFIKLGEMGKAISDLKAASKLRND---NTQAFYKLSTIYYNLGDHEMSLNEVRECLKLDPDHPQCFSHYKRVKKLNKLILSAEELIQQQRYGEAVSKYESVMKSDPNVPQYALLAKERICHCLSKDQQGAQAIPVCSEVLKSDPENVNALKDRAEAYLQDEQYEEAIKDFESAKMHSENDQEIKEGLDRAQRLLKQSQKRDYYKILGVKRTAQKKEIIKAYRKLAQQWHPD--NFQDPEDKKKAEKKFIDIAQAKEVLTDPEMRSKFDQGEDPLDPESQQGGGHHHHHHFRGGWESFQGFNPFGSGPFNFKFGFN 506          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Cavefish
Match: dnajc3b (dnaJ homolog subfamily C member 3-like [Source:NCBI gene;Acc:103042161])

HSP 1 Score: 128.642 bits (322), Expect = 1.520e-31
Identity = 115/430 (26.74%), Postives = 199/430 (46.28%), Query Frame = 1
Query:  136 EEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEAD---REAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVD 1416
            E+H   G K  + G    AL  Y +A++ +      Y  R+AV L + +   A  D  ++ +L+PD +   ++ G   L  G   EA   F+       +  E ++ L K   ++   ++      + DY   +  ++  +E+SP   E +  + E  I L    +A + L       TD+ A    L L  L     EH D + S  +  LK   D       Y++ KKLS+  +    L+   +Y++A + Y   ++ +P       K       +L K++   +AL  C +A + DPQ +  +  R    I L  YE+A    +EA + +++  + E  + L + +  +K S++ D Y +LGV +SAN+ EI K YRK A   HPD  +   E+ +   E++F ++ +A  VL+DP  +Q +DSG D
Sbjct:   40 EQHLEMGRKLLAAGQLAEALSHYHSAVEGDSKNYLTYYKRAAVFLAMGKSKSALPDLTRAIQLKPDFLAARIQRGNILLKQGNTQEAREDFEAVLQRSPDQEEARNQLHKAEELEELQEEAHKAHHRGDYTSTIQVLDHVIELSPWDPESREMRAECYIRLGEPRKAILDLTPAARLRTDNRAAF--LKLSRLLYDLGEHRD-SLSEIRECLKLDQDDKECFAHYKQVKKLSKQMDSAEELISEQRYQEAIDKYESVMKTEPKITFYTTKAKERICFSLVKIKEAEKALDTCSEAHQRDPQNIHILRDRAEAYILLQDYEKAVEDYQEAREFDQE--NQEIREGLDRAQKLLKLSRKRDYYKILGVSRSANKQEIIKAYRKLAQQWHPD--NFQSESEKKEAEKRFIDIASAKEVLTDPEMRQKFDSGED 462          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Sea Lamprey
Match: dnajc5aa (DnaJ (Hsp40) homolog, subfamily C, member 5aa [Source:ZFIN;Acc:ZDB-GENE-031113-20])

HSP 1 Score: 63.5438 bits (153), Expect = 4.056e-12
Identity = 33/66 (50.00%), Postives = 43/66 (65.15%), Query Frame = 1
Query: 1207 YAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYD 1404
            Y VLG+ K A   EIKK YRK AL +HPD++    EA      +KFKE+NNA  +LSD +K+ +YD
Sbjct:   18 YIVLGLQKGATADEIKKSYRKLALKYHPDKNPDNPEAV-----EKFKEINNANGILSDLKKRNIYD 78          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005772.1 (pep scaffold:Pmarinus_7.0:GL478792:23408:39519:-1 gene:ENSPMAG00000005227.1 transcript:ENSPMAT00000005772.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.698e-11
Identity = 35/95 (36.84%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  838 KEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKL 1122
            K++GN   +T  Y+ A + YT+ +E DP+    NA L  NR++   KL+++  A SDC+ A++LDP Y KA +RR    + L++ +EA  + E +
Sbjct:   18 KDKGNEYFKTGDYDAANDCYTRGMEADPH----NALLPANRAMAFLKLKKYELAESDCNLAIQLDPSYPKAFARRGAARLALNKLKEAREDFEAV 108          

HSP 2 Score: 55.4546 bits (132), Expect = 1.871e-8
Identity = 32/105 (30.48%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  154 GNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKL 468
            GN+Y+  G+Y AA + YT  ++ +P+ A    NR+   L L +Y  A +D   + +L+P   K   R G  +L L    EA   F+    +D  N +  + L+K+
Sbjct:   21 GNEYFKTGDYDAANDCYTRGMEADPHNALLPANRAMAFLKLKKYELAESDCNLAIQLDPSYPKAFARRGAARLALNKLKEAREDFEAVLTFDPVNKQAIAELKKI 125          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Sea Lamprey
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:HGNC Symbol;Acc:HGNC:14885])

HSP 1 Score: 63.929 bits (154), Expect = 3.350e-11
Identity = 38/102 (37.25%), Postives = 57/102 (55.88%), Query Frame = 1
Query: 1207 YAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSSG 1512
            Y  LGV  +A   E+KK YRK AL +HPD++ +        E +KFK+++ AY VL DP+K+++YD G +            +SG     PM++F  FF+ G
Sbjct:    8 YDTLGVNPNATHEELKKAYRKLALKYHPDKNPN--------EGEKFKQISQAYEVLLDPKKRELYDMGGE----QALKGGSSNSGNGFSSPMDIFDLFFNGG 97          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Sea Lamprey
Match: dnaja1 (DnaJ heat shock protein family (Hsp40) member A1 [Source:ZFIN;Acc:ZDB-GENE-030131-2642])

HSP 1 Score: 63.1586 bits (152), Expect = 5.009e-11
Identity = 36/102 (35.29%), Postives = 55/102 (53.92%), Query Frame = 1
Query: 1207 YAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSSG 1512
            Y +LGV  ++   E+KK YRK AL +HPD++ +        E +KFK+++ AY VLSD +K+++YD G +          G         PM++F  FF  G
Sbjct:    8 YDLLGVKPNSTADELKKAYRKLALKYHPDKNPN--------EGEKFKQISQAYEVLSDAKKRELYDRGGE----QAIKEGGAGGSGGFSSPMDIFNMFFGGG 97          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002911.1 (pep scaffold:Pmarinus_7.0:GL478619:21387:64649:1 gene:ENSPMAG00000002653.1 transcript:ENSPMAT00000002911.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 2.435e-10
Identity = 36/90 (40.00%), Postives = 52/90 (57.78%), Query Frame = 1
Query:  832 QLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEA 1101
            +LKE+GN L    KY+ A + YT+A+      + + A  Y NR+L   KL++W +A+SDC  ALELD Q VK         + L+ Y+EA
Sbjct:   40 ELKEQGNRLFGNRKYDDAIQCYTKAI----TRNSLVAAYYTNRALCFVKLQQWEKAVSDCKHALELDSQSVKGHFFMGQSQLELENYDEA 125          

