Thioredoxin-like protein

Overview
NameThioredoxin-like protein
Smed IDSMED30031155
Length (bp)1542
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Thioredoxin-like protein (SMED30031155) t-SNE clustered cells

Violin plots show distribution of expression levels for Thioredoxin-like protein (SMED30031155) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Thioredoxin-like protein (SMED30031155) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Thioredoxin-like protein (SMED30031155) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031155

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031155SMESG000033891.1 SmedASXL_013647SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30031155SMESG000033891.1 dd_Smed_v4_12826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031155SMESG000033891.1 dd_Smed_v4_12826_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30031155SMESG000033891.1 dd_Smed_v4_12826_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Thioredoxin-like protein vs. Ensembl Human
Match: TXN (thioredoxin [Source:HGNC Symbol;Acc:HGNC:12435])

HSP 1 Score: 70.0922 bits (170), Expect = 3.936e-14
Identity = 38/80 (47.50%), Postives = 44/80 (55.00%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKV 424
            L+VV F A WC  CK I PF   LS  +SNV FL VDV+    +A    V  MPTF F K   KV E  GAN   LE+ +
Sbjct:   22 LVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATI 101          
BLAST of Thioredoxin-like protein vs. Ensembl Human
Match: GLRX3 (glutaredoxin 3 [Source:HGNC Symbol;Acc:HGNC:15987])

HSP 1 Score: 68.9366 bits (167), Expect = 3.886e-12
Identity = 30/90 (33.33%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  167 KMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYS 436
            ++  KSL+VV F+A W   C  ++  + +L+     V F+ ++ E  P ++E Y + ++PTF+F K+  K+D L GA+A  L  KV+ ++
Sbjct:   27 RLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHA 116          
BLAST of Thioredoxin-like protein vs. Ensembl Human
Match: GLRX3 (glutaredoxin 3 [Source:HGNC Symbol;Acc:HGNC:15987])

HSP 1 Score: 68.9366 bits (167), Expect = 3.886e-12
Identity = 30/90 (33.33%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  167 KMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYS 436
            ++  KSL+VV F+A W   C  ++  + +L+     V F+ ++ E  P ++E Y + ++PTF+F K+  K+D L GA+A  L  KV+ ++
Sbjct:   27 RLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHA 116          
BLAST of Thioredoxin-like protein vs. Ensembl Human
Match: GLRX3 (glutaredoxin 3 [Source:HGNC Symbol;Acc:HGNC:15987])

HSP 1 Score: 68.9366 bits (167), Expect = 3.886e-12
Identity = 30/90 (33.33%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  167 KMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYS 436
            ++  KSL+VV F+A W   C  ++  + +L+     V F+ ++ E  P ++E Y + ++PTF+F K+  K+D L GA+A  L  KV+ ++
Sbjct:   27 RLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHA 116          
BLAST of Thioredoxin-like protein vs. Ensembl Human
Match: TXNL1 (thioredoxin like 1 [Source:HGNC Symbol;Acc:HGNC:12436])

HSP 1 Score: 62.003 bits (149), Expect = 4.987e-10
Identity = 33/104 (31.73%), Postives = 54/104 (51.92%), Query Frame = 2
Query:  122 INSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            + S+  +  E+  A       L VV F  + C  C  I+P    +S  +    FL VDV +    A   N+ A PTF+F +++ ++D+ +GA+A GLE K+K +
Sbjct:    3 VGSDPDFQPELSGAGS----RLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQH 102          
BLAST of Thioredoxin-like protein vs. Ensembl Celegans
Match: png-1 (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase [Source:UniProtKB/Swiss-Prot;Acc:Q9TW67])

HSP 1 Score: 77.0258 bits (188), Expect = 1.233e-14
Identity = 31/83 (37.35%), Postives = 51/83 (61.45%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            LI++ F+A WC  C+ ISP   + S  + N  FL V+ +    I + YN+ AMPTF+F+K+  +VD ++GAN   +  K++ +
Sbjct:   24 LIIIDFFANWCGPCRMISPIFEQFSAEYGNATFLKVNCDVARDIVQRYNISAMPTFIFLKNRQQVDMVRGANQQAIAEKIRQH 106          
BLAST of Thioredoxin-like protein vs. Ensembl Celegans
Match: trx-1 (Thioredoxin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09433])

HSP 1 Score: 63.1586 bits (152), Expect = 5.302e-12
Identity = 28/82 (34.15%), Postives = 47/82 (57.32%), Query Frame = 2
Query:  179 KSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKV 424
            + +I++ FYA WC  CK I+P  ++L+     + F  VDV++   +   Y+V  MPTF+F K+ + ++ L+G     L  KV
Sbjct:   27 EKIIILDFYATWCGPCKAIAPLYKELATTHKGIIFCKVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDELRQKV 108          
BLAST of Thioredoxin-like protein vs. Ensembl Celegans
Match: trx-1 (Thioredoxin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09433])

HSP 1 Score: 62.7734 bits (151), Expect = 5.588e-12
Identity = 28/83 (33.73%), Postives = 47/83 (56.63%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            +I++ FYA WC  CK I+P  ++L+     + F  VDV++   +   Y+V  MPTF+F K+ + ++ L+G     L  KV  +
Sbjct:   28 IIILDFYATWCGPCKAIAPLYKELATTHKGIIFCKVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDELRQKVLEH 110          
BLAST of Thioredoxin-like protein vs. Ensembl Celegans
Match: Y55F3AR.2 (pep chromosome:WBcel235:IV:1094545:1096723:1 gene:WBGene00021933.1 transcript:Y55F3AR.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AR.2)

HSP 1 Score: 62.7734 bits (151), Expect = 7.748e-11
Identity = 38/124 (30.65%), Postives = 59/124 (47.58%), Query Frame = 2
Query:  107 MNLIDINSESQYN--FEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLK 472
            M +I +N +S ++  F   N         + V F A WC  C+ I+P    L+  +    FL VDV++    A  Y V AMPTF+   +  K   ++GA+ SGL S V  Y+   +  +G   +
Sbjct:    1 MPVIVVNGDSDFDRKFSAGNGKA------VFVDFTASWCGPCQYIAPIFSDLANQYKGSVFLKVDVDECRGTAATYGVNAMPTFIAFVNGQKKATIQGADESGLRSMVAKYASTSAAWSGTGQR 118          
BLAST of Thioredoxin-like protein vs. Ensembl Celegans
Match: txl-1 (ThioredoXin-Like; Thioredoxin-like protein; Thioredoxin-like protein TXL [Source:UniProtKB/TrEMBL;Acc:G5EES9])

HSP 1 Score: 62.003 bits (149), Expect = 1.936e-10
Identity = 38/110 (34.55%), Postives = 60/110 (54.55%), Query Frame = 2
Query:  107 MNLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYS 436
            M +I++  +  +  ++  A    LKS ++V F A WC  CK I+P    LS  +    FL VDVE     +    V +MPTF+  +   +V+++KGA+A  LE+ VK Y+
Sbjct:    1 MPVINVKDDEDFRNQLSLAG---LKS-VIVDFTAVWCGPCKMIAPTFEALSNQYLGAVFLKVDVEICEKTSSENGVNSMPTFMVFQSGVRVEQMKGADAKALETMVKKYA 106          
BLAST of Thioredoxin-like protein vs. Ensembl Fly
Match: Trx-2 (gene:FBgn0040070 transcript:FBtr0079840)

HSP 1 Score: 75.485 bits (184), Expect = 2.288e-16
Identity = 41/82 (50.00%), Postives = 55/82 (67.07%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFS-NVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVK 427
            L+V+ F+A WC  CK ISP + +LS  F+ NV  L VDV++   IA  YN+ +MPTFVF+K+  KV+E  GANA  LE  +K
Sbjct:   22 LVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIK 103          
BLAST of Thioredoxin-like protein vs. Ensembl Fly
Match: Trx-2 (gene:FBgn0040070 transcript:FBtr0079839)

HSP 1 Score: 75.485 bits (184), Expect = 2.288e-16
Identity = 41/82 (50.00%), Postives = 55/82 (67.07%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFS-NVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVK 427
            L+V+ F+A WC  CK ISP + +LS  F+ NV  L VDV++   IA  YN+ +MPTFVF+K+  KV+E  GANA  LE  +K
Sbjct:   22 LVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIK 103          
BLAST of Thioredoxin-like protein vs. Ensembl Fly
Match: Txl (gene:FBgn0035631 transcript:FBtr0077098)

HSP 1 Score: 78.9518 bits (193), Expect = 6.082e-16
Identity = 40/109 (36.70%), Postives = 60/109 (55.05%), Query Frame = 2
Query:  107 MNLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            M++  IN ES +  E+  A       L+VV F A WC  CK I+P        +    FL VDV+K    A    V AMPTF+F ++  K+D ++GA+ +GLE+K++ +
Sbjct:    1 MSVRVINDESHFQAELAQAGI----QLVVVDFTASWCGPCKRIAPIFETFPTKYPKAIFLKVDVDKCQDTAAGQGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEH 105          
BLAST of Thioredoxin-like protein vs. Ensembl Fly
Match: TrxT (gene:FBgn0029752 transcript:FBtr0070755)

