Acyl-CoA synthetase short chain family member 3

Overview
NameAcyl-CoA synthetase short chain family member 3
Smed IDSMED30031147
Length (bp)2049
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acyl-CoA synthetase short chain family member 3 (SMED30031147) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acyl-CoA synthetase short chain family member 3 (SMED30031147) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031147

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30031147h1SMcG0020265 SmedASXL_011705SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30031147h1SMcG0020265 Contig37473uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031147h1SMcG0020265 Contig37473newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031147h1SMcG0020265 Contig39924newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031147h1SMcG0020265 Contig39924uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30031147h1SMcG0020265 dd_Smed_v4_7019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031147h1SMcG0020265 dd_Smed_v4_7019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30031147h1SMcG0020265 dd_Smed_v6_7019_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:HGNC Symbol;Acc:HGNC:24723])

HSP 1 Score: 429.098 bits (1102), Expect = 6.699e-141
Identity = 221/627 (35.25%), Postives = 356/627 (56.78%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            +Y   +  S+  PE+ W + A+++ W + +T  L  K SP+ +WFV G +N+ YN +DRH+  G G+KIAI+++SP +      TYKE+L++V  LAGV+V K  I+ GD V++Y P+IPQ M  +LAC RIGA +S ++GGF+S  ++++IDH++P +++T +          Y   +++A+   +HKP   +IYNRP      L   RDLDW+ +M  A+ H  VP+ S HP+ I+YTSG+TG PKG++  TG       + M    GL+  EV W   D  W+ G  ++ +G LL+  T++LYE    G P+  A   ++  H  A  F++P  +R  R+        +++     K+ F+ GE  D     W  + F  PV D W QTE  S      +G+G +         +SVP  G N  I+D    + L+   LG IV+K P+ P      +K+ E +   YF ++PG+YDTMD G     G + + SRVDDVI +AGHR+S+ ++EE  L +  ++   V+  ED L  ++P+AL V  +D  +++E++  E V+ V+  +G    F+  V V  L +T+SGK  R +L+ ++NGK YK+++ + +P  +  + ++L
Sbjct:   61 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVP--GYNVMILDDNM-QKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEML 683          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:HGNC Symbol;Acc:HGNC:24723])

HSP 1 Score: 420.239 bits (1079), Expect = 1.715e-137
Identity = 220/627 (35.09%), Postives = 355/627 (56.62%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            +Y   +  S+  PE+ W + A+++ W + +T  L  K SP+ + FV G +N+ YN +DRH+  G G+KIAI+++SP +      TYKE+L++V  LAGV+V K  I+ GD V++Y P+IPQ M  +LAC RIGA +S ++GGF+S  ++++IDH++P +++T +          Y   +++A+   +HKP   +IYNRP      L   RDLDW+ +M  A+ H  VP+ S HP+ I+YTSG+TG PKG++  TG       + M    GL+  EV W   D  W+ G  ++ +G LL+  T++LYE    G P+  A   ++  H  A  F++P  +R  R+        +++     K+ F+ GE  D     W  + F  PV D W QTE  S      +G+G +         +SVP  G N  I+D    + L+   LG IV+K P+ P      +K+ E +   YF ++PG+YDTMD G     G + + SRVDDVI +AGHR+S+ ++EE  L +  ++   V+  ED L  ++P+AL V  +D  +++E++  E V+ V+  +G    F+  V V  L +T+SGK  R +L+ ++NGK YK+++ + +P  +  + ++L
Sbjct:   61 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTR-FVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVP--GYNVMILDDNM-QKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEML 682          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS1 (acyl-CoA synthetase short chain family member 1 [Source:HGNC Symbol;Acc:HGNC:16091])

HSP 1 Score: 234.572 bits (597), Expect = 5.058e-67
Identity = 164/626 (26.20%), Postives = 299/626 (47.76%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQE-VIWDQQYTDVL-IEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP--QHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVP---LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMN--FKIID---SKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKM--STMVNNP 1856
            Y  L   +  +P   W  LA++ ++WD  Y  V   +  +    WF+GG++N+S NCLD+HV +     +A++ E       ++ITY+ELL+    LA  +  +  +  GD+V +Y PV P  +  +LAC RIGA ++ ++ GFS+ ++A +I+  +  +++T N           K+ +D+A+   KH P  QH ++ +R      + V   DLD   + + A+         + S   + ++YTSGSTG PKG+V      +       K     +  ++   + D  W+TG  ++ +G L N  TS+L+E    YP      E +   K   F+ +P  +R   K      + +K+D  +L++    GE  +     W   +     C + D W QTE   I + P      ++ ++ +P + M   F I+     + G  +    +   +  +   P ++ T Y DH+R++  YF  YPG+Y T D   +   G  +I  R+DDVI ++GHR+ +  +E+    +  +    V+     +      A IV  + +  SD  ++ E   +V   + K+ +  ++++V  L +T+SGK +RR L  +I  +  ++  +T + +P
Sbjct:   58 YPALSAQAAREPAAFWGPLARDTLVWDTPYHTVWDCDFSTGKIGWFLGGQLNVSVNCLDQHVRKSP-ESVALIWERDEPGTEVRITYRELLETTCRLANTL-KRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAVHTVIFAGFSAESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAV---KHCPTVQHVLVAHRTD----NKVHMGDLDVPLEQEMAKEDPVCAPESMGSEDMLFMLYTSGSTGMPKGIVHTQAGYLLYAALTHKLVFDHQPGDIFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVYPNAGRYWETVERLKINQFYGAPTAVRLLLKYGDA--WVKKYDRSSLRTLGSVGEPINCEAWEWLHRVVGDSRCTLVDTWWQTETGGICIAPR---PSEEGAEILPAMAMRPFFGIVPVLMDEKGSVVEGSNVSGALCISQAWPGMARTIYGDHQRFVDAYFKAYPGYYFTGDGAYRTEGGYYQITGRMDDVINISGHRLGTAEIEDAIADHPAVPESAVIGYPHDIKGEAAFAFIVVKDSAGDSDVVVQ-ELKSMVATKIAKYAVPDEILVVKRLPKTRSGKVMRRLLRKIITSEAQELGDTTTLEDP 668          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS2 (acyl-CoA synthetase short chain family member 2 [Source:HGNC Symbol;Acc:HGNC:15814])

HSP 1 Score: 233.032 bits (593), Expect = 2.497e-66
Identity = 181/644 (28.11%), Postives = 296/644 (45.96%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPK------WFVGGKINMSYNCLDRHVLEG-YGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP---QHCIIYNRPGT---------------------VPASLVGHRDLDWEYQMQGARHHRHVP-LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGPNLGL-KRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMI-NGKDYKMSTMVNNP 1856
            Y +L++ S+ +P + W ++A+E  W        +       K      W  G   N+ YN LDR+V E   G+K+A   E      T +ITY +LL +V   + V+  K  I+ GD+V +Y P+IP+ ++ +LAC RIGA +S V+ GFSS ++  +I      L++T +  Y      N KE  D+A+ + + K    + CI+    G                      V  S     DL W   MQ A         D+  P+ I+YTSGSTG+PKG+V   G  +       KY     +++V W   D  W+TG  ++T+G L N  TS+L+EG   YP+ + +  ++  +K   F+++P  +R   K   E        +L+     GE  +     W   +     CP+ D + QTE     + P  G    K  S + P  G+   I++    E L  E  G +V K P  P +  T Y +HER+  TYF ++PG+Y T D   +  +G   I  R+DD++ ++GH +S+  VE   +++E ++   V+     +     +   V   D  +   ++  E  + ++  +G       +   P L +T+SGK +RR L  +  N  D    + V +P
Sbjct:   47 YRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNVL-RKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQISWNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSATFPFFGVAPAILNESG-EELEGEAEGYLVFKQPW-PGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGEC-LYCFVTLCDGHTFSPKLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDMSTVADP 686          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS2 (acyl-CoA synthetase short chain family member 2 [Source:HGNC Symbol;Acc:HGNC:15814])