HSP 2 Score: 51.9878 bits (123), Expect = 1.402e-7
Identity = 29/94 (30.85%), Postives = 49/94 (52.13%), Query Frame = 1
Query:  130 TGEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQ 411
            T  E +  GN+ +    Y  A++ YT AI     VA++Y NR+   + L ++  A +D K + EL+  ++K    +G+ QL L  ++EA    Q
Sbjct:   37 TAHELKEQGNRLFGNRKYDDAIQCYTKAITRNSLVAAYYTNRALCFVKLQQWEKAVSDCKHALELDSQSVKGHFFMGQSQLELENYDEAIANLQ 130          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Yeast
Match: SIS1 (Type II HSP40 co-chaperone that interacts with the HSP70 protein Ssa1p; shuttles between cytosol and nucleus; mediates delivery of misfolded proteins into the nucleus for degradation; involved in proteasomal degradation of misfolded cytosolic proteins; protein abundance increases in response to DNA replication stress; polyQ aggregates sequester Sis1p and interfere with clearance of misfolded proteins; similar to bacterial DnaJ proteins and mammalian DnaJB1 [Source:SGD;Acc:S000004952])

HSP 1 Score: 68.1662 bits (165), Expect = 7.539e-13
Identity = 35/83 (42.17%), Postives = 54/83 (65.06%), Query Frame = 1
Query: 1156 LLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYD 1404
            ++K+TKL          Y +LGV  SANE E+KKGYRK AL +HPD+ +         + +KFKE++ A+ +L+DP+K+++YD
Sbjct:    1 MVKETKL----------YDLLGVSPSANEQELKKGYRKAALKYHPDKPT--------GDTEKFKEISEAFEILNDPQKREIYD 65          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Yeast
Match: XDJ1 (Chaperone with a role in facilitating mitochondrial protein import; ascomycete-specific member of the DnaJ-like family, closely related to Ydj1p; predicted to be C-terminally prenylated; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000004080])

HSP 1 Score: 67.781 bits (164), Expect = 1.540e-12
Identity = 34/66 (51.52%), Postives = 42/66 (63.64%), Query Frame = 1
Query: 1207 YAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYD 1404
            Y VLGV + A   EIK  YRK AL HHPD+  + D+ ++   E KFKE+  AY +LSDP KK  YD
Sbjct:   11 YDVLGVTRDATVQEIKTAYRKLALKHHPDK--YVDQDSKEVNEIKFKEITAAYEILSDPEKKSHYD 74          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Yeast
Match: YDJ1 (Type I HSP40 co-chaperone; involved in regulation of HSP90 and HSP70 functions; acts as an adaptor that helps Rsp5p recognize cytosolic misfolded proteins for ubiquitination after heat shock; critical for determining cell size at Start as a function of growth rate; involved in protein translocation across membranes; member of the DnaJ family; chimeric protein in which human p58IPK J domain replaces yeast Ydj1p J domain can complement yeast ydj1 mutant [Source:SGD;Acc:S000005008])

HSP 1 Score: 65.0846 bits (157), Expect = 1.096e-11
Identity = 32/66 (48.48%), Postives = 44/66 (66.67%), Query Frame = 1
Query: 1207 YAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYD 1404
            Y +LGVP +A + EIKK YRK AL +HPD++   + A      +KFKE + AY +LSDP K+ +YD
Sbjct:    8 YDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAA------EKFKEASAAYEILSDPEKRDIYD 67          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Yeast
Match: SCJ1 (One of several homologs of bacterial chaperone DnaJ; located in the ER lumen where it cooperates with Kar2p to mediate maturation of proteins [Source:SGD;Acc:S000004827])

HSP 1 Score: 64.3142 bits (155), Expect = 1.281e-11
Identity = 42/103 (40.78%), Postives = 58/103 (56.31%), Query Frame = 1
Query: 1201 DPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDS-GVD-IDEVLXXXXXXXXXXXXXXDPMEVFQAFF 1503
            D YA+L + K A E EIK  YR+ +  +HPD+++ ++EA      QKF EV  AY VLSDP KK++YD  G D +    G    GG       DP ++F+  F
Sbjct:   23 DYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEA-----HQKFIEVGEAYDVLSDPEKKKIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMF 120          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Yeast
Match: STI1 (Hsp90 cochaperone; regulates spatial organization of amyloid-like proteins in the cytosol, thereby buffering the proteotoxicity caused by amyloid-like proteins; interacts with the Ssa group of the cytosolic Hsp70 chaperones and activates Ssa1p ATPase activity; interacts with Hsp90 chaperones and inhibits their ATPase activity; homolog of mammalian Hop [Source:SGD;Acc:S000005553])

HSP 1 Score: 64.6994 bits (156), Expect = 1.933e-11
Identity = 38/115 (33.04%), Postives = 64/115 (55.65%), Query Frame = 1
Query:  130 TGEEHRRNGNKYYSQGNYKAALESYTAAIDTE--PNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKL 468
            T +E+++ GN  ++  +Y  A+E +T AI+    PN    Y+NRSA    L ++ DA NDA +  ++ P   K   RLG   L LG  +EAE  ++K+   D++N   +  L+++
Sbjct:    4 TADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHV-LYSNRSACYTSLKKFSDALNDANECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASNKAAKEGLDQV 117          

HSP 2 Score: 59.3066 bits (142), Expect = 1.048e-9
Identity = 32/100 (32.00%), Postives = 54/100 (54.00%), Query Frame = 1
Query:  802 QAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEA 1101
            +AY   +K  + + EG        +  A + YT+ ++  P     +A+ Y NR+  L+KL  +PEA++DC+KA+E DP +V+A  R+    I +  Y  A
Sbjct:  388 EAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPE----DARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASA 483          