HSP 1 Score: 62.3882 bits (150), Expect = 2.550e-11
Identity = 34/86 (39.53%), Postives = 53/86 (61.63%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFSN-VKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSG 439
            L+V+ FYA WC  CK I+P + +L+  +S+ V  L V+V++   I   YNV +MPTFVFIK  N ++   G N+  L   ++ ++G
Sbjct:   22 LVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHAG 107          
BLAST of Thioredoxin-like protein vs. Ensembl Fly
Match: TrxT (gene:FBgn0029752 transcript:FBtr0340478)

HSP 1 Score: 62.3882 bits (150), Expect = 2.550e-11
Identity = 34/86 (39.53%), Postives = 53/86 (61.63%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFSN-VKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSG 439
            L+V+ FYA WC  CK I+P + +L+  +S+ V  L V+V++   I   YNV +MPTFVFIK  N ++   G N+  L   ++ ++G
Sbjct:   22 LVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHAG 107          
BLAST of Thioredoxin-like protein vs. Ensembl Zebrafish
Match: TXN (zgc:56493 [Source:ZFIN;Acc:ZDB-GENE-030131-8581])

HSP 1 Score: 69.3218 bits (168), Expect = 4.673e-14
Identity = 36/85 (42.35%), Postives = 53/85 (62.35%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVA--FSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            L+VV F A WC  C++I+PF + LS    +SNV FL VDV+    +A++  +  MPTF F K+  K+D+  G+N + LE  VK +
Sbjct:   22 LVVVDFTATWCGPCQSIAPFYKGLSENPDYSNVVFLKVDVDDAQDVAQSCEIKCMPTFHFYKNGKKLDDFSGSNQTKLEEMVKQH 106          
BLAST of Thioredoxin-like protein vs. Ensembl Zebrafish
Match: txn (thioredoxin [Source:ZFIN;Acc:ZDB-GENE-040718-162])

HSP 1 Score: 68.5514 bits (166), Expect = 8.048e-14
Identity = 40/94 (42.55%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  158 NASKMPLKSLIVVCFYAKWCELCKTISPFVRKLS--VAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            NA K     L+VV F A WC  C+TI P+ + LS      NV FL VDV+    +A    +  MPTF F K+  KVDE  G+N S LE K+ ++
Sbjct:   11 NALKNAGDKLVVVDFTATWCGPCQTIGPYFKLLSEKPENKNVVFLKVDVDDAQDVAALCGISCMPTFHFYKNGKKVDEFSGSNQSKLEEKINSH 104          
BLAST of Thioredoxin-like protein vs. Ensembl Zebrafish
Match: txn (thioredoxin [Source:ZFIN;Acc:ZDB-GENE-040718-162])

HSP 1 Score: 68.5514 bits (166), Expect = 8.080e-14
Identity = 40/94 (42.55%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  158 NASKMPLKSLIVVCFYAKWCELCKTISPFVRKLS--VAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            NA K     L+VV F A WC  C+TI P+ + LS      NV FL VDV+    +A    +  MPTF F K+  KVDE  G+N S LE K+ ++
Sbjct:   13 NALKNAGDKLVVVDFTATWCGPCQTIGPYFKLLSEKPENKNVVFLKVDVDDAQDVAALCGISCMPTFHFYKNGKKVDEFSGSNQSKLEEKINSH 106          
BLAST of Thioredoxin-like protein vs. Ensembl Zebrafish
Match: txnl1 (thioredoxin-like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-701])

HSP 1 Score: 68.5514 bits (166), Expect = 2.800e-12
Identity = 39/104 (37.50%), Postives = 56/104 (53.85%), Query Frame = 2
Query:  122 INSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            I ++S +  E+  A       L VV F    C  C  I+P    LS  +  V FL VDV      A A N+ A PTF+F +++ +VD+ +GA+ASGLE K+K +
Sbjct:    7 IGNDSDFQAELSGAGS----RLTVVKFTMSGCRPCVRIAPAFNMLSNKYPQVVFLEVDVHVCQATAAANNISATPTFLFFRNKVRVDQYQGADASGLEEKIKQH 106          
BLAST of Thioredoxin-like protein vs. Ensembl Zebrafish
Match: txnl1 (thioredoxin-like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-701])

HSP 1 Score: 68.1662 bits (165), Expect = 3.149e-12
Identity = 39/104 (37.50%), Postives = 56/104 (53.85%), Query Frame = 2
Query:  122 INSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            I ++S +  E+  A       L VV F    C  C  I+P    LS  +  V FL VDV      A A N+ A PTF+F +++ +VD+ +GA+ASGLE K+K +
Sbjct:    7 IGNDSDFQAELSGAGS----RLTVVKFTMSGCRPCVRIAPAFNMLSNKYPQVVFLEVDVHVCQATAAANNISATPTFLFFRNKVRVDQYQGADASGLEEKIKQH 106          
BLAST of Thioredoxin-like protein vs. Ensembl Xenopus
Match: ENSXETT00000029198.1 (MGC80314 protein [Source:NCBI gene;Acc:100170420])

HSP 1 Score: 69.707 bits (169), Expect = 4.871e-14
Identity = 41/94 (43.62%), Postives = 51/94 (54.26%), Query Frame = 2
Query:  149 EVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKN 430
            E  N  K     L+VV F A WC  CK ISP   KLSV   +V F+ VDV+    +A   +V  MPTF F K+  KV E  GAN + L  KV++
Sbjct:   10 EFQNILKEAGDKLVVVDFTATWCGPCKMISPVFEKLSVENPDVVFIKVDVDDAQDVAAHCDVKCMPTFHFYKNGQKVHEFSGANQASLIQKVQD 103          
BLAST of Thioredoxin-like protein vs. Ensembl Xenopus
Match: glrx3 (glutaredoxin 3 [Source:NCBI gene;Acc:549963])

HSP 1 Score: 68.9366 bits (167), Expect = 4.233e-12
Identity = 33/108 (30.56%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  113 LIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYS 436
            +++  S  Q+   + N++K    SL VV F+A W   C  ++  + +L+     V F+ ++ E  P ++E Y V ++PTF+F K+  K+D L GA+A  L  +V+ ++
Sbjct:    4 VLEAGSAGQFEQLIQNSAK----SLTVVHFWAPWAPQCTQMNEVMAELAKEQPQVMFVKLEAEAVPEVSEKYEVTSVPTFLFFKNSQKIDRLDGAHAPELTKRVQRHA 107          
BLAST of Thioredoxin-like protein vs. Ensembl Xenopus
Match: glrx3 (glutaredoxin 3 [Source:NCBI gene;Acc:549963])

HSP 1 Score: 68.1662 bits (165), Expect = 6.531e-12
Identity = 33/108 (30.56%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  113 LIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYS 436
            +++  S  Q+   + N++K    SL VV F+A W   C  ++  + +L+     V F+ ++ E  P ++E Y V ++PTF+F K+  K+D L GA+A  L  +V+ ++
Sbjct:    4 VLEAGSAGQFEQLIQNSAK----SLTVVHFWAPWAPQCTQMNEVMAELAKEQPQVMFVKLEAEAVPEVSEKYEVTSVPTFLFFKNSQKIDRLDGAHAPELTKRVQRHA 107          
BLAST of Thioredoxin-like protein vs. Ensembl Xenopus
Match: txnl1 (thioredoxin like 1 [Source:NCBI gene;Acc:448593])

HSP 1 Score: 66.6254 bits (161), Expect = 1.557e-11
Identity = 34/83 (40.96%), Postives = 49/83 (59.04%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            L VV F  K C  C  I+P    LS  +    FL VDV +    A A N+ A PTF+F +++ K+D+ +GA+A+GLE K+K +
Sbjct:   24 LSVVKFTMKGCAPCVRIAPAFTSLSNKYPQAIFLEVDVHQCQATATANNISATPTFLFFRNKVKIDQYQGADAAGLEDKIKQH 106          
BLAST of Thioredoxin-like protein vs. Ensembl Xenopus
Match: txnl1 (thioredoxin like 1 [Source:NCBI gene;Acc:448593])

HSP 1 Score: 66.2402 bits (160), Expect = 2.138e-11
Identity = 34/83 (40.96%), Postives = 49/83 (59.04%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            L VV F  K C  C  I+P    LS  +    FL VDV +    A A N+ A PTF+F +++ K+D+ +GA+A+GLE K+K +
Sbjct:   24 LSVVKFTMKGCAPCVRIAPAFTSLSNKYPQAIFLEVDVHQCQATATANNISATPTFLFFRNKVKIDQYQGADAAGLEDKIKQH 106          
BLAST of Thioredoxin-like protein vs. Ensembl Mouse
Match: Txn1 (thioredoxin 1 [Source:MGI Symbol;Acc:MGI:98874])

HSP 1 Score: 70.0922 bits (170), Expect = 2.549e-14
Identity = 38/84 (45.24%), Postives = 45/84 (53.57%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYS 436
            L+VV F A WC  CK I PF   L   +SNV FL VDV+    +A    V  MPTF F K   KV E  GAN   LE+ +  Y+
Sbjct:   22 LVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVDDCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA 105          
BLAST of Thioredoxin-like protein vs. Ensembl Mouse
Match: Glrx3 (glutaredoxin 3 [Source:MGI Symbol;Acc:MGI:1353653])

HSP 1 Score: 68.1662 bits (165), Expect = 4.843e-12
Identity = 31/89 (34.83%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  167 KMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            ++  KSL+VV F+A W   C  ++  + +L+    +V F+ ++ E  P ++E Y + ++PTF+F K+  KVD L GA+A  L  KV+ +
Sbjct:   29 RLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRH 117          
BLAST of Thioredoxin-like protein vs. Ensembl Mouse
Match: Glrx3 (glutaredoxin 3 [Source:MGI Symbol;Acc:MGI:1353653])