HSP 1 Score: 227.254 bits (578), Expect = 3.475e-64
Identity = 179/657 (27.25%), Postives = 295/657 (44.90%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPK------WFVGGKINMSYNCLDRHVLEG-YGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP---QHCIIYNRPGTVPASLVGHR----------------------------------DLDWEYQMQGARHHRHVP-LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGPNLGL-KRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMI-NGKDYKMSTMVNNP 1856
            Y +L++ S+ +P + W ++A+E  W        +       K      W  G   N+ YN LDR+V E   G+K+A   E      T +ITY +LL +V   + V+  K  I+ GD+V +Y P+IP+ ++ +LAC RIGA +S V+ GFSS ++  +I      L++T +  Y      N KE  D+A+ + + K    + CI+    G     +                                      DL W   MQ A         D+  P+ I+YTSGSTG+PKG+V   G  +       KY     +++V W   D  W+TG  ++T+G L N  TS+L+EG   YP+ + +  ++  +K   F+++P  +R   K   E        +L+     GE  +     W   +     CP+ D + QTE     + P  G    K  S + P  G+   I++    E L  E  G +V K P  P +  T Y +HER+  TYF ++PG+Y T D   +  +G   I  R+DD++ ++GH +S+  VE   +++E ++   V+     +     +   V   D  +   ++  E  + ++  +G       +   P L +T+SGK +RR L  +  N  D    + V +P
Sbjct:   47 YRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNVL-RKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQGKLKEKSKRVQPQISWNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSATFPFFGVAPAILNESG-EELEGEAEGYLVFKQPW-PGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGEC-LYCFVTLCDGHTFSPKLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDMSTVADP 699          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 224.557 bits (571), Expect = 7.575e-64
Identity = 173/639 (27.07%), Postives = 295/639 (46.17%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVL-IEKESPTPKWFV----GGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP---------QHCIIYNRPGTVPASLVGHRDLDWEYQ---MQGARHHRHVP-LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWISSKF---HCPVYDIWGQTEL--HSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKM---STMVNNPGAYQLI 1874
            Y DLY+ SI   ++ W  ++ E+ ++Q  +  L    +S     FV    G K N+SYNCL+R++  GYGNKIA + E      T   TY EL  +V   + V+     ++ GD V LY P+IP+  + +LAC RIGA +S V+ GFS+ ++A ++      +++T +  +  A     K   D A + +  +          +H     +P  V    V + D+   Y    ++ A     V  +DS  P+ I+YTSGSTG+PKG+   T   +       KY    + D+V W   D  W+TG  ++ +G L+N    I YEG   YP  S + ++   +     ++SP   R       +   S     LK     GE  +     W+  +    +  + D + QTE   H I   P      K  + ++P  G +  ++D++ G  +     G +       P +    Y D +R+++TY   + G+Y T D   +  +G + I  RVDD++ ++GH +S+  +E   + +E ++   V+     +  + P A +  N   R  +E++  E  +LV+  +G   +   +   P L +T+SGK  RR L  +  G +  +   +T+V+     QLI
Sbjct:   40 YHDLYRSSINDADEFWRTVSSELHFEQGTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVLRSH-GVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLKRVTKPDGVELPKVDYTDITVIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVPTYPTPSRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMITCLPG-ATPMKPGAAAMPFFGASPVLLDAE-GRVIEGPGEGSLCFDRAW-PGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGER-INEKLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEGSESGIGDTTTLVDESVIKQLI 673          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 224.557 bits (571), Expect = 7.575e-64
Identity = 173/639 (27.07%), Postives = 295/639 (46.17%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVL-IEKESPTPKWFV----GGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP---------QHCIIYNRPGTVPASLVGHRDLDWEYQ---MQGARHHRHVP-LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWISSKF---HCPVYDIWGQTEL--HSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKM---STMVNNPGAYQLI 1874
            Y DLY+ SI   ++ W  ++ E+ ++Q  +  L    +S     FV    G K N+SYNCL+R++  GYGNKIA + E      T   TY EL  +V   + V+     ++ GD V LY P+IP+  + +LAC RIGA +S V+ GFS+ ++A ++      +++T +  +  A     K   D A + +  +          +H     +P  V    V + D+   Y    ++ A     V  +DS  P+ I+YTSGSTG+PKG+   T   +       KY    + D+V W   D  W+TG  ++ +G L+N    I YEG   YP  S + ++   +     ++SP   R       +   S     LK     GE  +     W+  +    +  + D + QTE   H I   P      K  + ++P  G +  ++D++ G  +     G +       P +    Y D +R+++TY   + G+Y T D   +  +G + I  RVDD++ ++GH +S+  +E   + +E ++   V+     +  + P A +  N   R  +E++  E  +LV+  +G   +   +   P L +T+SGK  RR L  +  G +  +   +T+V+     QLI
Sbjct:   40 YHDLYRSSINDADEFWRTVSSELHFEQGTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVLRSH-GVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLKRVTKPDGVELPKVDYTDITVIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVPTYPTPSRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMITCLPG-ATPMKPGAAAMPFFGASPVLLDAE-GRVIEGPGEGSLCFDRAW-PGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGER-INEKLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEGSESGIGDTTTLVDESVIKQLI 673          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 224.172 bits (570), Expect = 8.378e-64
Identity = 173/639 (27.07%), Postives = 295/639 (46.17%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVL-IEKESPTPKWFV----GGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP---------QHCIIYNRPGTVPASLVGHRDLDWEYQ---MQGARHHRHVP-LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWISSKF---HCPVYDIWGQTEL--HSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKM---STMVNNPGAYQLI 1874
            Y DLY+ SI   ++ W  ++ E+ ++Q  +  L    +S     FV    G K N+SYNCL+R++  GYGNKIA + E      T   TY EL  +V   + V+     ++ GD V LY P+IP+  + +LAC RIGA +S V+ GFS+ ++A ++      +++T +  +  A     K   D A + +  +          +H     +P  V    V + D+   Y    ++ A     V  +DS  P+ I+YTSGSTG+PKG+   T   +       KY    + D+V W   D  W+TG  ++ +G L+N    I YEG   YP  S + ++   +     ++SP   R       +   S     LK     GE  +     W+  +    +  + D + QTE   H I   P      K  + ++P  G +  ++D++ G  +     G +       P +    Y D +R+++TY   + G+Y T D   +  +G + I  RVDD++ ++GH +S+  +E   + +E ++   V+     +  + P A +  N   R  +E++  E  +LV+  +G   +   +   P L +T+SGK  RR L  +  G +  +   +T+V+     QLI
Sbjct:   30 YHDLYRSSINDADEFWRTVSSELHFEQGTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVLRSH-GVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLKRVTKPDGVELPKVDYTDITVIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVPTYPTPSRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMITCLPG-ATPMKPGAAAMPFFGASPVLLDAE-GRVIEGPGEGSLCFDRAW-PGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGER-INEKLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEGSESGIGDTTTLVDESVIKQLI 663          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-21 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:O16481])