HSP 3 Score: 51.9878 bits (123), Expect = 1.731e-7
Identity = 29/91 (31.87%), Postives = 54/91 (59.34%), Query Frame = 1
Query:  838 KEEGNMLVRTCKYEKAREVYTQALEID--PNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEAD 1104
            K++GN       Y+KA E++T+A+E+   PNH      LY NRS   + L+++ +AL+D ++ ++++P + K  +R     +GL   +EA+
Sbjct:    9 KQQGNAAFTAKDYDKAIELFTKAIEVSETPNH-----VLYSNRSACYTSLKKFSDALNDANECVKINPSWSKGYNRLGAAHLGLGDLDEAE 94          

HSP 4 Score: 48.9062 bits (115), Expect = 1.621e-6
Identity = 29/114 (25.44%), Postives = 56/114 (49.12%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDS--NNSEIQSNLEKL 468
             EE R  G +Y+++ ++  A+++YT  I   P  A  Y+NR+A    L  + +A  D  K+ E +P+ ++  +R    Q+ +  +  A  T   +   D+  NN      +++L
Sbjct:  396 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQL 509          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Nematostella
Match: EDO32703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUB0])

HSP 1 Score: 122.865 bits (307), Expect = 3.055e-30
Identity = 113/425 (26.59%), Postives = 197/425 (46.35%), Query Frame = 1
Query:  154 GNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYY-MEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEAD---REAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVD 1416
            G K  S G    AL  Y AA+D +PN       R+ V + L R   A  D  K  EL P+  +  V+ G   L  G ++EA I ++    Y   N +    L  +  +K  + + +   E+ D   A+  +   +E++P   EL++ + +     +R  +   ++  +   T   + NT+A +LR   L+Y +  L++A    +  LK   DH      Y++ KKL++       L+   +Y +A +   +AL  +  +  +  K          KL    EA+ +C+ AL +D   V A+  R    I  + Y EA    ++A+ +N+     +    L + +  +K+S++ D Y +LG+ ++ N+ EI K YRK A+  HPD +   D   +   E+ F ++  A  VL+DP K+  YD+G D
Sbjct:    2 GKKLLSAGQLTDALSHYHAAVDGDPNNFLPRFQRATVLIALGRSRSAIPDLDKVLELRPEFYQARVQRGNVFLKQGRFDEAHIDYEGVLRYSPENKDALQQLGVIEPIKRTVMEAKYAMERGDCHSAIEQLTHAIEVAPWDPELRMMRAD---CYERQGDLIKAISDIKPTTKLINDNTQA-FLRMSKLHYEIGELEEALREVRECLKLDQDHKQCHPFYKKMKKLNKQLSAAQDLINKEQYHEAIDKLKKALRTESKNKPLVGKARRQLCHCHLKLGFSQEAIKECNAALSIDENDVDALCDRAEAYILEEMYNEAVNDFQKAKSINEHLHKVQEG--LDRAQRLLKQSQKRDYYKILGLKRNCNKREITKAYRKLAVKWHPDNYKGED---KKKAEKMFIDIAAAKEVLTDPEKRAKYDAGED 417          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Nematostella
Match: EDO37560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFH5])

HSP 1 Score: 97.8265 bits (242), Expect = 1.364e-24
Identity = 46/82 (56.10%), Postives = 63/82 (76.83%), Query Frame = 1
Query: 1180 MKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDE 1425
            +K+SK+ D Y +L + K+A+E EIKK Y+K AL HHPDRHS A +  +   E++FKEVN AYS+LSDP+KK+ YDSG D++E
Sbjct:    1 LKKSKRKDYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKMSEKQFKEVNEAYSILSDPKKKRRYDSGQDLEE 82          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Nematostella
Match: EDO26658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBE9])

HSP 1 Score: 78.9518 bits (193), Expect = 5.413e-18
Identity = 45/95 (47.37%), Postives = 65/95 (68.42%), Query Frame = 1
Query: 1072 LIGLDRYEEADREAEKLNKK-YPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEV 1353
            ++  ++YEEA R+ E L KK   S E  +LL++ KL +K+SK+ D Y +L + K+A+E EIKK Y+K AL HHPDRHS A +  +   E++FKEV
Sbjct:    1 MMESEKYEEAVRDYESLCKKDRSSREFRRLLEKAKLELKKSKRKDYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEV 95          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Nematostella
Match: EDO37841 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEM8])

HSP 1 Score: 70.0922 bits (170), Expect = 5.125e-15
Identity = 35/66 (53.03%), Postives = 46/66 (69.70%), Query Frame = 1
Query: 1207 YAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYD 1404
            Y +LGV   A   EIKK YRK AL HHPD++    EAT     +KFKE+N+A+S+LSDP K+++YD
Sbjct:    5 YEILGVEHDATPEEIKKAYRKMALKHHPDKNRDNPEAT-----EKFKEINHAHSILSDPSKREIYD 65          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Nematostella
Match: EDO38741 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC40])

HSP 1 Score: 72.7886 bits (177), Expect = 5.326e-14
Identity = 30/66 (45.45%), Postives = 51/66 (77.27%), Query Frame = 1
Query: 1207 YAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYD 1404
            YA+LGVP++A++ +IKK YR++AL+ HPD++ ++        E+KFKE++ AY VL+DPR++ ++D
Sbjct:    6 YAILGVPRNASDDDIKKAYRRQALIFHPDKNKNS------GAEEKFKEISEAYKVLTDPRQRDIFD 65          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Medaka
Match: DNAJC7 (dnaJ homolog subfamily C member 7 [Source:NCBI gene;Acc:101160690])

HSP 1 Score: 326.25 bits (835), Expect = 4.815e-105
Identity = 183/431 (42.46%), Postives = 267/431 (61.95%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDE 1425
             E  +  GN YYS+ +Y AA   YT AID  P  AS+Y NR+A  +ML R+ +A  D++++  L+   +K  +R GKC L+LG    A   FQK    + +N E Q   +    +           +K+D+R  ++C++R + ++P     K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + +DKA   F   L+ +PDH  A+ A R  K L   KEEGN + + C Y+ A ++YT+AL IDPN+ + NAKLY NR+   +KL+++ +A+ DC KA++LD  Y+KA  RR  C +  + YEEA R+ EK+ +   + E+ +LLK  ++ +K+SK+ D Y VLGV K+A E EIKK YRKRAL+HHPDRHS A    +  EE+KFKEV  A+++LSDP+KK  YDSG D+++
Sbjct:   42 AEIFKEQGNAYYSKKDYPAAFNYYTKAIDASPKTASYYGNRAATLMMLCRFREALEDSQQAVRLDDGFMKGHLREGKCHLSLGNAMAAARCFQKVLELEPSNKEAQQEKKNATTLLEYERMADFSFDKRDFRKVVYCMDRAIALAPTCQRFKILKAECLALLGRYPEAQ-SVASDILRMDAT--NADALYVRGLCLYYEDCIDKAVQFFVQALRMAPDHEKARLACRNAKALKAKKEEGNQVFKNCSYDAAYQLYTEALAIDPNNIKTNAKLYCNRATAGAKLKKFDQAIDDCTKAIKLDDTYIKAYLRRAQCYMDTELYEEAVRDYEKVYQTEKTSEHKQLLKTAQMELKKSKRKDYYKVLGVGKNATEDEIKKAYRKRALMHHPDRHSSATAEVQKEEEKKFKEVGEAFTILSDPKKKMRYDSGHDLED 469          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Medaka
Match: dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:NCBI gene;Acc:101161810])