HSP 1 Score: 68.1662 bits (165), Expect = 7.536e-12
Identity = 31/89 (34.83%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  167 KMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            ++  KSL+VV F+A W   C  ++  + +L+    +V F+ ++ E  P ++E Y + ++PTF+F K+  KVD L GA+A  L  KV+ +
Sbjct:   29 RLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRH 117          
BLAST of Thioredoxin-like protein vs. Ensembl Mouse
Match: Txnl1 (thioredoxin-like 1 [Source:MGI Symbol;Acc:MGI:1860078])

HSP 1 Score: 62.003 bits (149), Expect = 3.581e-10
Identity = 33/104 (31.73%), Postives = 54/104 (51.92%), Query Frame = 2
Query:  122 INSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            + S+  +  E+  A       L VV F  + C  C  I+P    +S  +    FL VDV +    A   N+ A PTF+F +++ ++D+ +GA+A GLE K+K +
Sbjct:    7 VGSDPDFQPELSGAGS----RLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQH 106          
BLAST of Thioredoxin-like protein vs. Ensembl Mouse
Match: Txnl1 (thioredoxin-like 1 [Source:MGI Symbol;Acc:MGI:1860078])

HSP 1 Score: 62.003 bits (149), Expect = 3.585e-10
Identity = 33/104 (31.73%), Postives = 54/104 (51.92%), Query Frame = 2
Query:  122 INSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            + S+  +  E+  A       L VV F  + C  C  I+P    +S  +    FL VDV +    A   N+ A PTF+F +++ ++D+ +GA+A GLE K+K +
Sbjct:    7 VGSDPDFQPELSGAGS----RLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQH 106          
BLAST of Thioredoxin-like protein vs. UniProt/SwissProt
Match: sp|O97508|THIO_HORSE (Thioredoxin OS=Equus caballus OX=9796 GN=TXN PE=3 SV=3)

HSP 1 Score: 75.485 bits (184), Expect = 2.276e-15
Identity = 44/103 (42.72%), Postives = 56/103 (54.37%), Query Frame = 2
Query:  122 INSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKN 430
            I S+S +   +++A +     L+VV F A WC  CK I PF   LS  +SNV FL VDV+    +A    V  MPTF F K   KVDE  GAN   LE+ +K 
Sbjct:    5 IESKSAFQEALNSAGE----KLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVDDCQDVAAECEVKCMPTFQFFKKGQKVDEFSGANKEKLEATIKG 103          
BLAST of Thioredoxin-like protein vs. UniProt/SwissProt
Match: sp|Q9V429|THIO2_DROME (Thioredoxin-2 OS=Drosophila melanogaster OX=7227 GN=Trx-2 PE=1 SV=3)

HSP 1 Score: 75.485 bits (184), Expect = 2.293e-15
Identity = 41/82 (50.00%), Postives = 55/82 (67.07%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFS-NVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVK 427
            L+V+ F+A WC  CK ISP + +LS  F+ NV  L VDV++   IA  YN+ +MPTFVF+K+  KV+E  GANA  LE  +K
Sbjct:   22 LVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIK 103          
BLAST of Thioredoxin-like protein vs. UniProt/SwissProt
Match: sp|Q6XHI1|THIO2_DROYA (Thioredoxin-2 OS=Drosophila yakuba OX=7245 GN=Trx-2 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.897e-15
Identity = 43/103 (41.75%), Postives = 63/103 (61.17%), Query Frame = 2
Query:  122 INSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSN-VKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVK 427
            I  ++  N ++  AS      L+V+ F+A WC  CK ISP + +LS  +++ V  L VDV++   IA  YN+ +MPTFVF+K+  KV+E  GANA  LE  +K
Sbjct:    5 IKDKADLNGQLTKASG----KLVVLDFFATWCGPCKMISPKLAELSTQYADTVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAQRLEDVIK 103          
BLAST of Thioredoxin-like protein vs. UniProt/SwissProt
Match: sp|P29429|THIO_EMENI (Thioredoxin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=TRX1 PE=1 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 7.164e-15
Identity = 36/102 (35.29%), Postives = 58/102 (56.86%), Query Frame = 2
Query:  122 INSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVK 427
            I S++++  +V NA     K  +VV  +A WC  CK I+P V K +  +++  F  +DV++   +A    + AMPTF+  KD  KV ++ GAN   LE+ +K
Sbjct:   10 ITSKAEFQEKVLNA-----KGFVVVDCFATWCGPCKAIAPTVEKFAQTYTDASFYQIDVDELSEVAAELGIRAMPTFLLFKDGQKVSDVVGANPGALEAGIK 106          
BLAST of Thioredoxin-like protein vs. UniProt/SwissProt
Match: sp|O65049|TRXH_PICMA (Thioredoxin H-type OS=Picea mariana OX=3335 GN=SB09 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 7.276e-15
Identity = 37/82 (45.12%), Postives = 50/82 (60.98%), Query Frame = 2
Query:  179 KSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKV 424
            K L+ V F A WC  C+ I P   +LS  F  + FL VDV++   +A+ ++V AMPTF+FIKD   VD++ GA    LE KV
Sbjct:   26 KRLVAVDFTATWCGPCRVIGPVFVELSKKFPEIFFLKVDVDELRDVAQEWDVEAMPTFIFIKDGKAVDKVVGAKKDDLERKV 107          
BLAST of Thioredoxin-like protein vs. TrEMBL
Match: A0A0C2JI12 (DDE_3 domain-containing protein OS=Thelohanellus kitauei OX=669202 GN=RF11_01522 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 4.222e-28
Identity = 77/264 (29.17%), Postives = 139/264 (52.65%), Query Frame = 3
Query:  732 RTQFKSKKLSEKHIFEIRNWLKGNCAMTLKEIQTELSEKFDISISENTINKVIPNFHFSIKRFS---GSSNLEFAPNLNDERKNFCSCVLNALKNNQE--IVFIDESSFKISTRHFHKKSQFLSSVKEKNSNLKIKNQTIFAAISPTGLVHWKSFDDFENQNYLKEFFDEIMLLVFDAGQKNVVFIFNNLTNENCAEIQNIIKSNGHEFVVLPSLSSDFNPVEDLFFQWESVIRNCAFENEQQLWNFITNIRDIVTSSEFCNYF 1508
            R   + +KL+E     I++W+  N  + L+ I T++ E+ DIS+ ++TI++++  FH+S KR S      N E   N+   R+ + +  L  L++ +E   +FIDE    IS R  H +S+  S       NL+ +N +I AA++  G++  K  D   N++    + DE++  +     ++   + +N++  +C EI   I   GH  + LP  S   NP+E++F +W+  IR    EN ++L+  IT    ++TSS+   Y+
Sbjct:   56 RGYIQPEKLNEDQKERIKSWVDDNAGIPLRTIVTKVQEEMDISVGKSTIDRILQRFHYSWKRVSIIPERRNNESTLNI---RERYATRYLELLQSFREHQFIFIDECGVNISMRTSHGRSKIGSPAIHVVPNLRSRNISICAAMNVNGMLLHKWHDRAFNRDLFGNYIDELLEKIRALNIEHATIVMDNVSFHHCEEISQQISEAGHTLLFLPPYSPFMNPIENMFSKWKREIRYRRSENSEELYQNITAASSLITSSDCSGYY 316          
BLAST of Thioredoxin-like protein vs. TrEMBL
Match: A0A0C2N3A1 (DDE_3 domain-containing protein OS=Thelohanellus kitauei OX=669202 GN=RF11_01274 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 3.012e-27
Identity = 72/255 (28.24%), Postives = 134/255 (52.55%), Query Frame = 3
Query:  780 IRNWLKGNCAMTLKEIQTELSEKFDISISENTINKVIPNFHFSIKRFSGSSNLEFAPNLNDERKNFCSCVLNALKNNQE--IVFIDESSFKISTRHFHKKSQFLSSVKEKNSNLKIKNQTIFAAISPTGLVHWKSFDDFENQNYLKEFFDEIMLLVFDAGQKNVVFIFNNLTNENCAEIQNIIKSNGHEFVVLPSLSSDFNPVEDLFFQWESVIRNCAFENEQQLWNFITNIRDIVTSSEFCNYFQ---SSIDKC 1529
            I++W+  N  + L+ I T++ E+ DIS+ ++TI++++  FH+S KR S         +  + R+ + +  L  L++ +E   +FIDE    IS R  H +S+  S       NL+ +N +I AA++  G++  K  D   N++    + DE++  +     ++   + +N++  +C EI   I   GH  + LP  S   NP+E++F +W+  IR    EN ++L+  IT    ++TSS+   Y+      I++C
Sbjct:    2 IKSWVDDNAGIPLRTIVTKVQEEMDISVGKSTIDRILQRFHYSWKRVSIIPERRNNESTLNIRERYATRYLELLQSFREHQFIFIDECGVNISMRTSHGRSKIGSPAIHVVPNLRSRNISICAAMNVNGMLLHKWHDRAFNRDLFGNYIDELLEKIRALNIEHATIVMDNVSFHHCEEISQQISEAGHTLLFLPPYSPFMNPIENMFSKWKREIRYRRSENSEELYQNITAASSLITSSDCSGYYSHMFRYINRC 256          
BLAST of Thioredoxin-like protein vs. TrEMBL
Match: A0A0C2I6K5 (DDE_3 domain-containing protein OS=Thelohanellus kitauei OX=669202 GN=RF11_14809 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 2.233e-25
Identity = 79/277 (28.52%), Postives = 143/277 (51.62%), Query Frame = 3
Query:  732 RTQFKSKKLSEKHIFEIRNWLKGNCAMTLKEIQTELSEKFDISISENTINKVIPNFHFSIKRFSGSSNLEFAPNLNDERKNFCSCVLNALKNNQE--IVFIDESSFKISTRHFHKKSQFLSSVKEKNSNLKIKNQTIFAAISPTGLVHWKSFDDFENQNYLKEFFDEIMLLVFDAGQKNVVFIFNNLTNENCAEIQNIIKSNGHEFVVLPSLSSDFNPVEDLFFQWESVIRNCAFENEQQLWNFITNIRDIVTSSEFCNYFQSS----IDKC-RMEI 1541
            R   K +KL E     I++W+  N  + L+   T++ E+ DIS+ ++T+++++ +FH+S KR S         +  + R+ + +  L  L++ +E   +FI E    IS    H +S+  S       NL+  N +I AA++  G++  K  D   N++    +FDE++  +     ++   + +N++  +C EI   I   GH  + LP  S   NP+E++F +W+  IRN   EN  +L+  IT    ++TSS+ C+ + S     I++C R EI
Sbjct:   33 RGYIKPEKLKEYQKEIIKSWIDDNAGIPLRTNVTKVQEEMDISVGKSTMDRILQSFHYSWKRLSIIPERRNNVSTLNIRERYATGYLELLQSFREHQFIFIVECGVNISMITSHGRSKIGSPAIYVVPNLRSSNISIIAAMNVNGMLLHKWHDQAFNRDLFGYYFDELLEKIRALNIEHATIVMDNVSFHHCEEISQQISEAGHTLLFLPPYSPFMNPIENMFSKWKGEIRNMRSENSGELYPNITAASSLITSSD-CSGYDSHMFRYINRCLRREI 308          
BLAST of Thioredoxin-like protein vs. TrEMBL
Match: A0A0C2N268 (DDE_3 domain-containing protein OS=Thelohanellus kitauei OX=669202 GN=RF11_14042 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 5.220e-25
Identity = 65/226 (28.76%), Postives = 121/226 (53.54%), Query Frame = 3
Query:  780 IRNWLKGNCAMTLKEIQTELSEKFDISISENTINKVIPNFHFSIKRFSGSSNLEFAPNLNDERKNFCSCVLNALKNNQE--IVFIDESSFKISTRHFHKKSQFLSSVKEKNSNLKIKNQTIFAAISPTGLVHWKSFDDFENQNYLKEFFDEIMLLVFDAGQKNVVFIFNNLTNENCAEIQNIIKSNGHEFVVLPSLSSDFNPVEDLFFQWESVIRNCAFENEQQLW 1451
            I++W+  N  + L+ I T++ E+ DIS+ ++TI++++  FH+S KR S         +  + R+ + +  L  L++ +E   +FIDE    IS R  H +S+  S       NL+ +N +I AA++  G++  K  D   N++    + DE++  +     ++   + +N++  +C EI   I   GH  + LP  S   NP+E++F +W+  IRN   EN ++L+
Sbjct:    2 IKSWVDDNAGIPLRTIVTKVQEEMDISVGKSTIDRILQRFHYSWKRVSIIPERRNNESTLNIRERYATRYLELLQSFREHQFIFIDECGVNISMRTSHGRSKIGSPAIHVVPNLRSRNISICAAMNVNGMLLHKWHDRAFNRDLFGNYIDELLEKIRALNIEHATIVMDNVSFHHCEEISQQISEAGHTLLFLPPYSPFMNPIENMFSKWKGEIRNMRSENSEELY 227          
BLAST of Thioredoxin-like protein vs. TrEMBL
Match: A0A0C2ITH7 (DDE_3 domain-containing protein OS=Thelohanellus kitauei OX=669202 GN=RF11_01079 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.387e-20
Identity = 72/258 (27.91%), Postives = 127/258 (49.22%), Query Frame = 3
Query:  780 IRNWLKGNCAMTLKEIQTELSEKFDISISENTINKVIPNFHFSIKRFSGSSNLEFAPNLNDERKNFCSCVLNALKNNQEIVFIDESSFKISTRHFHKKSQFLSSVKEKNS--NLKIKNQTIFAAISPTGLVHWKSFDDFENQNYLKEFFDEIMLLVFDAGQKNVVFIFNNLTNENCAEIQNIIKSNGHEFVVLPSLSSDFNPVEDLFFQWESVIRNCAFENEQQLWNFITNIRDIVTSSE---FCNYFQSSIDKCRME 1538
            +  W+  +C ++L EIQ +    F + IS +T+++++  FHF+IK  S             +RK + +  LN +  NQ+I F+ E  F+ STR   KK +  +  KE  +  N++ KN +I AA+S   L  +   +   N      F D+ +  +  +G  N V + + L       I   ++S+GH  + LP  SS  NP++++F QW+  + +   ENE  L + I      +T  +   + N+ +S I +C+ E
Sbjct:   86 VLTWVDEDCLLSLSEIQAKCYTDFGLKISTSTLSRILKGFHFTIKIISVHPERRNDTITISKRKQYANGFLNLMNLNQKIFFLGECRFRCSTR---KKGRSQAGTKEAVTVPNIQSKNYSISAALSANSLFFYHIKEVTCNTEVFSFFIDDFLAKLKQSGISNTVLVIDKLDFRKNRRIGRKVESHGHITLFLPPYSSFLNPIKNVFNQWKCHVTSSRPENETTLVHSINESMKFITPGDCIRYYNHMESYISRCKRE 340          
BLAST of Thioredoxin-like protein vs. Ensembl Cavefish
Match: zgc:56493 (thioredoxin-like [Source:NCBI gene;Acc:103040975])