HSP 1 Score: 67.0106 bits (162), Expect = 2.159e-11
Identity = 109/497 (21.93%), Postives = 201/497 (40.44%), Query Frame = 3
Query:  288 KITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDL-DWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGY-PEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFS-EKFDNLKSFFIGGE-LTDDTLRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENI--SGVVVLPLEDILNTNLPVALIVKN--EDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIV 1754
            KITY + +      A  + +K  I+ GD+V+              AC +IGA Y  V    +    A  +   +P L +TC            K+  D+  M  +     CI        P  ++  + L D   + +      HV  + ++   I +TSG+TG PKG V + G +  +   +++ + G   ++V           G  F     L +  + I    +  ED +      L    +F   P    +    L   NF+ E F+ ++ F  G   L+  TL  +   +    + + +G TE   I   P  G KRK  +    + G+  ++ ++           G I IK   + S+   ++K+ E+  +  FT   G++ T D G    +G + I  R  D+I   G  +    +E+     E +  S V+  P  D     + V ++ KN  ED +  +E++    +++++  L K+ + +KV+++
Sbjct:   47 KITYGDFVQRAGQYATALTEKYKIKKGDRVMARVSKTTDTAALYAACLQIGALYVPVNPALTQSEAAHYVKDAKPSLWITC------------KDDADQIAMFQRVLKTVCI------DNPVEVINEKVLADEAGKRKACTMIEHV--EKSNAATICFTSGTTGAPKGAVLSHGALTNNTNALVQ-EWGFTENDVNLHCLPIFHAHGLYFSLHCSLFSHSSVIWRPNFDAEDCS----KHLKNATVFMGVPTFYSRL---LATNNFNKESFEKIRLFISGSAPLSVPTLEEF-EKRTGQVILERYGMTEAGVIASNPLKG-KRKAGTVGQALKGVQCRVTEN-----------GEIEIK---SDSIFSEYWKNPEK-TKEEFTE-DGWFKTGDVGSLDKDGYLTIGGRSKDMIISGGENIYPKEIEDAIDSIEFVKESAVIAAPHPDFGEAVVAV-VVPKNMVEDEQKFEEDL----IEMLRKKLAKYKVPKKVILL 492          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-11 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q20264])

HSP 1 Score: 62.7734 bits (151), Expect = 4.548e-10
Identity = 102/513 (19.88%), Postives = 199/513 (38.79%), Query Frame = 3
Query:  288 KITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPA-SLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGYPEDSAILEMMR---LHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEI--CLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTD 1808
            K TY E +      A  + +K NI+ GD+V+             +AC +IGA Y  V  G++    A  I    P ++++CN            E +DK   +         + +  G++ A +++ H                   ++ + P  + YTSG+TG PKG +   G++ +++ + +    G   ++       F  + G  +     L +  T I    +  +  I  M     +     FFS  +  + F K        E F N++ F  G      +       +    + + +G TE   +   P L  +RK  +    V G+  +I  +           G I +K   T ++   ++K+ ++     FT   G++ T D G    +G + I  R  D++   G  V    +E+    L     S V+  P  D       VA++V +E   + ++E + + + +++  +  + + ++V+++  L      K  +  L D
Sbjct:   46 KTTYGEFVKRTGQYATALTEKYNIKKGDRVMARVSKTTDTAALYIACLQIGALYIPVNPGYTESEAAHYIKDATPSILVSCN------------EELDKVFRDKIRVINEDKLASEAGSLNACTMIEH-------------------VEKSDPASVCYTSGTTGLPKGAILTHGSL-SNNAHDIVRDWGFTGNDYNLHALPFYHVHGLYYSLHCSLFSHSTMIWRSKFEVEDCIKYMKNATVMMGVPTFFSRLLASKNFNK--------EAFGNVRVFISGSAPLSVSTIEEFRERTGQVILERYGMTEAGVMTTNP-LNGERKAGTVGPAVQGVGCRIAKN-----------GGIEVK---TNAIFAGYWKNPKKTAEE-FTE-DGWFKTGDVGHLDEDGYLTIGGRSKDMVITGGLNVYPKELEDFIDTLPFVKESAVIASPHPDF--GEAVVAIVVPSEKV-TDEKEFEKKLIGIMKKKVANYKVPKRVIVLDDLPRNHITKVQKNVLRD 498          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: CG6432 (gene:FBgn0039184 transcript:FBtr0346110)

HSP 1 Score: 369.777 bits (948), Expect = 2.021e-118
Identity = 198/640 (30.94%), Postives = 341/640 (53.28%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP-QHCIIYNRPGTVP--ASLVGHRDLDWE---YQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGYPEDSA----ILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRK----DYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVLINHGFKATLP 1916
            Y   Y+ S+  P   W E    + WD+ +  VL     P  KW+VGG +N  YN +DRH+L G G+ +A++H+SP +    ++TY+EL D++ LLAG +  K  +  GD+V++Y P+IP+ +I +LA  R+GA +S V+GGF++  + ++I+H+EP L++  NV         Y + +  AI  S+ +P Q  II+ R    P    L    D+ W       +G R    VP+++N P+ I+YTSG+T +PKG++   G  + +  Y ++   G+      W   D  W+ G  ++ +G L    TS++YEG P+ +        ++  ++    FS P   R  R+   ++++  ++   +L++ FI GE  D   ++WI   F  PV + W QTE  S      LG ++      YS  +P++G + KI+ +   E   +E LGRI +K P+ P    T YK+ E +   YF ++PG+YDTMD G +   G I + +R DDVI +AGHR+S+ S+E+  L++ ++  V V  + +     +P+ L +  E+ + +D ++  E ++L++  +G    F+ V  V  L  T+SGK +R+++ D    +   +   +++   +  I   L   G+  T P
Sbjct:   28 YLKAYRQSVQNPAAFWEEQGNLLDWDRPWEKVLDNSNPPFTKWYVGGYLNACYNSIDRHILAGRGSNVALIHDSPLTGTLRRVTYQELYDQIVLLAGGLA-KLGVVKGDRVVIYMPLIPETIIAMLAIVRLGAIHSVVFGGFAARELCSRIEHVEPKLVIASNVGVEPGKVVPYLDILHSAISMSRWRPPQRNIIFRRDNVSPDTTKLDPLTDVLWSDILKMAEGERPIACVPIEANDPLYILYTSGTTDKPKGVLRTIGGHLVALVYTLRTLYGINPGHTWWAASDMGWVVGHSYICYGPLCLGATSVMYEGKPDRTPDPGQYFRIIDQYQVRSIFSVPTSFRVIRRADPDISYGRQYSMKSLRAIFIAGEHCDYETKSWIEKTFKVPVLNHWWQTETGSAVTATCLGFQQNLSPPTYSTGLPLMGYDVKILKADGSEAQTSE-LGRIALKLPLPPGNMATLYKNEELFRTLYFQKFPGYYDTMDAGYKDERGYIFVTARDDDVINVAGHRLSTSSLEDAVLRHPDVVDVAVFGVPEATKGQVPLCLYIPVENCKKTDAKLSTEIIKLIRDVVGPIAAFRLVTSVNNLPRTRSGKTMRKAMADFARNERVVLPATIDDASVFIEIRRALNQLGYAMTAP 665          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: CG6432 (gene:FBgn0039184 transcript:FBtr0084606)