HSP 1 Score: 318.546 bits (815), Expect = 2.291e-102
Identity = 187/431 (43.39%), Postives = 262/431 (60.79%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDE 1425
             E  +  GN +Y + +Y  A   YT AID  P   S+Y NR+A  +ML RY +A  DA+++  L+ + +K  +R GKC L+LG    A   FQK    +  N + Q  ++    +           EK+D+R  +FC++R LE +P   + K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + +DKA   F   L+ +PDH  A+ A R  K L   KEEGN   +   +E A E+Y++AL IDPN+ + NAKLY NR+   SKL++  +A+ DC KA++LD  Y+KA  RR  C +  + YEEA R+ EK+ +   + E+  LLK  +L +K+SK+ D Y +LGV K+A E EIKK YRKRALLHHPDRHS A    +  EE+KFKEV  A+SVLSDP+KK  YDSG D+++
Sbjct:   28 AEGFKEQGNAFYVKKDYAEAFNYYTKAIDMCPRNPSYYGNRAATLMMLCRYREALEDAQQAVRLDGNFVKGHLREGKCHLSLGNAMAARRCFQKVLELELENGQAQQEVKNAESILEYERMAEIGFEKRDFRMVVFCMDRALESAPACHKFKILKAECLALLGRYPEAQ-SVASDILRMDST--NADALYVRGLCLYYEDCIDKAVQFFVQALRMAPDHDKARLACRDAKALKAKKEEGNKAFKDGNFEAAYELYSEALTIDPNNIKTNAKLYCNRATVGSKLKKLDQAIEDCTKAIKLDETYIKAYLRRAQCYMDTELYEEAVRDYEKVYQTEKTKEHKHLLKTAQLELKKSKRKDYYKILGVEKNATEDEIKKAYRKRALLHHPDRHSGASPELQKEEEKKFKEVGEAFSVLSDPKKKSRYDSGQDLED 455          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Medaka
Match: dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:NCBI gene;Acc:101161810])

HSP 1 Score: 318.931 bits (816), Expect = 2.321e-102
Identity = 187/431 (43.39%), Postives = 262/431 (60.79%), Query Frame = 1
Query:  133 GEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDE 1425
             E  +  GN +Y + +Y  A   YT AID  P   S+Y NR+A  +ML RY +A  DA+++  L+ + +K  +R GKC L+LG    A   FQK    +  N + Q  ++    +           EK+D+R  +FC++R LE +P   + K+ K E L  L RYPEA+ S+ S I +   +  N +ALY+RGLCLYY + +DKA   F   L+ +PDH  A+ A R  K L   KEEGN   +   +E A E+Y++AL IDPN+ + NAKLY NR+   SKL++  +A+ DC KA++LD  Y+KA  RR  C +  + YEEA R+ EK+ +   + E+  LLK  +L +K+SK+ D Y +LGV K+A E EIKK YRKRALLHHPDRHS A    +  EE+KFKEV  A+SVLSDP+KK  YDSG D+++
Sbjct:   27 AEGFKEQGNAFYVKKDYAEAFNYYTKAIDMCPRNPSYYGNRAATLMMLCRYREALEDAQQAVRLDGNFVKGHLREGKCHLSLGNAMAARRCFQKVLELELENGQAQQEVKNAESILEYERMAEIGFEKRDFRMVVFCMDRALESAPACHKFKILKAECLALLGRYPEAQ-SVASDILRMDST--NADALYVRGLCLYYEDCIDKAVQFFVQALRMAPDHDKARLACRDAKALKAKKEEGNKAFKDGNFEAAYELYSEALTIDPNNIKTNAKLYCNRATVGSKLKKLDQAIEDCTKAIKLDETYIKAYLRRAQCYMDTELYEEAVRDYEKVYQTEKTKEHKHLLKTAQLELKKSKRKDYYKILGVEKNATEDEIKKAYRKRALLHHPDRHSGASPELQKEEEKKFKEVGEAFSVLSDPKKKSRYDSGQDLED 454          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Medaka
Match: dnajc3a (DnaJ heat shock protein family (Hsp40) member C3 [Source:NCBI gene;Acc:101166264])

HSP 1 Score: 142.124 bits (357), Expect = 4.209e-36
Identity = 127/475 (26.74%), Postives = 211/475 (44.42%), Query Frame = 1
Query:  136 EEHRRNGNKYYSQGNYKAALESYTAAIDTEP-NVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQ---KSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSK-LLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLXXXXXXXXXXXXXXDPMEVFQAFFSSGCGNAGFKMNFH 1545
            + H   G K  + G    AL  + AA+D +P N  +FY  R+ V L + +   A  D  +  EL+PD     ++ G   L  G  +EAE  F+   KS   D    E +S L K   ++  + Q R+    KDY  A+  ++  +E        +  + E  I +    +A   L++  +   D   NT+A Y      Y +   + + +  +  LK  PDH      Y+R KKL++  +    L++  +Y  A   Y   ++ +PN  +            L+K ++   A+S C + L+ DP+ V  +  R    +  ++YEEA ++ E   K   +D   K  L++ +  +K+S++ D Y +LGV ++A + EI K YRK A   HPD  +  D   +   E++F ++  A  VL+DP  +  +D G D      +  S              FQ F   G G   FK NF+
Sbjct:   38 DNHMEMGKKLLAAGQLADALSHFHAAVDGDPKNYMAFYR-RATVFLAMGKSKSALPDLSRVIELKPDFTSARLQRGNLLLKQGKLDEAESDFKKVLKSNPSDKEEREAKSQLAKSDEIQRLVAQSRSSFNGKDYMTAITLLDTIIETCVWDASSREMRAECYIQMGEMGKAVSDLKAASKLKND---NTQAFYKLSTIYYDLGDHEMSLNEVRECLKLDPDHKQCYNHYKRVKKLNKQIQSAEELIQEQRYVDAVSKYEAVMKTEPNVQQFTLLAKERICHALAKDQQASRAISVCSEVLQSDPENVNVLKDRAEAYVQDEQYEEAIKDYETAGKHSENDHQIKEGLERAQRLLKQSQRRDYYKILGVKRTAKKKEIIKAYRKLAQQWHPD--NFQDPQEKKKAEKRFIDIAQAKEVLTDPEMRNKFDQGEDP----MDPDSQQGHHHPFNGGFHGFQGFNPFGSGPFNFKFNFN 502          
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Medaka
Match: dnajc3b (dnaJ homolog subfamily C member 3 [Source:NCBI gene;Acc:101168077])