HSP 1 Score: 65.4698 bits (158), Expect = 8.670e-13
Identity = 36/82 (43.90%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLS--VAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKV 424
            L+VV F A WC  C++I+PF + LS      NV FL VDV+    +A++  +  MPTF F K+  KVDE  G+N + LE  V
Sbjct:   22 LVVVDFTATWCGPCQSIAPFYKGLSEKPDNGNVVFLKVDVDDAQDVAQSCEIKCMPTFHFYKNGKKVDEFSGSNQAKLEELV 103          
BLAST of Thioredoxin-like protein vs. Ensembl Cavefish
Match: txn (thioredoxin-like [Source:NCBI gene;Acc:103039731])

HSP 1 Score: 63.1586 bits (152), Expect = 4.879e-12
Identity = 38/104 (36.54%), Postives = 55/104 (52.88%), Query Frame = 2
Query:  107 MNLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLS--VAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGL 412
            M +I+I  +  ++  + +A       L+VV F A WC  CK I+P+ ++LS     SNV FL VDV+    +A    +  MPTF F K+  K+DE  G N   L
Sbjct:    1 MPVIEIEDKDSFDKALRDAGS----KLVVVDFTATWCGPCKMIAPYYKELSDNPQNSNVVFLKVDVDDAQDVAAHCEIKCMPTFHFYKNGKKIDEFSGGNRDKL 100          
BLAST of Thioredoxin-like protein vs. Ensembl Cavefish
Match: txnl1 (thioredoxin like 1 [Source:NCBI gene;Acc:103021638])

HSP 1 Score: 66.2402 bits (160), Expect = 1.388e-11
Identity = 38/104 (36.54%), Postives = 58/104 (55.77%), Query Frame = 2
Query:  122 INSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            I +++++  E+ +A       L VV F    C  C  I+P    LS  +  V FL VDV      A A N+ A PTF+F +++ +VD+ +GA+ASGLE K+K +
Sbjct:    7 IANDAEFQPELASAGS----RLAVVKFTMAGCRPCLRIAPAFNMLSSKYPQVVFLEVDVHVCQGTAAANNISATPTFLFFRNKVRVDQYQGADASGLEDKIKQH 106          
BLAST of Thioredoxin-like protein vs. Ensembl Cavefish
Match: txnl1 (thioredoxin like 1 [Source:NCBI gene;Acc:103021638])

HSP 1 Score: 65.855 bits (159), Expect = 1.869e-11
Identity = 38/104 (36.54%), Postives = 58/104 (55.77%), Query Frame = 2
Query:  122 INSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            I +++++  E+ +A       L VV F    C  C  I+P    LS  +  V FL VDV      A A N+ A PTF+F +++ +VD+ +GA+ASGLE K+K +
Sbjct:    7 IANDAEFQPELASAGS----RLAVVKFTMAGCRPCLRIAPAFNMLSSKYPQVVFLEVDVHVCQGTAAANNISATPTFLFFRNKVRVDQYQGADASGLEDKIKQH 106          
BLAST of Thioredoxin-like protein vs. Ensembl Cavefish
Match: glrx3 (glutaredoxin 3 [Source:NCBI gene;Acc:449777])