HSP 1 Score: 369.777 bits (948), Expect = 2.021e-118
Identity = 198/640 (30.94%), Postives = 341/640 (53.28%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP-QHCIIYNRPGTVP--ASLVGHRDLDWE---YQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGYPEDSA----ILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRK----DYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVLINHGFKATLP 1916
            Y   Y+ S+  P   W E    + WD+ +  VL     P  KW+VGG +N  YN +DRH+L G G+ +A++H+SP +    ++TY+EL D++ LLAG +  K  +  GD+V++Y P+IP+ +I +LA  R+GA +S V+GGF++  + ++I+H+EP L++  NV         Y + +  AI  S+ +P Q  II+ R    P    L    D+ W       +G R    VP+++N P+ I+YTSG+T +PKG++   G  + +  Y ++   G+      W   D  W+ G  ++ +G L    TS++YEG P+ +        ++  ++    FS P   R  R+   ++++  ++   +L++ FI GE  D   ++WI   F  PV + W QTE  S      LG ++      YS  +P++G + KI+ +   E   +E LGRI +K P+ P    T YK+ E +   YF ++PG+YDTMD G +   G I + +R DDVI +AGHR+S+ S+E+  L++ ++  V V  + +     +P+ L +  E+ + +D ++  E ++L++  +G    F+ V  V  L  T+SGK +R+++ D    +   +   +++   +  I   L   G+  T P
Sbjct:   28 YLKAYRQSVQNPAAFWEEQGNLLDWDRPWEKVLDNSNPPFTKWYVGGYLNACYNSIDRHILAGRGSNVALIHDSPLTGTLRRVTYQELYDQIVLLAGGLA-KLGVVKGDRVVIYMPLIPETIIAMLAIVRLGAIHSVVFGGFAARELCSRIEHVEPKLVIASNVGVEPGKVVPYLDILHSAISMSRWRPPQRNIIFRRDNVSPDTTKLDPLTDVLWSDILKMAEGERPIACVPIEANDPLYILYTSGTTDKPKGVLRTIGGHLVALVYTLRTLYGINPGHTWWAASDMGWVVGHSYICYGPLCLGATSVMYEGKPDRTPDPGQYFRIIDQYQVRSIFSVPTSFRVIRRADPDISYGRQYSMKSLRAIFIAGEHCDYETKSWIEKTFKVPVLNHWWQTETGSAVTATCLGFQQNLSPPTYSTGLPLMGYDVKILKADGSEAQTSE-LGRIALKLPLPPGNMATLYKNEELFRTLYFQKFPGYYDTMDAGYKDERGYIFVTARDDDVINVAGHRLSTSSLEDAVLRHPDVVDVAVFGVPEATKGQVPLCLYIPVENCKKTDAKLSTEIIKLIRDVVGPIAAFRLVTSVNNLPRTRSGKTMRKAMADFARNERVVLPATIDDASVFIEIRRALNQLGYAMTAP 665          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0333126)

HSP 1 Score: 247.284 bits (630), Expect = 3.481e-72
Identity = 173/617 (28.04%), Postives = 291/617 (47.16%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYT-------DVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSP--ITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKA---IMESKHKPQHCIIYNRPGTVPASLVGH----------RDLDWEYQMQGARHHRHVP-LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWIS---SKFHCPVYDIWGQTELHSIGVGPNLGL-KRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSL 1802
            +Y   Y+ S+  P + W  +A++  W+           +  I K   + KW  G   N+ YN LDR+V  G G++IA   E  N P   +  +TY++LL+EV   A V+ D   IR GD+V +Y P+I +  I +LAC RIGA +S V+ GFS  ++A ++   +  L++T + A+        K   D A   + E  H  + CI+ +    V      H          RD  W  +M+      +   +D+  P+ ++YTSGSTG+PKG++  T   +       K     K  ++ W  GD  W+TG  ++ +G L N  TS+++EG   +P +     ++  +K   F+++P  +R   K             LK     GE  +     W      K  C + D + QTE     + P  G    K  S S P  G+   ++D + G  ++ E  G +V   P  P +  T Y +HER+  TYF+++PG+Y T D   +  +G + I  RVDD++ ++GH +S+  VE +  ++  ++   V+     +        I  NE+    D+++  +  ++V+  +G F +   +   P L +T+SGK +RR L
Sbjct:   25 EYQKFYQESLDNPAEFWSRVAKQFHWETPADQDKFLKYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEG-NHPDDYSRGLTYRKLLEEVCRFANVLKDH-GIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFPGNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLD-ECGIEIKGEGEGYLVFSQPW-PGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNEN-EVFDQKLISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVL 636          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0078413)

HSP 1 Score: 247.284 bits (630), Expect = 3.481e-72
Identity = 173/617 (28.04%), Postives = 291/617 (47.16%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYT-------DVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSP--ITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKA---IMESKHKPQHCIIYNRPGTVPASLVGH----------RDLDWEYQMQGARHHRHVP-LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWIS---SKFHCPVYDIWGQTELHSIGVGPNLGL-KRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSL 1802
            +Y   Y+ S+  P + W  +A++  W+           +  I K   + KW  G   N+ YN LDR+V  G G++IA   E  N P   +  +TY++LL+EV   A V+ D   IR GD+V +Y P+I +  I +LAC RIGA +S V+ GFS  ++A ++   +  L++T + A+        K   D A   + E  H  + CI+ +    V      H          RD  W  +M+      +   +D+  P+ ++YTSGSTG+PKG++  T   +       K     K  ++ W  GD  W+TG  ++ +G L N  TS+++EG   +P +     ++  +K   F+++P  +R   K             LK     GE  +     W      K  C + D + QTE     + P  G    K  S S P  G+   ++D + G  ++ E  G +V   P  P +  T Y +HER+  TYF+++PG+Y T D   +  +G + I  RVDD++ ++GH +S+  VE +  ++  ++   V+     +        I  NE+    D+++  +  ++V+  +G F +   +   P L +T+SGK +RR L
Sbjct:   25 EYQKFYQESLDNPAEFWSRVAKQFHWETPADQDKFLKYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEG-NHPDDYSRGLTYRKLLEEVCRFANVLKDH-GIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFPGNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLD-ECGIEIKGEGEGYLVFSQPW-PGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNEN-EVFDQKLISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVL 636          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0078414)