HSP 1 Score: 119.398 bits (298), Expect = 2.085e-28
Identity = 114/434 (26.27%), Postives = 199/434 (45.85%), Query Frame = 1
Query:  136 EEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRS-----LTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENS--KLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVD 1416
            E+H   G K  + G    AL  Y +A++ +      Y  R+AV L L +   A  D  ++ EL+PD +   ++ G   L  G   EA   F+       +  E +  L K   ++   ++  A   + +Y  A+  +ER +EISP   +L+  + E  +   R  + + +++ +   T   + N  A     L  Y +    ++ +H +  LK   D       Y++ KKLS+  +    L+   +Y  A + Y   ++      E +   Y N +         KL    EA+  C +A + DP+  K +  R    I    YE+A  + ++  +++  D N   + L++ +  +K S++ D Y +LGV +SAN+ E+ K YRK A   HPD  +   EA +   E+KF ++ +A  VL+DP  +Q +DSG D
Sbjct:   39 EQHLEMGRKLLAAGQLAEALSHYHSAVEGDSKNYLTYYKRAAVFLALGKSKSALPDLTRAIELKPDFLAARLQRGNILLKQGNTEEARADFESVLKRSPDQEEARQQLMKASELEGLQEEAYAAHHQGEYSAAIAVLERAIEISPWDPDLRELRAECYV---RTGDPQKAIQDLTPTTKLRNDNRAAFLKLSLLHYSLGQHHESLNHVRECLKLDQDDKDCFNHYKQVKKLSKQLDSAEELILEERYRDAIDKYESVMKT-----ESDVPFYTNLAKERICFCFVKLNLVSEAIDVCSEAHQRDPRNAKILRDRAEAYILNQDYEKAVEDYQE-AREFDGDSNDIKEGLERAQKLLKVSQKRDYYKILGVSRSANKQEVIKAYRKLAQQWHPD--NFQSEAEKKEAEKKFIDIASAKEVLTDPEMRQKFDSGED 461          
BLAST of DnaJ homolog subfamily C member 7 vs. Planmine SMEST
Match: SMESG000075584.1 (SMESG000075584.1)

HSP 1 Score: 739.569 bits (1908), Expect = 0.000e+0
Identity = 362/387 (93.54%), Postives = 362/387 (93.54%), Query Frame = 1
Query:  130 TGEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHP 1290
            TGEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSN                         ALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHP
Sbjct:   15 TGEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSN-------------------------ALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHP 376          

HSP 2 Score: 112.464 bits (280), Expect = 2.107e-26
Identity = 56/79 (70.89%), Postives = 58/79 (73.42%), Query Frame = 2
Query: 1205 PMRCWGCRKVQTNQKSRKAIGKGHCFTIPIDIHMLTRPLGTQKSRNSKKSIMHIAFFQIRGKSKCTILESILMRCLGIR 1441
            P    G  K     + +K   K      PIDIHMLTRPLGTQKSRNSKKSIMHIAFFQIRGKSKCTILESILMRCLGIR
Sbjct:  348 PYAVLGVPKSANESEIKKGYRKRALLHHPIDIHMLTRPLGTQKSRNSKKSIMHIAFFQIRGKSKCTILESILMRCLGIR 426          
BLAST of DnaJ homolog subfamily C member 7 vs. Planmine SMEST
Match: SMESG000075593.1 (SMESG000075593.1)

HSP 1 Score: 657.907 bits (1696), Expect = 0.000e+0
Identity = 341/436 (78.21%), Postives = 355/436 (81.42%), Query Frame = 1
Query:  130 TGEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDH--VGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVL 1431
            TGEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKT DSHANTEALYLR          +KA+  +   L+  P+H  V A+  + R   LS+L+          ++ +A     +ALE+D                                      PQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVL
Sbjct:   15 TGEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTADSHANTEALYLRACVKAETCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLE----------RWPEALSDCDKALELD--------------------------------------PQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVL 402          
BLAST of DnaJ homolog subfamily C member 7 vs. Planmine SMEST
Match: SMESG000075593.1 (SMESG000075593.1)

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 341/436 (78.21%), Postives = 355/436 (81.42%), Query Frame = 1
Query:  130 TGEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDH--VGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVL 1431
            TGEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKT DSHANTEALYLR          +KA+  +   L+  P+H  V A+  + R   LS+L+          ++ +A     +ALE+D                                      PQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVL
Sbjct:   15 TGEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTADSHANTEALYLRACVKAETCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLE----------RWPEALSDCDKALELD--------------------------------------PQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVL 402          
BLAST of DnaJ homolog subfamily C member 7 vs. Planmine SMEST
Match: SMESG000065256.1 (SMESG000065256.1)

HSP 1 Score: 97.8265 bits (242), Expect = 2.938e-21
Identity = 101/433 (23.33%), Postives = 185/433 (42.73%), Query Frame = 1
Query:  139 EHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASF----YNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKD----YRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGV 1413
            E R NGN      +Y+ A++ YT     EP    +    ++N    ++++  +L+A    + +  L+ +NIK   R   C +    ++EAE   ++     +N+ E   NL   V+ K   + F+   +K      Y  AL  +   +E S  +D L + + E+ + L R  EA I +E  +      H         G+ L    ++ K  +H +                                    ++++A E Y  A++  P HD     LY  R+    ++  W   + D   A+E+          R  CL+  + Y+EA ++A     +    E + L+++ +  + R+     Y VLGV   A+  +++K Y K +L +HPD+ S  +E  R+A +++FK++  +Y  LSDP  K +YD  +
Sbjct:  171 EMRLNGNLALKNKDYELAIQFYTKGFSIEPKFQKYNSLLHSNAGYSHMLMDNHLEAIESFEMAVLLDGNNIKAKRRKIICLIKTQRFDEAEKEVKELLL--TNSCEEDKNLLNEVLNKKA-EYFKGDGDKNKSEIAYLKALKSLTNLIE-SNETDGLLIKRAEVFMQLNRLSEALIDVEKAMRNEKSEH---------GIQLVKSIYIRKGLAHMER----------------------------------SEFQEAMESYNNAIKCTP-HD---VSLYETRARIAEQMNDWVTIIIDTSHAIEMGSTDTNNWVLRSKCLLKEELYKEAYKDASLAYSRTRCPETAMLVREAEKGILRNSTETFYDVLGVKFGASNKDVRKRYLKLSLRYHPDKWSRVNEYFRNASQERFKKILESYKTLSDPALKMVYDMSI 552          