HSP 1 Score: 61.2326 bits (147), Expect = 7.073e-10
Identity = 37/127 (29.13%), Postives = 62/127 (48.82%), Query Frame = 2
Query:  110 NLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKF-LNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLKKKEFL 487
            NL D  +  Q+   + NA +    SL VV F+A W   C  ++  +++L+           ++ E  P ++E Y + ++PTF+F K   K+D L GA+A  L +KV+  +       G+    KE L
Sbjct:   11 NLTDAATPKQFEELLKNAGR----SLTVVHFHAPWAPQCSQMNDVMKELAKEHKQTMLSWWLEAEAVPEVSEKYEISSVPTFLFFKGGEKIDRLDGAHAPELTNKVQRLASSGGGPAGVGDVPKEEL 133          
BLAST of Thioredoxin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009652.1 (pep scaffold:Pmarinus_7.0:GL478563:4231:10899:-1 gene:ENSPMAG00000008707.1 transcript:ENSPMAT00000009652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 6.979e-13
Identity = 38/82 (46.34%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKN 430
            L+V+ F A WC  CK ISP     +  + NV F  VDV+  P IAE  N+ AMPTF+F K+  KV E+ GAN   LE  +K+
Sbjct:   22 LVVIDFSATWCGPCKIISPIFHAFANEYHNVVFCVVDVDDAPDIAELCNIKAMPTFIFFKNNEKVGEVMGANKDHLEKTLKD 103          
BLAST of Thioredoxin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007779.1 (pep scaffold:Pmarinus_7.0:GL477155:15795:22678:-1 gene:ENSPMAG00000007027.1 transcript:ENSPMAT00000007779.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.874e-9
Identity = 27/84 (32.14%), Postives = 46/84 (54.76%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTI-SPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            LI++ F AKWC  C+ I  P+         N  F  VDV++   +  ++ +  MPTFVF KD  ++++L+G +   L  +++ Y
Sbjct:   22 LIILFFTAKWCGPCQQIKEPYHTMAEKEEYNAVFCEVDVDEAADLLSSFGINCMPTFVFFKDGIQLEKLEGGSQGNLRKRIEKY 105          
BLAST of Thioredoxin-like protein vs. Ensembl Sea Lamprey
Match: glrx3 (glutaredoxin 3 [Source:NCBI gene;Acc:449777])

HSP 1 Score: 55.8398 bits (133), Expect = 8.274e-9
Identity = 27/80 (33.75%), Postives = 44/80 (55.00%), Query Frame = 2
Query:  191 VVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKN 430
            +V F+A W   C  ++  + +L+     V F+ ++ E  P +A  +NV A+PTF+F K    V+ L GA+A  L  KV+ 
Sbjct:   11 LVHFWATWAPQCAQMNDVMEELATEHPAVSFVKLEAEAVPELALKHNVKAVPTFIFFKAGQPVERLDGAHAPELVKKVQQ 90          
BLAST of Thioredoxin-like protein vs. Ensembl Sea Lamprey
Match: txn2 (thioredoxin 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1795])

HSP 1 Score: 46.2098 bits (108), Expect = 4.320e-6
Identity = 26/71 (36.62%), Postives = 42/71 (59.15%), Query Frame = 2
Query:  188 IVVCFYAKWCELCKTISPFVRKLSVAFSNVKFL--NVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKG 394
            +VV F+A+WC  CK + P + KL VA  + K L   VD++    +A  Y V A+PT + +++ + VD+  G
Sbjct:   89 VVVDFHAQWCGPCKILGPRLEKL-VAKQSGKVLMAKVDIDDHTDLAVEYGVSAVPTVLAMRNGSVVDKFVG 158          
BLAST of Thioredoxin-like protein vs. Ensembl Yeast
Match: TRX3 (Mitochondrial thioredoxin; highly conserved oxidoreductase required to maintain the redox homeostasis of the cell, forms the mitochondrial thioredoxin system with Trr2p, redox state is maintained by both Trr2p and Glr1p [Source:SGD;Acc:S000000679])

HSP 1 Score: 73.559 bits (179), Expect = 2.263e-16
Identity = 34/81 (41.98%), Postives = 51/81 (62.96%), Query Frame = 2
Query:  188 IVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKN 430
            +V+ FYA WC  CK + P + KL  A+ +V+F+  DV++ P IA+   V AMPTFV  KD   + ++ GAN + LE  +K+
Sbjct:   46 LVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTALEKGIKD 126          
BLAST of Thioredoxin-like protein vs. Ensembl Yeast
Match: TRX2 (Cytoplasmic thioredoxin isoenzyme; part of thioredoxin system which protects cells against oxidative and reductive stress; forms LMA1 complex with Pbi2p; acts as a cofactor for Tsa1p; required for ER-Golgi transport and vacuole inheritance; with Trx1p, facilitates mitochondrial import of small Tims Tim9p, Tim10p, Tim13p by maintaining them in reduced form; abundance increases under DNA replication stress; TRX2 has a paralog, TRX1, that arose from the whole genome duplication [Source:SGD;Acc:S000003441])

HSP 1 Score: 63.929 bits (154), Expect = 3.405e-13
Identity = 31/101 (30.69%), Postives = 56/101 (55.45%), Query Frame = 2
Query:  122 INSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKV 424
            + S S+Y+  + +  K     L+VV F+A WC  CK I+P + K +  +S+  F  +DV++   +A+   V +MPT +F K   +V  + GAN + ++  +
Sbjct:    5 LKSASEYDSALASGDK-----LVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAI 100          
BLAST of Thioredoxin-like protein vs. Ensembl Yeast
Match: TRX1 (Cytoplasmic thioredoxin isoenzyme; part of thioredoxin system which protects cells against oxidative and reductive stress; forms LMA1 complex with Pbi2p; acts as a cofactor for Tsa1p; required for ER-Golgi transport and vacuole inheritance; with Trx2p, facilitates mitochondrial import of small Tims Tim9p, Tim10p, Tim13p by maintaining them in reduced form; abundance increases iunder DNA replication stress; TRX1 has a paralog, TRX2, that arose from the whole genome duplication [Source:SGD;Acc:S000004033])

HSP 1 Score: 62.003 bits (149), Expect = 1.719e-12
Identity = 29/87 (33.33%), Postives = 48/87 (55.17%), Query Frame = 2
Query:  164 SKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKV 424
            S +    L+VV FYA WC  CK I+P + K S  +    F  +DV++   +A+   V AMPT +  K+  +V ++ GAN + ++  +
Sbjct:   13 SAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAI 99          
BLAST of Thioredoxin-like protein vs. Ensembl Yeast
Match: GRX4 (Glutathione-dependent oxidoreductase; hydroperoxide and superoxide-radical responsive; monothiol glutaredoxin subfamily member along with Grx3p and Grx5p; protects cells from oxidative damage; with Grx3p, binds to Aft1p in iron-replete conditions, promoting its dissociation from promoters; mutant has increased aneuploidy tolerance; transcription regulated by Yap5p; GRX4 has a paralog, GRX3, that arose from the whole genome duplication [Source:SGD;Acc:S000000976])

HSP 1 Score: 59.6918 bits (143), Expect = 1.297e-10
Identity = 33/101 (32.67%), Postives = 60/101 (59.41%), Query Frame = 2
Query:  107 MNLIDINSESQY-NFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLS--VAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGAN 400
            M +++I S+ Q+      NA+      LIV+ F A+W + CKT+S  +  +S  V   +V+FL++D ++ P I++ + + A+P FVFI++   V E+  A+
Sbjct:    1 MTVVEIKSQDQFTQLTTTNAAN----KLIVLYFKAQWADPCKTMSQVLEAVSEKVRQEDVRFLSIDADEHPEISDLFEIAAVPYFVFIQNGTIVKEISAAD 97          
BLAST of Thioredoxin-like protein vs. Ensembl Yeast
Match: GRX3 (Glutathione-dependent oxidoreductase; hydroperoxide and superoxide-radical responsive; monothiol glutaredoxin subfamily member along with Grx4p and Grx5p; protects cells from oxidative damage; with Grx4p, binds to Aft1p in iron-replete conditions, promoting its dissociation from promoters; evidence exists indicating that the translation start site is not Met1 as currently annotated, but rather Met36; GRX3 has a paralog, GRX4, that arose from the whole genome duplication [Source:SGD;Acc:S000002505])

HSP 1 Score: 53.9138 bits (128), Expect = 1.366e-8
Identity = 31/100 (31.00%), Postives = 53/100 (53.00%), Query Frame = 2
Query:  107 MNLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLS--VAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGAN 400
            M +I+IN + Q+ +    A+      LIV+ F+  W E CK +      +S   + SNV FL++D ++   I+E + + A+P F+ I     + EL GA+
Sbjct:    1 MPVIEINDQEQFTYLTTTAAG---DKLIVLYFHTSWAEPCKALKQVFEAISNEPSNSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGAD 97          
BLAST of Thioredoxin-like protein vs. Ensembl Nematostella
Match: EDO33372 (Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7SSF5])

HSP 1 Score: 81.6481 bits (200), Expect = 5.414e-19
Identity = 41/105 (39.05%), Postives = 65/105 (61.90%), Query Frame = 2
Query:  110 NLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKV 424
            N+I +  +S ++ E+  A       L+V+ F A WC  CK+I+P    LS+ F +V FL VDV++  + AE+  + AMPTF F  ++ K+DEL+GA+   LE+K+
Sbjct:    6 NVIVVEDDSFFSVEIERAGS----RLVVIDFTATWCGPCKSIAPVFTNLSMKFMDVVFLKVDVDQCQLTAESCGIRAMPTFHFYHNKAKIDELRGADPGALENKI 106          
BLAST of Thioredoxin-like protein vs. Ensembl Nematostella
Match: EDO41852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A4])