HSP 1 Score: 190.66 bits (483), Expect = 1.341e-52
Identity = 132/492 (26.83%), Postives = 228/492 (46.34%), Query Frame = 3
Query:  390 PVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKA---IMESKHKPQHCIIYNRPGTVPASLVGH----------RDLDWEYQMQGARHHRHVP-LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWIS---SKFHCPVYDIWGQTELHSIGVGPNLGL-KRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSL 1802
            P+I +  I +LAC RIGA +S V+ GFS  ++A ++   +  L++T + A+        K   D A   + E  H  + CI+ +    V      H          RD  W  +M+      +   +D+  P+ ++YTSGSTG+PKG++  T   +       K     K  ++ W  GD  W+TG  ++ +G L N  TS+++EG   +P +     ++  +K   F+++P  +R   K             LK     GE  +     W      K  C + D + QTE     + P  G    K  S S P  G+   ++D + G  ++ E  G +V   P  P +  T Y +HER+  TYF+++PG+Y T D   +  +G + I  RVDD++ ++GH +S+  VE +  ++  ++   V+     +        I  NE+    D+++  +  ++V+  +G F +   +   P L +T+SGK +RR L
Sbjct:    2 PMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEPACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFPGNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLD-ECGIEIKGEGEGYLVFSQPW-PGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNEN-EVFDQKLISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVL 490          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:ZFIN;Acc:ZDB-GENE-060503-816])

HSP 1 Score: 422.165 bits (1084), Expect = 5.414e-139
Identity = 221/624 (35.42%), Postives = 352/624 (56.41%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKF--DNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTE----LHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            Y+D + L+  +P+  W E A  + W +++T  L   +   PKWFVGGK+N+ YN +DRHV  G G++ A++++SP +     ITY+E+ ++V  LAGV+V K  ++ GD V++Y P++PQ M  +LAC RIGAT+S ++GGF+S  ++++IDH +P L++T +          Y   ++KA+  S HKP   +IYNRP     S      LDWE +M  AR H  V + ++HP+ ++YTSG+TG PKG+V  +G       + M    GL   EV W   D  W+ G  ++ +G LL+  T++LYE    G P+  A   +M  H  A  F++P  +R  R+   +    + +  + L++ F+ GE  D     W    F  PV D W QTE    + +  VG    L     +   PV G N  +ID    + ++  TLG IV+K P+ P  +++ +++H  +   YFT++ G+YDTMD G     G + I +R DDVI +AGHR+S+ ++EE  L +  +    V+ LED L  ++P+AL V   D + S++++    V+LV+  +G    F+KV  V  L +T+SGK  R SL +++N K YK+S  + +P  ++ I  +L
Sbjct:    2 YEDAFGLARDKPDTFWSEAALGITWFERWTKTLDNTDLVFPKWFVGGKLNVCYNAVDRHVENGRGDQAAVIYDSPVTGTKQVITYREVQEQVSRLAGVLV-KHGVKMGDLVVIYMPMVPQAMFTMLACARIGATHSLIFGGFASKELSSRIDHAKPKLLVTASFGIEPGRLVEYIPLVEKALELSTHKPHKVLIYNRPSMEKVSTRPDLTLDWEEEMSTARPHDCVSVSAHHPLYVLYTSGTTGSPKGVVRDSGGYAVMLNWTMSNVYGLAPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDPGAFFRVMSEHGTACMFTAPTAIRAIRQQDPQAEHGKLYPLNRLRNLFVAGERCDIETLEWAKKSFGVPVLDHWWQTESGSSITASCVGLGCSLAPPPGTAGKPVPGYNVTVIDDDM-QQVKPRTLGNIVVKLPLPPGAALSLWQNHMLFKELYFTKFTGYYDTMDAGFVDEEGFLYIMARSDDVINVAGHRLSTGALEESVLLHPAVVDCAVVGLEDSLKGHVPLALCVLRNDCKESEDDLVKGLVKLVRDTIGPVAAFRKVFFVKALPKTRSGKIPRSSLANLVNQKPYKISPTIEDPEVFKDIEKML 623          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:ZFIN;Acc:ZDB-GENE-060503-816])

HSP 1 Score: 399.053 bits (1024), Expect = 1.957e-129
Identity = 214/624 (34.29%), Postives = 342/624 (54.81%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG----YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKF--DNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTE----LHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            Y+D + L+  +P+  W E A  + W +++T  L   +   PKWFVGGK+N+ YN +DRHV  G G++ A++++SP +     ITY+E+ ++V  LAGV+V K  ++ GD V++Y P++PQ M  +LAC RIGAT+S ++GGF+S  ++++IDH +P L++T +          Y   ++KA+  S HKP   +IYNRP     S      LDWE +M  AR H  V + ++HP+ ++YTSG+TG PK                           V W   D  W+ G  ++ +G LL+  T++LYEG     P+  A   +M  H  A  F++P  +R  R+   +    + +  + L++ F+ GE  D     W    F  PV D W QTE    + +  VG    L     +   PV G N  +ID    + ++  TLG IV+K P+ P  +++ +++H  +   YFT++ G+YDTMD G     G + I +R DDVI +AGHR+S+ ++EE  L +  +    V+ LED L  ++P+AL V   D + S++++    V+LV+  +G    F+KV  V  L +T+SGK  R SL +++N K YK+S  + +P  ++ I  +L
Sbjct:   84 YEDAFGLARDKPDTFWSEAALGITWFERWTKTLDNTDLVFPKWFVGGKLNVCYNAVDRHVENGRGDQAAVIYDSPVTGTKQVITYREVQEQVSRLAGVLV-KHGVKMGDLVVIYMPMVPQAMFTMLACARIGATHSLIFGGFASKELSSRIDHAKPKLLVTASFGIEPGRLVEYIPLVEKALELSTHKPHKVLIYNRPSMEKVSTRPDLTLDWEEEMSTARPHDCVSVSAHHPLYVLYTSGTTGSPK---------------------------VWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDPGAFFRVMSEHGTACMFTAPTAIRAIRQQDPQAEHGKLYPLNRLRNLFVAGERCDIETLEWAKKSFGVPVLDHWWQTESGSSITASCVGLGCSLAPPPGTAGKPVPGYNVTVIDDDM-QQVKPRTLGNIVVKLPLPPGAALSLWQNHMLFKELYFTKFTGYYDTMDAGFVDEEGFLYIMARSDDVINVAGHRLSTGALEESVLLHPAVVDCAVVGLEDSLKGHVPLALCVLRNDCKESEDDLVKGLVKLVRDTIGPVAAFRKVFFVKALPKTRSGKIPRSSLANLVNQKPYKISPTIEDPEVFKDIEKML 678          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss1 (acyl-CoA synthetase short chain family member 1 [Source:ZFIN;Acc:ZDB-GENE-050320-139])