HSP 2 Score: 56.6102 bits (135), Expect = 3.842e-8
Identity = 32/120 (26.67%), Postives = 67/120 (55.83%), Query Frame = 1
Query:  811 RRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQT 1170
            ++ K++++++  GN+ ++   YE A + YT+   I+P   + N+ L+ N   +   ++   EA+   + A+ LD   +KA  R++ CLI   R++EA++E ++L      +E+  LL + 
Sbjct:  164 KKIKEMNEMRLNGNLALKNKDYELAIQFYTKGFSIEPKFQKYNSLLHSNAGYSHMLMDNHLEAIESFEMAVLLDGNNIKAKRRKIICLIKTQRFDEAEKEVKELLLTNSCEEDKNLLNEV 283          
BLAST of DnaJ homolog subfamily C member 7 vs. Planmine SMEST
Match: SMESG000065252.1 (SMESG000065252.1)

HSP 1 Score: 97.4413 bits (241), Expect = 4.312e-21
Identity = 102/432 (23.61%), Postives = 181/432 (41.90%), Query Frame = 1
Query:  139 EHRRNGNKYYSQGNYKAALESYTAAIDTEPNVASF----YNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYWNEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNG---IDQFRAQKEKKDYRHALFCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHANTEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHHPDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGV 1413
            E R NGN      +Y+ A++ YT     EP    +    ++N    ++++  +L+A    + +  L+ +NIK   R   C +    ++EAE   +K     +N+ E   NL   V+ K     I+     K +  Y  AL  +   +E S  +D L + + E+ + L R  EA I +E  +      H         G+ L    ++ K  +H +                                    ++++A E Y  A++  P HD     LY  R+    ++  W   + D   A+E+          R  CL+  + Y+EA  +A     +    E + L+++    + R+     Y VLGV   A+  +++K Y K +L +HPD  S  +E  R+A +++FK++  +Y  LSDP  K +YD  +
Sbjct:  171 EMRLNGNLALKNKDYELAIQFYTKGFSIEPKFQKYNSLLHSNAGYGHMLMDNHLEAIGSFEMAVLLDGNNIKAKRRKIICLIKTQRFDEAEKEAKKLLL--TNSCEEDKNLLNEVLNKKAEYFIEDGDKNKSEIAYSKALKSLTNLIE-SNETDGLLIKRAEVFMQLNRLSEALIDVEKAMRNEKSEH---------GIQLVKNIYIRKGLAHMER----------------------------------SEFQEAMESYNNAIKCTP-HD---VSLYETRARIAEQMNDWVTIIIDTSHAIEMGSTDTNNWVLRSKCLLKEELYKEAYEDASLAYSRTRCPETAMLVREAGEGILRNSTETFYDVLGVKFGASNKDVRKRYLKLSLRYHPDNWSRVNEYFRNASQERFKKILESYKTLSDPALKMVYDMSI 552          