HSP 1 Score: 75.485 bits (184), Expect = 3.633e-15
Identity = 40/103 (38.83%), Postives = 57/103 (55.34%), Query Frame = 2
Query:  131 ESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSG 439
            +SQ+  E+ NA       L+V  F A WC  CK+I+P    LS  +    FL +DV+    +A    V AMPTF F K++ KVDE++GA+   LE  +K + G
Sbjct:   15 DSQFTAELTNAGT----KLVVADFTASWCGPCKSIAPVYSGLSEKYKQAVFLKIDVDVCQELAAKQGVTAMPTFQFFKNKVKVDEVRGADPKALEDAIKKWIG 113          
BLAST of Thioredoxin-like protein vs. Ensembl Nematostella
Match: EDO45413 (Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7RT76])

HSP 1 Score: 61.2326 bits (147), Expect = 1.011e-11
Identity = 35/106 (33.02%), Postives = 61/106 (57.55%), Query Frame = 2
Query:  119 DINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVA-FSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNY 433
            +I   +++N  ++N        L+V+ FYA+WC  C+ I P  +K+++  F +V F  +DV++   ++E   + AMPTFVF K+  K+++L GAN   L   +  Y
Sbjct:   14 EIEERAEFNSVINNTKD----KLVVIDFYAEWCGPCRQIKPKFKKMALEEFKDVFFAKIDVDELEELSEDEQITAMPTFVFYKNGQKLEKLVGANEVKLRELILKY 115          
BLAST of Thioredoxin-like protein vs. Ensembl Nematostella
Match: EDO46139 (Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7RQN2])

HSP 1 Score: 55.4546 bits (132), Expect = 1.024e-9
Identity = 29/76 (38.16%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGL 412
            +  + F A WC  C+ I P   +++  F  VK   VDV+     AE+  + AMPTF F K+   VDE+ GA+ S L
Sbjct:   19 VAAIDFTATWCGPCRMIGPKFEEMAKEFKGVKCAKVDVDVNSETAESEGITAMPTFRFYKNGEMVDEVVGASESKL 94          
BLAST of Thioredoxin-like protein vs. Ensembl Nematostella
Match: EDO46379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQK5])

HSP 1 Score: 58.151 bits (139), Expect = 2.253e-9
Identity = 27/84 (32.14%), Postives = 49/84 (58.33%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYS 436
            + VV F+A W   C  ++  + +L+    +V F+ V+ EK P ++   N+ A+PT +  K++  VD + GANA  L  KV++++
Sbjct:    1 MAVVHFFAPWAPHCNQMNDVLEELAKENPHVNFIKVEAEKLPEVSYKNNINAVPTLLLFKNQKVVDRIDGANAPELTKKVEHHA 84          
BLAST of Thioredoxin-like protein vs. Ensembl Medaka
Match: txnl1 (thioredoxin like 1 [Source:NCBI gene;Acc:101158293])

HSP 1 Score: 68.5514 bits (166), Expect = 1.317e-12
Identity = 39/105 (37.14%), Postives = 57/105 (54.29%), Query Frame = 2
Query:  122 INSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYS 436
            I S+  +  E+  A       L+VV F    C  C  ISP    LS  + +V FL VDV      A A N+ A PTF+F ++  +VD+ +GA+A+GLE K+K ++
Sbjct:    7 IGSDPDFQPELAAAGS----RLVVVKFTMAGCRPCVRISPAFNALSNKYPHVVFLEVDVHVCQATAAANNISATPTFLFFRNRVRVDQYQGADAAGLEEKIKQHT 107          
BLAST of Thioredoxin-like protein vs. Ensembl Medaka
Match: glrx3 (glutaredoxin 3 [Source:NCBI gene;Acc:449777])

HSP 1 Score: 69.707 bits (169), Expect = 1.324e-12
Identity = 35/110 (31.82%), Postives = 62/110 (56.36%), Query Frame = 2
Query:  110 NLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSG 439
            N+++  S  Q+   +  A K    +L VV F A W   C  ++  + +L+ A ++  F+ ++ E  P ++E Y++ ++PTF+F K   KVD L GA+A+ L  KV+  +G
Sbjct:   10 NVLEATSRQQFEDFLAKAGK----NLAVVHFQAAWAPQCGDMNEVMAELAKAHAHATFVKLEAEAVPDVSEKYDISSVPTFIFFKGGEKVDRLDGAHAAELTKKVQGLAG 115          
BLAST of Thioredoxin-like protein vs. Ensembl Medaka
Match: txnl1 (thioredoxin like 1 [Source:NCBI gene;Acc:101158293])

HSP 1 Score: 68.5514 bits (166), Expect = 2.086e-12
Identity = 39/105 (37.14%), Postives = 57/105 (54.29%), Query Frame = 2
Query:  122 INSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYS 436
            I S+  +  E+  A       L+VV F    C  C  ISP    LS  + +V FL VDV      A A N+ A PTF+F ++  +VD+ +GA+A+GLE K+K ++
Sbjct:    7 IGSDPDFQPELAAAGS----RLVVVKFTMAGCRPCVRISPAFNALSNKYPHVVFLEVDVHVCQATAAANNISATPTFLFFRNRVRVDQYQGADAAGLEEKIKQHT 107          
BLAST of Thioredoxin-like protein vs. Ensembl Medaka
Match: ENSORLT00000009496.2 (thioredoxin [Source:NCBI gene;Acc:101173415])

HSP 1 Score: 60.077 bits (144), Expect = 6.185e-11
Identity = 36/83 (43.37%), Postives = 49/83 (59.04%), Query Frame = 2
Query:  185 LIVVCFYAKWCELCKTISPFVRKLSVAFSN--VKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVK 427
            L+VV F A WC  CK I+P  +++S +  N  V FL VDV++  + +    +  MPTF F K   KVDE  GAN + LE K+K
Sbjct:   22 LVVVDFTASWCGPCKQIAPLYKQMSESDDNKNVVFLKVDVDEADV-SVFCEIKCMPTFHFYKGGKKVDEFSGANVATLEEKLK 103          
BLAST of Thioredoxin-like protein vs. Ensembl Medaka
Match: pdia6 (protein disulfide isomerase family A member 6 [Source:NCBI gene;Acc:101171545])

HSP 1 Score: 54.299 bits (129), Expect = 1.920e-7
Identity = 35/116 (30.17%), Postives = 59/116 (50.86%), Query Frame = 2
Query:   65 CFTKCQINIIYYFSMNLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSN-VKFLNVDVEKFPIIAEAYNVIAMPTF-VFIKDENKVDELKGANAS 406
            C     +  +Y  S +++++ + S +N EV     M   SL +V FYA WC  C+ ++P  +K + A    VK   VD ++   +   Y V   PT  +F  ++NK +E +GA +S
Sbjct:   11 CSLLLSVEALYSPSDDVVEL-TPSNFNREV-----MQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKVGAVDADEHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGARSS 120          
BLAST of Thioredoxin-like protein vs. Planmine SMEST
Match: SMESG000033891.1 (SMESG000033891.1)

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 270/270 (100.00%), Postives = 270/270 (100.00%), Query Frame = 3
Query:  732 RTQFKSKKLSEKHIFEIRNWLKGNCAMTLKEIQTELSEKFDISISENTINKVIPNFHFSIKRFSGSSNLEFAPNLNDERKNFCSCVLNALKNNQEIVFIDESSFKISTRHFHKKSQFLSSVKEKNSNLKIKNQTIFAAISPTGLVHWKSFDDFENQNYLKEFFDEIMLLVFDAGQKNVVFIFNNLTNENCAEIQNIIKSNGHEFVVLPSLSSDFNPVEDLFFQWESVIRNCAFENEQQLWNFITNIRDIVTSSEFCNYFQSSIDKCRMEI 1541
            RTQFKSKKLSEKHIFEIRNWLKGNCAMTLKEIQTELSEKFDISISENTINKVIPNFHFSIKRFSGSSNLEFAPNLNDERKNFCSCVLNALKNNQEIVFIDESSFKISTRHFHKKSQFLSSVKEKNSNLKIKNQTIFAAISPTGLVHWKSFDDFENQNYLKEFFDEIMLLVFDAGQKNVVFIFNNLTNENCAEIQNIIKSNGHEFVVLPSLSSDFNPVEDLFFQWESVIRNCAFENEQQLWNFITNIRDIVTSSEFCNYFQSSIDKCRMEI
Sbjct:  195 RTQFKSKKLSEKHIFEIRNWLKGNCAMTLKEIQTELSEKFDISISENTINKVIPNFHFSIKRFSGSSNLEFAPNLNDERKNFCSCVLNALKNNQEIVFIDESSFKISTRHFHKKSQFLSSVKEKNSNLKIKNQTIFAAISPTGLVHWKSFDDFENQNYLKEFFDEIMLLVFDAGQKNVVFIFNNLTNENCAEIQNIIKSNGHEFVVLPSLSSDFNPVEDLFFQWESVIRNCAFENEQQLWNFITNIRDIVTSSEFCNYFQSSIDKCRMEI 464          