HSP 1 Score: 268.47 bits (685), Expect = 9.820e-80
Identity = 173/602 (28.74%), Postives = 300/602 (49.83%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQE-VIWDQQYTDVL-IEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPG-TVPASLVGHRDLDWEYQMQG-ARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGP---NLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSL 1802
            +Y DLY+LS+  PE  W  +A+E + W + +  V   +  S    WF+GG++N+S NCLD HV     +++A++ E        +ITY+ELL+    LA  +     ++ G++V +Y PV P  +  +LAC RIGA ++ V+ GFSS A+A +I   +   ++TCN         + K T+DKA+ +S    +H  +  R   +VP   +G  D+  E  M G +      P++S   + ++YTSGSTG+PKG+V      +       +Y       +V   + D  W+TG  ++ +G L N  TS+L+E    YP      E ++  +   F+ +P  +R   K   E ++ +K+D  +LK+    GE  +    +W   +     CP+ D W QTE   + + P     G + +      P  G+  +++  K      N+  G + I  P  P ++ T + DH+R++  YF  Y G Y T D   +  +G  +I  R+DDVI ++GHR+ +  +E+   ++ ++    V+ +   +   +P A +V  E +  + + +  E   LV   + K+ +    ++V  L +T+SGK +RR L
Sbjct:   61 NYADLYELSVKDPENFWGSIAKERLAWTKPFDQVSDCDISSGKINWFLGGQLNVSVNCLDVHVAND-PSRVALIWEKDEPGTEERITYRELLEMTCRLANTLKSH-GVQRGERVAIYMPVSPMAVAAMLACARIGAVHTVVFAGFSSEALAGRIQDAQCKFVITCNQGVRGGRVFDLKSTVDKAV-KSCPSVRHVFVAKRTNNSVP---MGKLDIPLEEVMAGQSSECAPEPMESEEMLFMLYTSGSTGKPKGIVHTQAGYLLYASLTHQYVFDYTPGDVFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVYPNPGRYWETVQRLRINQFYGAPTAIRLLLK--YEESWVKKYDRSSLKTLASVGEPINHEAWDWFHNVVGDGRCPLVDTWWQTETGGVCIAPLPAEPGAEIRPAMAMRPFFGIKPELLGEKGQIITGNDVNGALCISQPW-PGMARTIFGDHQRFVDAYFKPYQGQYFTGDGAYRTEDGYYQITGRMDDVINISGHRLGTAEIEDALDEHPDVPETAVIGIPHEIKGEVPFAFVVLKESAAENQQAVVNELRHLVASKIAKYAVPDHFLVVKRLPKTRSGKIMRRIL 653          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 239.965 bits (611), Expect = 2.837e-69
Identity = 175/623 (28.09%), Postives = 299/623 (47.99%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIE------KESPTPKWFVGGKINMSYNCLDRHVLE-GYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP---QHCIIYNR--------PGTV--PASLVG---------HRDLDWEYQMQGARHH-RHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGP-NLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSL 1802
            Y +LY  S+  PE+ W ++A++  W  +YT   ++      K     K   G   N+ YN LDR+V E   G+++A   E         +TY+ELL +V   A V+  +  ++ GD+V +Y P++ + ++ +LAC RIGA +S V+ GFSS ++  +I   +  L++T +  Y      N K   D+A+ + + K    + CI+            G++  PA               D+ W   + GA      V  DS  P+ I+YTSGSTG+PKG++      +       K      SD+V W   D  W+TG  ++T+G L N  TS+L+EG   YP+ S + E++  +  + F+++P  +R   K  ++     K  +LK     GE  +     W   +  +  CPV D + QTE     + P       K  S + P  G+   I++ ++GE L   + G +V K P  P +  T Y +H R+  TYF ++PG+Y T D   +  +G   I  R+DD++ ++GH +S+  VE   +++E ++   V+     +        +  N D  + +++++ E  + V+  +G       +   P L +T+SGK +RR L
Sbjct:   30 YKELYIKSVESPEEFWADVAKDFFWKTKYTGKFLDYNFDVTKGEIYIKCMEGATTNICYNVLDRNVHERKLGDRVAFYWEGNEPGDEKTVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSSESLCERIMDSQCCLLITADGFYRGDKLINLKLIADEALKKCRDKSFPVEKCIMLKHLTKEDEASSGSLSPPAKRACPDLQVPWNPEVDMCWHSLIGGASEECEPVWCDSEDPLFILYTSGSTGKPKGVLHTVSGYMLYTASTFKMVFDYHSDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGSDPVHKYKRTSLKILGTVGEPINPEAWQWYYNVVGEKRCPVVDTFWQTETGGHVMTPLPAATPMKPGSATFPFFGVVPAILN-ESGEELEGPSEGYLVFKQPW-PGVMRTVYGNHLRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGRPHPVKGESLYCFVTLN-DGINYNQKLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVL 648          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 238.81 bits (608), Expect = 1.127e-68
Identity = 176/639 (27.54%), Postives = 300/639 (46.95%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIE------KESPTPKWFVGGKINMSYNCLDRHVLE-GYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP---QHCIIYNR--------PGTV-PASLVGHRDLDWEYQMQGARHHRHVP---------------------------LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGP-NLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSL 1802
            Y +LY  S+  PE+ W ++A++  W  +YT   ++      K     K   G   N+ YN LDR+V E   G+++A   E         +TY+ELL +V   A V+  +  ++ GD+V +Y P++ + ++ +LAC RIGA +S V+ GFSS ++  +I   +  L++T +  Y      N K   D+A+ + + K    + CI+            G++ P +     DL  E Q +  R  R  P                            DS  P+ I+YTSGSTG+PKG++      +       K      SD+V W   D  W+TG  ++T+G L N  TS+L+EG   YP+ S + E++  +  + F+++P  +R   K  ++     K  +LK     GE  +     W   +  +  CPV D + QTE     + P       K  S + P  G+   I++ ++GE L   + G +V K P  P +  T Y +H R+  TYF ++PG+Y T D   +  +G   I  R+DD++ ++GH +S+  VE   +++E ++   V+     +        +  N D  + +++++ E  + V+  +G       +   P L +T+SGK +RR L
Sbjct:   30 YKELYIKSVESPEEFWADVAKDFFWKTKYTGKFLDYNFDVTKGEIYIKCMEGATTNICYNVLDRNVHERKLGDRVAFYWEGNEPGDEKTVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSSESLCERIMDSQCCLLITADGFYRGDKLINLKLIADEALKKCRDKSFPVEKCIMLKHLTKEDEASSGSLSPPAKRACPDLQQEKQKERVRKVRPPPQVPWNPEVDMCWHSLIGGASEECEPVWCDSEDPLFILYTSGSTGKPKGVLHTVSGYMLYTASTFKMVFDYHSDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGSDPVHKYKRTSLKILGTVGEPINPEAWQWYYNVVGEKRCPVVDTFWQTETGGHVMTPLPAATPMKPGSATFPFFGVVPAILN-ESGEELEGPSEGYLVFKQPW-PGVMRTVYGNHLRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGRPHPVKGESLYCFVTLN-DGINYNQKLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVL 664          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 437.187 bits (1123), Expect = 1.038e-143
Identity = 227/627 (36.20%), Postives = 359/627 (57.26%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            +Y+ +++ S+ +PEKVW E A  + W + ++ ++     P  KWF+ G++N+ YN +DRH+  G G++ AI+++SP +     ITYKE+ ++V  LA V+  K  ++ GD+V++Y P+IPQ    +LAC RIGA +S ++GGF+S  +A +IDH +P LI+T +          Y   +++A+  ++HKP+  +IY+RP      L   RDLDW  ++  A  H  VP+ S HP+ ++YTSG+TG PKG+V ++        + M    GL   +V W   D  W+ G  ++ +G LL+  TS+LYE    G P+ SA   ++  H  A  F++P  +R  R+   E    + F     ++ F+ GE  D     W    F  PV D W QTE  S      IG+G +  LK        PV G N KI+D+   E   N TLG IV+K P+ P    T +K+   +   YFT++PG+YDTMD G +  +G I + SRVDDVI +AGHR+S+ ++EE  L ++ ++   V+ LED L  ++P+AL V       + E+I+ E V LV+ ++G    F+KVVIV  L +T+SGK  R +L+ ++NGK YK+ + + +P  ++ + D +
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNS--LKPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKIGSTIEDPDVFKYVEDAV 708          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 429.098 bits (1102), Expect = 1.997e-140
Identity = 225/610 (36.89%), Postives = 350/610 (57.38%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKM 1835
            +Y+ +++ S+ +PEKVW E A  + W + ++ ++     P  KWF+ G++N+ YN +DRH+  G G++ AI+++SP +     ITYKE+ ++V  LA V+  K  ++ GD+V++Y P+IPQ    +LAC RIGA +S ++GGF+S  +A +IDH +P LI+T +          Y   +++A+  ++HKP+  +IY+RP      L   RDLDW  ++  A  H  VP+ S HP+ ++YTSG+TG PKG+V ++        + M    GL   +V W   D  W+ G  ++ +G LL+  TS+LYE    G P+ SA   ++  H  A  F++P  +R  R+   E    + F     ++ F+ GE  D     W    F  PV D W QTE  S      IG+G +  LK        PV G N KI+D+   E   N TLG IV+K P+ P    T +K+   +   YFT++PG+YDTMD G +  +G I + SRVDDVI +AGHR+S+ ++EE  L ++ ++   V+ LED L  ++P+AL V       + E+I+ E V LV+ ++G    F+KVVIV  L +T+SGK  R +L+ ++NGK YK+
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNS--LKPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKV 691          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 426.787 bits (1096), Expect = 8.253e-140
Identity = 228/621 (36.71%), Postives = 354/621 (57.00%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG----YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYK-MSTMVNNPGAY 1865
            +Y+ +++ S+ +PEKVW E A  + W + ++ ++     P  KWF+ G++N+ YN +DRH+  G G++ AI+++SP +     ITYKE+ ++V  LA V+  K  ++ GD+V++Y P+IPQ    +LAC RIGA +S ++GGF+S  +A +IDH +P LI+T +          Y   +++A+  ++HKP+  +IY+RP  V       RDLDW  ++  A  H  VP+ S HP+ ++YTSG+TG PKG+V ++        + M    GL   +V W   D  W+ G  ++ +G LL+  TS+LYEG     P+ SA   ++  H  A  F++P  +R  R+   E    + F     ++ F+ GE  D     W    F  PV D W QTE  S      IG+G +L  K        PV G N KI+D+   E   N TLG IV+K P+ P    T +K+   +   YFT++PG+YDTMD G +  +G I + SRVDDVI +AGHR+S+ ++EE  L ++ ++   V+ LED L  ++P+AL V       + E+I+ E V LV+ ++G    F+KVVIV  L +T+SGK  R +L+ ++NGK YK  S    +PG +
Sbjct:   82 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMV---CNAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSL--KPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKAASPQAAHPGTH 695          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 412.92 bits (1060), Expect = 2.655e-134
Identity = 218/610 (35.74%), Postives = 343/610 (56.23%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKM 1835
            +Y+ +++ S+ +PEKVW E A  + W + ++ ++     P  KWF+ G++N+ YN +DRH+  G G++ AI+++SP +     ITYKE+ ++V  LA V+  K  ++ GD+V++Y P+IPQ    +LAC RIGA +S ++GGF+S  +A +IDH +P LI+T +          Y   +++A+  ++HKP+  +IY+RP      L   RDLDW  ++  A  H  VP+ S HP+ ++YTSG+TG PKG+V ++        + M    GL   +V W   D  W+ G  ++ +G LL+  TS+LYE    G P+ SA   ++  H  A  F++P  +R  R+   E    + F     ++ F+ GE  D     W    F  PV D W QTE  S      IG+G +  LK        PV G N K       + LR   L    ++ P+ P    T +K+   +   YFT++PG+YDTMD G +  +G I + SRVDDVI +AGHR+S+ ++EE  L ++ ++   V+ LED L  ++P+AL V       + E+I+ E V LV+ ++G    F+KVVIV  L +T+SGK  R +L+ ++NGK YK+
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNS--LKPPAGQAGKPVPGYNGK-------QNLRKLLLATYPLRLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKV 685          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 409.068 bits (1050), Expect = 4.226e-133
Identity = 220/610 (36.07%), Postives = 340/610 (55.74%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG----YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKM 1835
            +Y+ +++ S+ +PEKVW E A  + W + ++ ++     P  KWF+ G++N+ YN +DRH+  G G++ AI+++SP +     ITYKE+ ++V  LA V+  K  ++ GD+V++Y P+IPQ    +LAC RIGA +S ++GGF+S  +A +IDH +P LI+T +          Y   +++A+  ++HKP+  +IY+RP      L   RDLDW  ++  A  H  VP+ S HP+ ++YTSG+TG PK                           V W   D  W+ G  ++ +G LL+  TS+LYEG     P+ SA   ++  H  A  F++P  +R  R+   E    + F     ++ F+ GE  D     W    F  PV D W QTE  S      IG+G +L  K        PV G N KI+D+   E   N TLG IV+K P+ P    T +K+   +   YFT++PG+YDTMD G +  +G I + SRVDDVI +AGHR+S+ ++EE  L ++ ++   V+ LED L  ++P+AL V       + E+I+ E V LV+ ++G    F+KVVIV  L +T+SGK  R +L+ ++NGK YK+
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPK---------------------------VWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSL--KPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKV 664          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss3 (acyl-CoA synthetase short-chain family member 3 [Source:MGI Symbol;Acc:MGI:2685720])