HSP 2 Score: 59.3066 bits (142), Expect = 4.506e-9
Identity = 34/120 (28.33%), Postives = 67/120 (55.83%), Query Frame = 1
Query:  811 RRCKKLSQLKEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLERWPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYPSDENSKLLKQT 1170
            ++ K++++++  GN+ ++   YE A + YT+   I+P   + N+ L+ N       ++   EA+   + A+ LD   +KA  R++ CLI   R++EA++EA+KL      +E+  LL + 
Sbjct:  164 KKIKEMNEMRLNGNLALKNKDYELAIQFYTKGFSIEPKFQKYNSLLHSNAGYGHMLMDNHLEAIGSFEMAVLLDGNNIKAKRRKIICLIKTQRFDEAEKEAKKLLLTNSCEEDKNLLNEV 283          
The following BLAST results are available for this feature:
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJC79.507e-10441.21DnaJ heat shock protein family (Hsp40) member C7 [... [more]
DNAJC73.121e-9643.50DnaJ heat shock protein family (Hsp40) member C7 [... [more]
DNAJC73.121e-9643.50DnaJ heat shock protein family (Hsp40) member C7 [... [more]
DNAJC72.629e-4739.37DnaJ heat shock protein family (Hsp40) member C7 [... [more]
DNAJC71.596e-4237.92DnaJ heat shock protein family (Hsp40) member C7 [... [more]
back to top
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnj-73.843e-2124.42DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-281.122e-1823.95DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-138.170e-1341.53DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-138.170e-1341.53DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-165.026e-1252.86DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
back to top
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tpr21.482e-9736.90gene:FBgn0032586 transcript:FBtr0080867[more]
Tpr21.482e-9736.90gene:FBgn0032586 transcript:FBtr0333488[more]
Tpr21.843e-9736.90gene:FBgn0032586 transcript:FBtr0333486[more]
Tpr24.464e-9737.58gene:FBgn0032586 transcript:FBtr0080866[more]
Tpr24.464e-9737.58gene:FBgn0032586 transcript:FBtr0333487[more]
back to top
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc71.442e-10341.74DnaJ (Hsp40) homolog, subfamily C, member 7 [Sourc... [more]
dnajc78.805e-10341.74DnaJ (Hsp40) homolog, subfamily C, member 7 [Sourc... [more]
dnajc71.065e-10043.39DnaJ (Hsp40) homolog, subfamily C, member 7 [Sourc... [more]
dnajc3a1.030e-3428.72DnaJ (Hsp40) homolog, subfamily C, member 3a [Sour... [more]
dnajc3a1.030e-3428.72DnaJ (Hsp40) homolog, subfamily C, member 3a [Sour... [more]
back to top
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc71.668e-10041.42DnaJ heat shock protein family (Hsp40) member C7 [... [more]
dnajc72.542e-10041.42DnaJ heat shock protein family (Hsp40) member C7 [... [more]
dnajc74.524e-10041.42DnaJ heat shock protein family (Hsp40) member C7 [... [more]
dnajc74.801e-10041.83DnaJ heat shock protein family (Hsp40) member C7 [... [more]
dnajc77.238e-10041.56DnaJ heat shock protein family (Hsp40) member C7 [... [more]
back to top
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnajc79.883e-10542.46DnaJ heat shock protein family (Hsp40) member C7 [... [more]
Dnajc71.473e-4635.82DnaJ heat shock protein family (Hsp40) member C7 [... [more]
Dnajc31.054e-3127.31DnaJ heat shock protein family (Hsp40) member C3 [... [more]
Dnajc71.336e-1734.56DnaJ heat shock protein family (Hsp40) member C7 [... [more]
Sgtb1.325e-1439.25small glutamine-rich tetratricopeptide repeat (TPR... [more]
back to top
BLAST of DnaJ homolog subfamily C member 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QYI3|DNJC7_MOUSE6.913e-10442.46DnaJ homolog subfamily C member 7 OS=Mus musculus ... [more]
sp|Q5R8D8|DNJC7_PONAB2.451e-10341.21DnaJ homolog subfamily C member 7 OS=Pongo abelii ... [more]
sp|Q99615|DNJC7_HUMAN4.565e-10341.21DnaJ homolog subfamily C member 7 OS=Homo sapiens ... [more]
sp|Q54IP0|DNJC7_DICDI7.191e-7535.48DnaJ homolog subfamily C member 7 homolog OS=Dicty... [more]
sp|Q9HGM9|DNJC7_SCHPO2.104e-6132.21DnaJ homolog subfamily C member 7 homolog OS=Schiz... [more]
back to top
BLAST of DnaJ homolog subfamily C member 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LCN81.199e-11745.54Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7Y5702.133e-11745.07DnaJ homolog subfamily C member 7 (Fragment) OS=Cl... [more]
A0A5J4NQM63.995e-11644.37DnaJ subfamily C member 7 (Fragment) OS=Paragonimu... [more]
A0A419Q1355.739e-11645.31DnaJ-like protein subfamily C member 7 OS=Clonorch... [more]
A0A3Q0KMX62.339e-11544.84DNAj homolog subfamily C member, putative OS=Schis... [more]
back to top
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc75.707e-10242.92DnaJ heat shock protein family (Hsp40) member C7 [... [more]
dnajc75.733e-10242.92DnaJ heat shock protein family (Hsp40) member C7 [... [more]
ENSAMXT00000022001.21.860e-9940.51dnaJ homolog subfamily C member 7-like [Source:NCB... [more]
dnajc3a3.150e-3627.00DnaJ heat shock protein family (Hsp40) member C3 [... [more]
dnajc3b1.520e-3126.74dnaJ homolog subfamily C member 3-like [Source:NCB... [more]
back to top
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc5aa4.056e-1250.00DnaJ (Hsp40) homolog, subfamily C, member 5aa [Sou... [more]
ENSPMAT00000005772.11.698e-1136.84pep scaffold:Pmarinus_7.0:GL478792:23408:39519:-1 ... [more]
DNAJA43.350e-1137.25DnaJ heat shock protein family (Hsp40) member A4 [... [more]
dnaja15.009e-1135.29DnaJ heat shock protein family (Hsp40) member A1 [... [more]
ENSPMAT00000002911.12.435e-1040.00pep scaffold:Pmarinus_7.0:GL478619:21387:64649:1 g... [more]
back to top
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SIS17.539e-1342.17Type II HSP40 co-chaperone that interacts with the... [more]
XDJ11.540e-1251.52Chaperone with a role in facilitating mitochondria... [more]
YDJ11.096e-1148.48Type I HSP40 co-chaperone; involved in regulation ... [more]
SCJ11.281e-1140.78One of several homologs of bacterial chaperone Dna... [more]
STI11.933e-1133.04Hsp90 cochaperone; regulates spatial organization ... [more]
back to top
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO327033.055e-3026.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375601.364e-2456.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO266585.413e-1847.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378415.125e-1553.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387415.326e-1445.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DnaJ homolog subfamily C member 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJC74.815e-10542.46dnaJ homolog subfamily C member 7 [Source:NCBI gen... [more]
dnajc72.291e-10243.39DnaJ heat shock protein family (Hsp40) member C7 [... [more]
dnajc72.321e-10243.39DnaJ heat shock protein family (Hsp40) member C7 [... [more]
dnajc3a4.209e-3626.74DnaJ heat shock protein family (Hsp40) member C3 [... [more]
dnajc3b2.085e-2826.27dnaJ homolog subfamily C member 3 [Source:NCBI gen... [more]
back to top
BLAST of DnaJ homolog subfamily C member 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075584.12.107e-2693.54SMESG000075584.1[more]
SMESG000075593.10.000e+078.21SMESG000075593.1[more]
SMESG000075593.10.000e+078.21SMESG000075593.1[more]
SMESG000065256.12.938e-2123.33SMESG000065256.1[more]
SMESG000065252.14.312e-2123.61SMESG000065252.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031156 ID=SMED30031156|Name=DnaJ homolog subfamily C member 7|organism=Schmidtea mediterranea sexual|type=transcript|length=1712bp
ATTTCGGCTTTTAAATTATTCAAATTATTTTTTAAGACCAAATATTTTTA
ATTATTAATTTAAGCATTTTAAATATTCATCATAAAAATGGAAATAGATT
TGGTAGATGATGACTCTGTGATATTAGTTACAGGTGAAGAACATAGACGT
AATGGAAATAAATACTACAGTCAAGGGAATTATAAAGCTGCCCTTGAATC
TTATACAGCAGCAATAGACACCGAACCTAATGTAGCTTCATTTTATAACA
ATCGATCAGCAGTTAATCTTATGCTGTATAGATATTTAGATGCTTTTAAT
GATGCTAAAAAATCATGCGAATTAGAGCCAGACAATATAAAATGTTTAGT
CAGACTTGGAAAATGTCAACTTAATTTAGGATATTGGAATGAAGCTGAAA
TTACTTTTCAAAAATCTACATGTTATGATAGTAATAATTCAGAAATTCAA
TCTAATTTGGAAAAATTAGTCGTAGTAAAAAATGGAATCGATCAATTTCG
TGCTCAAAAAGAAAAAAAAGATTATAGACATGCACTATTTTGTGTCGAGA
GATGCCTGGAAATTTCTCCTGGATCGGACGAATTGAAATTATACAAAATC
GAGTTATTGATCTCATTAAAGAGATATCCTGAAGCAAAAATTAGTTTAGA
GAGTATGATAGAAAAGACTACAGACAGTCATGCAAACACAGAGGCATTAT
ATCTAAGAGGTCTGTGCCTTTACTACATGGAACATCTCGATAAAGCACAA
TCACATTTTCAGCATGTGTTAAAGCAGAGTCCTGATCACGTCGGTGCCCA
GCAGGCATATCGGCGGTGCAAGAAATTGAGTCAGTTAAAAGAGGAGGGCA
ATATGCTCGTTAGAACATGCAAATATGAGAAGGCTCGTGAAGTGTACACA
CAAGCACTGGAAATCGATCCGAATCATGACGAAGTCAATGCAAAATTATA
TTTTAATCGTTCGTTGACCTTATCAAAACTCGAGAGGTGGCCAGAAGCGC
TCAGTGATTGTGACAAAGCTTTGGAGTTGGATCCACAATACGTGAAGGCG
ATGTCTAGGAGAGTGAATTGTCTTATCGGATTAGACAGATATGAAGAAGC
TGATAGAGAAGCGGAAAAGTTGAACAAAAAATATCCATCGGACGAGAATT
CCAAGCTGTTGAAGCAAACGAAATTGGCGATGAAGCGATCCAAGCAACTC
GATCCCTATGCGGTGCTGGGGGTGCCGAAAAGTGCAAACGAATCAGAAAT
CAAGAAAGGCTATCGGAAAAGGGCACTGCTTCACCATCCCGATCGACATT
CACATGCTGACGAGGCCACTCGGCACGCAGAAGAGCAGAAATTCAAAGAA
GTCAATAATGCATATAGCGTTCTTTCAGATCCGAGGAAAAAGCAAATGTA
CGATTCTGGAGTCGATATTGATGAGGTGCTTGGGAATTCGTGTAGCGGTG
GCAGCAGTGGCTTCCATGGTGGAGATCCTATGGAGGTTTTCCAGGCGTTT
TTTAGCAGTGGTTGTGGCAATGCTGGATTCAAAATGAATTTCCATCACCA
GTAGTTGTTGCTGCTACTGTTACTGTCAGATTTGTACAGGCGAGGAGCGT
GACGACAACCCAAATCGTAGAAACTTGAGGATTGTATTGATGAATATTAA
TTTATCTTGTCTTTCGTTTTTAATATTTTGTCTTAATAATTTCGGTTTTT
GCAATTTCTAGC
back to top