HSP 2 Score: 403.675 bits (1036), Expect = 0.000e+0
Identity = 198/203 (97.54%), Postives = 200/203 (98.52%), Query Frame = 2
Query:  107 MNLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLKKKEFLCPIKNEGSIKRKDRKHIPNDVRRKLIECLEKKICSRKEAAEIFGMPYTTVANIYKKYCTLNIMDPKVSKRFISKRL 715
            MNLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLKKKEFLCPIKNEGSIKRKDRKHIPNDVRRKLIECLEKKICSRKEAAEIFGMPYTTVANIYKKYCTLNIMDPKV  +F SK+L
Sbjct:    1 MNLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLKKKEFLCPIKNEGSIKRKDRKHIPNDVRRKLIECLEKKICSRKEAAEIFGMPYTTVANIYKKYCTLNIMDPKVRTQFKSKKL 203          
BLAST of Thioredoxin-like protein vs. Planmine SMEST
Match: SMESG000033891.1 (SMESG000033891.1)

HSP 1 Score: 543.888 bits (1400), Expect = 0.000e+0
Identity = 270/270 (100.00%), Postives = 270/270 (100.00%), Query Frame = 3
Query:  732 RTQFKSKKLSEKHIFEIRNWLKGNCAMTLKEIQTELSEKFDISISENTINKVIPNFHFSIKRFSGSSNLEFAPNLNDERKNFCSCVLNALKNNQEIVFIDESSFKISTRHFHKKSQFLSSVKEKNSNLKIKNQTIFAAISPTGLVHWKSFDDFENQNYLKEFFDEIMLLVFDAGQKNVVFIFNNLTNENCAEIQNIIKSNGHEFVVLPSLSSDFNPVEDLFFQWESVIRNCAFENEQQLWNFITNIRDIVTSSEFCNYFQSSIDKCRMEI 1541
            RTQFKSKKLSEKHIFEIRNWLKGNCAMTLKEIQTELSEKFDISISENTINKVIPNFHFSIKRFSGSSNLEFAPNLNDERKNFCSCVLNALKNNQEIVFIDESSFKISTRHFHKKSQFLSSVKEKNSNLKIKNQTIFAAISPTGLVHWKSFDDFENQNYLKEFFDEIMLLVFDAGQKNVVFIFNNLTNENCAEIQNIIKSNGHEFVVLPSLSSDFNPVEDLFFQWESVIRNCAFENEQQLWNFITNIRDIVTSSEFCNYFQSSIDKCRMEI
Sbjct:  174 RTQFKSKKLSEKHIFEIRNWLKGNCAMTLKEIQTELSEKFDISISENTINKVIPNFHFSIKRFSGSSNLEFAPNLNDERKNFCSCVLNALKNNQEIVFIDESSFKISTRHFHKKSQFLSSVKEKNSNLKIKNQTIFAAISPTGLVHWKSFDDFENQNYLKEFFDEIMLLVFDAGQKNVVFIFNNLTNENCAEIQNIIKSNGHEFVVLPSLSSDFNPVEDLFFQWESVIRNCAFENEQQLWNFITNIRDIVTSSEFCNYFQSSIDKCRMEI 443          

HSP 2 Score: 361.688 bits (927), Expect = 0.000e+0
Identity = 177/182 (97.25%), Postives = 179/182 (98.35%), Query Frame = 2
Query:  170 MPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLKKKEFLCPIKNEGSIKRKDRKHIPNDVRRKLIECLEKKICSRKEAAEIFGMPYTTVANIYKKYCTLNIMDPKVSKRFISKRL 715
            MPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLKKKEFLCPIKNEGSIKRKDRKHIPNDVRRKLIECLEKKICSRKEAAEIFGMPYTTVANIYKKYCTLNIMDPKV  +F SK+L
Sbjct:    1 MPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLKKKEFLCPIKNEGSIKRKDRKHIPNDVRRKLIECLEKKICSRKEAAEIFGMPYTTVANIYKKYCTLNIMDPKVRTQFKSKKL 182          
BLAST of Thioredoxin-like protein vs. Planmine SMEST
Match: SMESG000033891.1 (SMESG000033891.1)

HSP 1 Score: 281.182 bits (718), Expect = 1.914e-93
Identity = 139/139 (100.00%), Postives = 139/139 (100.00%), Query Frame = 2
Query:  107 MNLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLKKKEFLCPIKNEGSIKRK 523
            MNLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLKKKEFLCPIKNEGSIKRK
Sbjct:    1 MNLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLKKKEFLCPIKNEGSIKRK 139          
BLAST of Thioredoxin-like protein vs. Planmine SMEST
Match: SMESG000033891.1 (SMESG000033891.1)

HSP 1 Score: 238.424 bits (607), Expect = 4.150e-77
Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 2
Query:  170 MPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLKKKEFLCPIKNEGSIKRK 523
            MPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLKKKEFLCPIKNEGSIKRK
Sbjct:    1 MPLKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSGFESMKTGIKLKKKEFLCPIKNEGSIKRK 118          
BLAST of Thioredoxin-like protein vs. Planmine SMEST
Match: SMESG000033877.1 (SMESG000033877.1)