HSP 1 Score: 427.172 bits (1097), Expect = 2.484e-140
Identity = 222/627 (35.41%), Postives = 353/627 (56.30%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            +Y   +  S+  PE+ W + A+++ W + +T  L  +  P+  WFV G +N+ YN +DRH+  G G+KIAI+++SP +     I+YKE+L++V  LAGV+V K  ++ GD V++Y P+IPQ +  +LAC RIGA +S ++GGF+S  ++T+IDH +P +++T +          Y   +++A+   +H+P   +IY+RP      L+  RDLDWE +M  A+ H  VP+ S HP+ I+YTSG+TG PKG+V  TG       + M    GLK  EV W   D  W+ G  ++ +G LL+  T++LYE    G P+  A   ++  H  A  F++P  +R  R+        +++     K+ F+ GE  D     W    F  PV D W QTE  S      IG+G +         + VP  G N  I+D    + L+  +LG IV+K P+ P      +K+ E +   YF ++PG+YDTMD G     G + + SRVDDVI +AGHR+S+ ++EE  L +  ++   V+  ED L  ++P+AL V  +D  +S+E++  E V+ V+  +G    F+  V V  L +T+SGK  R +L+ ++NGK YK++  + +P  +  I +VL
Sbjct:   56 EYKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHRPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKCVP--GYNVMILDDNM-QKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVPLALCVLKKDVNASEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVTPTIEDPSIFGHIEEVL 678          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss3 (acyl-CoA synthetase short-chain family member 3 [Source:MGI Symbol;Acc:MGI:2685720])