protein sequence of SMED30031156-orf-1

>SMED30031156-orf-1 ID=SMED30031156-orf-1|Name=SMED30031156-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=489bp
MEIDLVDDDSVILVTGEEHRRNGNKYYSQGNYKAALESYTAAIDTEPNVA
SFYNNRSAVNLMLYRYLDAFNDAKKSCELEPDNIKCLVRLGKCQLNLGYW
NEAEITFQKSTCYDSNNSEIQSNLEKLVVVKNGIDQFRAQKEKKDYRHAL
FCVERCLEISPGSDELKLYKIELLISLKRYPEAKISLESMIEKTTDSHAN
TEALYLRGLCLYYMEHLDKAQSHFQHVLKQSPDHVGAQQAYRRCKKLSQL
KEEGNMLVRTCKYEKAREVYTQALEIDPNHDEVNAKLYFNRSLTLSKLER
WPEALSDCDKALELDPQYVKAMSRRVNCLIGLDRYEEADREAEKLNKKYP
SDENSKLLKQTKLAMKRSKQLDPYAVLGVPKSANESEIKKGYRKRALLHH
PDRHSHADEATRHAEEQKFKEVNNAYSVLSDPRKKQMYDSGVDIDEVLGN
SCSGGSSGFHGGDPMEVFQAFFSSGCGNAGFKMNFHHQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR036869J_dom_sf
IPR001623DnaJ_domain
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013105TPR_2
IPR018253DnaJ_domain_CS
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 335..355
NoneNo IPR availablePFAMPF13414TPR_11coord: 23..59
e-value: 1.9E-7
score: 30.6
NoneNo IPR availablePANTHERPTHR44200:SF1DNAJ HOMOLOG SUBFAMILY C MEMBER 7coord: 17..446
NoneNo IPR availablePANTHERPTHR44200FAMILY NOT NAMEDcoord: 17..446
IPR001623DnaJ domainPRINTSPR00625JDOMAINcoord: 392..407
score: 43.16
coord: 414..434
score: 51.25
coord: 374..392
score: 52.53
IPR001623DnaJ domainSMARTSM00271dnaj_3coord: 371..434
e-value: 2.0E-26
score: 103.8
IPR001623DnaJ domainPFAMPF00226DnaJcoord: 372..439
e-value: 2.3E-22
score: 78.9
IPR001623DnaJ domainPROSITEPS50076DNAJ_2coord: 372..442
score: 19.673
IPR001623DnaJ domainCDDcd06257DnaJcoord: 372..431
e-value: 4.82249E-20
score: 81.4377
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 285..318
e-value: 1.7E-5
score: 34.3
coord: 16..49
e-value: 0.0031
score: 26.7
coord: 201..234
e-value: 0.0013
score: 28.1
coord: 84..117
e-value: 36.0
score: 10.1
coord: 50..83
e-value: 29.0
score: 10.9
coord: 247..280
e-value: 0.0043
score: 26.3
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 247..280
score: 10.207
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 50..83
score: 6.195
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 201..234
score: 9.381
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 84..117
score: 6.195
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 285..318
score: 9.263
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 16..49
score: 10.03
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 16..369
e-value: 2.0E-78
score: 266.2
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 18..348
IPR013105Tetratricopeptide repeat 2PFAMPF07719TPR_2coord: 252..280
e-value: 2.2E-5
score: 24.2
coord: 202..234
e-value: 1.1E-5
score: 25.2
coord: 285..318
e-value: 1.6E-5
score: 24.6
IPR036869Chaperone J-domain superfamilyGENE3DG3DSA:1.10.287.110coord: 370..484
e-value: 7.2E-27
score: 96.1
IPR036869Chaperone J-domain superfamilySUPERFAMILYSSF46565Chaperone J-domaincoord: 366..481
IPR018253DnaJ domain, conserved sitePROSITEPS00636DNAJ_1coord: 419..438
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 16..352
score: 34.255