HSP 1 Score: 132.88 bits (333), Expect = 7.148e-35
Identity = 64/111 (57.66%), Postives = 84/111 (75.68%), Query Frame = 2
Query:  110 NLIDINSESQYNFEVHNASKMP-LKSLIVVCFYAKWCELCKTISPFVRKLSVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANASGLESKVKNYSG 439
            ++ID++SE Q+  E+   SK   +  L+V+ FYA WC  CK I+PFV +LSV F NV FL VDVEKFP+IAE YNV AMPTF+F+K++ K+DELKGANAS LE+KV  ++G
Sbjct:    3 SVIDVDSEVQFEQEIQETSKQASVNKLVVIDFYATWCGPCKNIAPFVHRLSVKFPNVTFLKVDVEKFPVIAERYNVNAMPTFIFLKNKIKMDELKGANASVLEAKVTEHAG 113          
The following BLAST results are available for this feature:
BLAST of Thioredoxin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TXN3.936e-1447.50thioredoxin [Source:HGNC Symbol;Acc:HGNC:12435][more]
GLRX33.886e-1233.33glutaredoxin 3 [Source:HGNC Symbol;Acc:HGNC:15987][more]
GLRX33.886e-1233.33glutaredoxin 3 [Source:HGNC Symbol;Acc:HGNC:15987][more]
GLRX33.886e-1233.33glutaredoxin 3 [Source:HGNC Symbol;Acc:HGNC:15987][more]
TXNL14.987e-1031.73thioredoxin like 1 [Source:HGNC Symbol;Acc:HGNC:12... [more]
back to top
BLAST of Thioredoxin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
png-11.233e-1437.35Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]
trx-15.302e-1234.15Thioredoxin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
trx-15.588e-1233.73Thioredoxin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
Y55F3AR.27.748e-1130.65pep chromosome:WBcel235:IV:1094545:1096723:1 gene:... [more]
txl-11.936e-1034.55ThioredoXin-Like; Thioredoxin-like protein; Thiore... [more]
back to top
BLAST of Thioredoxin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trx-22.288e-1650.00gene:FBgn0040070 transcript:FBtr0079840[more]
Trx-22.288e-1650.00gene:FBgn0040070 transcript:FBtr0079839[more]
Txl6.082e-1636.70gene:FBgn0035631 transcript:FBtr0077098[more]
TrxT2.550e-1139.53gene:FBgn0029752 transcript:FBtr0070755[more]
TrxT2.550e-1139.53gene:FBgn0029752 transcript:FBtr0340478[more]
back to top
BLAST of Thioredoxin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TXN4.673e-1442.35zgc:56493 [Source:ZFIN;Acc:ZDB-GENE-030131-8581][more]
txn8.048e-1442.55thioredoxin [Source:ZFIN;Acc:ZDB-GENE-040718-162][more]
txn8.080e-1442.55thioredoxin [Source:ZFIN;Acc:ZDB-GENE-040718-162][more]
txnl12.800e-1237.50thioredoxin-like 1 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
txnl13.149e-1237.50thioredoxin-like 1 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
back to top
BLAST of Thioredoxin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000029198.14.871e-1443.62MGC80314 protein [Source:NCBI gene;Acc:100170420][more]
glrx34.233e-1230.56glutaredoxin 3 [Source:NCBI gene;Acc:549963][more]
glrx36.531e-1230.56glutaredoxin 3 [Source:NCBI gene;Acc:549963][more]
txnl11.557e-1140.96thioredoxin like 1 [Source:NCBI gene;Acc:448593][more]
txnl12.138e-1140.96thioredoxin like 1 [Source:NCBI gene;Acc:448593][more]
back to top
BLAST of Thioredoxin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Txn12.549e-1445.24thioredoxin 1 [Source:MGI Symbol;Acc:MGI:98874][more]
Glrx34.843e-1234.83glutaredoxin 3 [Source:MGI Symbol;Acc:MGI:1353653][more]
Glrx37.536e-1234.83glutaredoxin 3 [Source:MGI Symbol;Acc:MGI:1353653][more]
Txnl13.581e-1031.73thioredoxin-like 1 [Source:MGI Symbol;Acc:MGI:1860... [more]
Txnl13.585e-1031.73thioredoxin-like 1 [Source:MGI Symbol;Acc:MGI:1860... [more]
back to top
BLAST of Thioredoxin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O97508|THIO_HORSE2.276e-1542.72Thioredoxin OS=Equus caballus OX=9796 GN=TXN PE=3 ... [more]
sp|Q9V429|THIO2_DROME2.293e-1550.00Thioredoxin-2 OS=Drosophila melanogaster OX=7227 G... [more]
sp|Q6XHI1|THIO2_DROYA5.897e-1541.75Thioredoxin-2 OS=Drosophila yakuba OX=7245 GN=Trx-... [more]
sp|P29429|THIO_EMENI7.164e-1535.29Thioredoxin OS=Emericella nidulans (strain FGSC A4... [more]
sp|O65049|TRXH_PICMA7.276e-1545.12Thioredoxin H-type OS=Picea mariana OX=3335 GN=SB0... [more]
back to top
BLAST of Thioredoxin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0C2JI124.222e-2829.17DDE_3 domain-containing protein OS=Thelohanellus k... [more]
A0A0C2N3A13.012e-2728.24DDE_3 domain-containing protein OS=Thelohanellus k... [more]
A0A0C2I6K52.233e-2528.52DDE_3 domain-containing protein OS=Thelohanellus k... [more]
A0A0C2N2685.220e-2528.76DDE_3 domain-containing protein OS=Thelohanellus k... [more]
A0A0C2ITH71.387e-2027.91DDE_3 domain-containing protein OS=Thelohanellus k... [more]
back to top
BLAST of Thioredoxin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:564938.670e-1343.90thioredoxin-like [Source:NCBI gene;Acc:103040975][more]
txn4.879e-1236.54thioredoxin-like [Source:NCBI gene;Acc:103039731][more]
txnl11.388e-1136.54thioredoxin like 1 [Source:NCBI gene;Acc:103021638... [more]
txnl11.869e-1136.54thioredoxin like 1 [Source:NCBI gene;Acc:103021638... [more]
glrx37.073e-1029.13glutaredoxin 3 [Source:NCBI gene;Acc:449777][more]
back to top
BLAST of Thioredoxin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000009652.16.979e-1346.34pep scaffold:Pmarinus_7.0:GL478563:4231:10899:-1 g... [more]
ENSPMAT00000007779.11.874e-932.14pep scaffold:Pmarinus_7.0:GL477155:15795:22678:-1 ... [more]
glrx38.274e-933.75glutaredoxin 3 [Source:NCBI gene;Acc:449777][more]
txn24.320e-636.62thioredoxin 2 [Source:ZFIN;Acc:ZDB-GENE-040426-179... [more]
back to top
BLAST of Thioredoxin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TRX32.263e-1641.98Mitochondrial thioredoxin; highly conserved oxidor... [more]
TRX23.405e-1330.69Cytoplasmic thioredoxin isoenzyme; part of thiored... [more]
TRX11.719e-1233.33Cytoplasmic thioredoxin isoenzyme; part of thiored... [more]
GRX41.297e-1032.67Glutathione-dependent oxidoreductase; hydroperoxid... [more]
GRX31.366e-831.00Glutathione-dependent oxidoreductase; hydroperoxid... [more]
back to top
BLAST of Thioredoxin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO333725.414e-1939.05Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7SSF5][more]
EDO418523.633e-1538.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454131.011e-1133.02Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7RT76][more]
EDO461391.024e-938.16Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7RQN2][more]
EDO463792.253e-932.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Thioredoxin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
txnl11.317e-1237.14thioredoxin like 1 [Source:NCBI gene;Acc:101158293... [more]
glrx31.324e-1231.82glutaredoxin 3 [Source:NCBI gene;Acc:449777][more]
txnl12.086e-1237.14thioredoxin like 1 [Source:NCBI gene;Acc:101158293... [more]
ENSORLT00000009496.26.185e-1143.37thioredoxin [Source:NCBI gene;Acc:101173415][more]
pdia61.920e-730.17protein disulfide isomerase family A member 6 [Sou... [more]
back to top
BLAST of Thioredoxin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033891.10.000e+0100.00SMESG000033891.1[more]
SMESG000033891.10.000e+0100.00SMESG000033891.1[more]
SMESG000033891.11.914e-93100.00SMESG000033891.1[more]
SMESG000033891.14.150e-77100.00SMESG000033891.1[more]
SMESG000033877.17.148e-3557.66SMESG000033877.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031155 ID=SMED30031155|Name=Thioredoxin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1542bp
TATTATTTGAATAGTTTATTTATTATTAATATAAACTCACATTAGCCAGT
CTCAAAGAAAGTATTGTTTTACAAAATGTCAAATTAATATAATTTATTAT
TTTAGTATGAATTTAATTGACATAAATAGTGAATCCCAATATAATTTTGA
AGTTCATAATGCAAGTAAAATGCCACTAAAATCACTAATTGTTGTGTGCT
TTTATGCTAAATGGTGTGAACTTTGTAAAACGATTTCTCCATTTGTCCGT
AAATTAAGTGTAGCATTTTCTAATGTGAAATTTTTAAATGTTGATGTTGA
AAAATTTCCGATAATAGCTGAAGCTTACAACGTAATCGCAATGCCAACAT
TTGTGTTTATTAAAGATGAGAATAAAGTCGATGAATTAAAAGGGGCCAAT
GCATCGGGTTTAGAGTCGAAAGTGAAAAATTATTCTGGTTTTGAATCTAT
GAAAACTGGAATTAAGTTGAAAAAAAAAGAATTTCTTTGTCCCATAAAAA
ATGAAGGCTCTATTAAAAGGAAAGACAGAAAACATATTCCCAATGATGTT
CGAAGGAAACTTATTGAATGTCTAGAAAAAAAAATCTGTTCTCGTAAGGA
AGCTGCAGAAATTTTCGGTATGCCTTATACAACTGTAGCCAATATTTATA
AGAAATATTGTACATTGAATATCATGGATCCCAAGGTTTCAAAACGTTTT
ATTAGTAAACGCTTAAAATTTGGTTTAGGTTCGGACACAGTTTAAGTCGA
AAAAATTAAGTGAAAAGCATATATTTGAAATAAGAAACTGGTTAAAAGGC
AATTGCGCTATGACTCTGAAAGAGATCCAAACGGAACTGAGTGAAAAATT
CGATATTTCAATTTCAGAAAATACCATAAACAAAGTCATTCCAAATTTTC
ATTTTTCCATTAAACGATTTTCTGGCAGCTCAAATTTAGAATTTGCCCCT
AACTTGAATGATGAAAGGAAAAACTTCTGTTCCTGTGTTCTTAATGCCTT
AAAAAATAATCAAGAAATCGTTTTTATCGATGAGTCTTCGTTCAAAATCT
CCACGAGACATTTCCATAAGAAATCTCAATTCCTCAGTAGTGTGAAAGAG
AAAAACTCGAATTTAAAAATCAAAAACCAAACCATTTTTGCCGCTATTTC
CCCGACTGGTTTGGTACATTGGAAAAGTTTCGATGATTTCGAAAACCAAA
ATTATCTTAAAGAATTTTTCGATGAAATAATGCTTTTGGTTTTTGATGCA
GGACAGAAGAATGTCGTCTTCATTTTTAATAATTTAACCAATGAGAATTG
TGCCGAAATTCAGAATATCATCAAAAGTAACGGCCATGAATTTGTTGTCC
TTCCATCTCTTAGTTCCGATTTCAATCCGGTTGAAGACCTCTTTTTTCAA
TGGGAATCTGTAATTAGAAATTGTGCATTTGAAAATGAGCAACAATTATG
GAATTTTATAACTAATATCAGAGATATTGTGACATCTAGTGAATTTTGTA
ATTATTTTCAATCTAGTATTGATAAATGTCGAATGGAAATTT
back to top

protein sequence of SMED30031155-orf-1

>SMED30031155-orf-1 ID=SMED30031155-orf-1|Name=SMED30031155-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=213bp
MNLIDINSESQYNFEVHNASKMPLKSLIVVCFYAKWCELCKTISPFVRKL
SVAFSNVKFLNVDVEKFPIIAEAYNVIAMPTFVFIKDENKVDELKGANAS
GLESKVKNYSGFESMKTGIKLKKKEFLCPIKNEGSIKRKDRKHIPNDVRR
KLIECLEKKICSRKEAAEIFGMPYTTVANIYKKYCTLNIMDPKVSKRFIS
KRLKFGLGSDTV*
back to top

protein sequence of SMED30031155-orf-2

>SMED30031155-orf-2 ID=SMED30031155-orf-2|Name=SMED30031155-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=244bp
MTLKEIQTELSEKFDISISENTINKVIPNFHFSIKRFSGSSNLEFAPNLN
DERKNFCSCVLNALKNNQEIVFIDESSFKISTRHFHKKSQFLSSVKEKNS
NLKIKNQTIFAAISPTGLVHWKSFDDFENQNYLKEFFDEIMLLVFDAGQK
NVVFIFNNLTNENCAEIQNIIKSNGHEFVVLPSLSSDFNPVEDLFFQWES
VIRNCAFENEQQLWNFITNIRDIVTSSEFCNYFQSSIDKCRMEI
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR038717Tc1-like_DDE_dom
IPR013766Thioredoxin_domain
IPR012336Thioredoxin-like_fold
Vocabulary: biological process
TermDefinition
GO:0045454cell redox homeostasis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038717Tc1-like transposase, DDE domainPFAMPF13358DDE_3coord: 70..213
e-value: 4.3E-12
score: 46.0
NoneNo IPR availableGENE3DG3DSA:3.30.420.470coord: 43..244
e-value: 3.6E-11
score: 44.9