HSP 1 Score: 293.508 bits (750), Expect = 3.501e-91
Identity = 153/445 (34.38%), Postives = 243/445 (54.61%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGR 1340
            +Y   +  S+  PE+ W + A+++ W + +T  L  +  P+  WFV G +N+ YN +DRH+  G G+KIAI+++SP +     I+YKE+L++V  LAGV+V K  ++ GD V++Y P+IPQ +  +LAC RIGA +S ++GGF+S  ++T+IDH +P +++T +          Y   +++A+   +H+P   +IY+RP      L+  RDLDWE +M  A+ H  VP+ S HP+ I+YTSG+TG PKG+V  TG       + M    GLK  EV W   D  W+ G  ++ +G LL+  T++LYE    G P+  A   ++  H  A  F++P  +R  R+        +++     K+ F+ GE  D     W    F  PV D W QTE  S      IG+G +         + VP  G N + +   + E+L    +G+
Sbjct:   56 EYKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHRPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKCVP--GYNGRYLLHHSAESLTPPAMGK 497          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss1 (acyl-CoA synthetase short-chain family member 1 [Source:MGI Symbol;Acc:MGI:1915988])

HSP 1 Score: 242.276 bits (617), Expect = 4.889e-70
Identity = 176/633 (27.80%), Postives = 307/633 (48.50%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQE-VIWDQQYTDVL-IEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGT-VPASLVGHRDLDWEYQMQGARHHRHVP------LDSNHPILIIYTSGSTGEPKGMVCATGN----IVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMN--FKIID---SKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQL-VQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMIN--GKDYKMSTMVNNP 1856
            Y  L   +  +P   W  LA++ ++WD  Y  V   +  +    WF+GG++N+S NCLD+HV +     IA++ E       ++ITY+ELL+    LA  +  +  +  GD+V +Y PV P  +  +LAC RIGA ++ V+ GFS+ ++A +I+  +   ++T N           K+ +D+A+ +S    QH ++ +R  T VP   +G  D+  E +M      +  P      + S   + ++YTSGSTG PKG+V            + K V  YQ G    +V   + D  W+TG  ++ +G L N  T++L+E    YP+     E ++  K   F+ +P  +R   K      + +K+D  +L++    GE  +     W   +     C + D W QTE   I + P      +D ++ +P + M   F I+     + G  L    +   +  +   P ++ T Y DH+R++  YF  YPG+Y T D   +   G  +I  R+DDVI ++GHR+ +  +E+    +  +    V+     +      A IV  ++   SDE + +  ++L V   + K+ +  ++++V  L +T+SGK +RR L  +I   G+D   +T + +P
Sbjct:   51 YPALSAQAAQEPAAFWGPLARDTLVWDTPYHTVWDCDFRTGKIGWFLGGQLNVSVNCLDQHV-QKSPETIALIWERDEPGTEVRITYRELLETTCRLANTL-KRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAIHTVVFAGFSAESLAGRINDAKCKAVITFNQGLRGGRVVELKKIVDEAV-KSCPTVQHVLVAHRTDTKVP---MGSLDIPLEQEMA-----KEAPVCTPESMSSEDMLFMLYTSGSTGTPKGLVHTQAGYLLYAAMTHKLVFDYQPG----DVFGCVADIGWITGHSYVVYGPLCNGATTVLFESTPVYPDAGRYWETVQRLKINQFYGAPTAVRLLLKYGDA--WVKKYDRSSLRTLGSVGEPINHEAWEWLHKVVGDGRCTLVDTWWQTETGGICIAPR---PSEDGAEILPGMAMRPFFGIVPVLMDEKGNVLEGGDVSGALCISQAWPGMARTIYGDHQRFVDAYFRAYPGYYFTGDGAHRTEGGYYQITGRMDDVINISGHRLGTAEIEDAMADHPAVPETAVIGYPHDIKGEAAFAFIVLKDN--ISDENMVVNELKLSVATKIAKYAVPDQILVVKRLPKTRSGKVMRRLLRKIITSRGQDLGDTTTLEDP 661          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss2 (acyl-CoA synthetase short-chain family member 2 [Source:MGI Symbol;Acc:MGI:1890410])

HSP 1 Score: 228.794 bits (582), Expect = 5.701e-65
Identity = 183/659 (27.77%), Postives = 300/659 (45.52%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIE------KESPTPKWFVGGKINMSYNCLDRHVLEG-YGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHK--PQHCIIYNR-----------------PGTVPASLVG-----HRDLDWEYQMQGARHHRHVP-LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGPNLGL-KRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMI-NGKDYKMSTMVNNPGAYQLIYDVLINHGF 1901
            Y +L++ S+ +P + W  +A+E  W        ++      K     +W  G   N+ YN LDR+V E   G+K+A   E      T KITY+ELL +V   + V+  K  I+ GD+V +Y P+I + ++ +LAC R+GA +S V+ GFS+ ++  +I      L++T +  Y      N KE  D+++ + + K  P  C I  +                 P   P   V        DL W   MQ A         D+  P+ I+YTSGSTG+PKG+V   G  +       KY      ++V W   D  W+TG  ++T+G L N  TS+L+EG   YP++  +  ++  +K   F+++P  +R   K   +        +L+     GE  +     W   +     CP+ D + QTE     + P  G    K  S S P  G+   I++    E L  E  G +V K P  P +  T Y +H R+  TYF ++PG+Y T D   +  +G   I  R+DD++ ++GH +S+  VE   +++E ++   V+     +     +   V   D  +    +  E  + ++  +G       +   P L +T+SGK +RR L  +  N  D   ++ V +P         +INH F
Sbjct:   47 YRELHRRSVEEPREFWGNIAKEFYWKTACPGPFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQFSNVL-RKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQICWNEGVDLWWHELMQQAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSASFPFFGVAPAILNESG-EELEGEAEGYLVFKQPW-PGIMRTVYGNHTRFETTYFKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGEC-LYCFVTLCDGHTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDTSTVADPS--------VINHLF 693          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss2 (acyl-CoA synthetase short-chain family member 2 [Source:MGI Symbol;Acc:MGI:1890410])

HSP 1 Score: 225.713 bits (574), Expect = 8.809e-64
Identity = 183/672 (27.23%), Postives = 301/672 (44.79%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIE------KESPTPKWFVGGKINMSYNCLDRHVLEG-YGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHK--PQHCIIYNR-----------------PGTVPASLVGHR------------------DLDWEYQMQGARHHRHVP-LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGPNLGL-KRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMI-NGKDYKMSTMVNNPGAYQLIYDVLINHGF 1901
            Y +L++ S+ +P + W  +A+E  W        ++      K     +W  G   N+ YN LDR+V E   G+K+A   E      T KITY+ELL +V   + V+  K  I+ GD+V +Y P+I + ++ +LAC R+GA +S V+ GFS+ ++  +I      L++T +  Y      N KE  D+++ + + K  P  C I  +                 P   P   V  +                  DL W   MQ A         D+  P+ I+YTSGSTG+PKG+V   G  +       KY      ++V W   D  W+TG  ++T+G L N  TS+L+EG   YP++  +  ++  +K   F+++P  +R   K   +        +L+     GE  +     W   +     CP+ D + QTE     + P  G    K  S S P  G+   I++    E L  E  G +V K P  P +  T Y +H R+  TYF ++PG+Y T D   +  +G   I  R+DD++ ++GH +S+  VE   +++E ++   V+     +     +   V   D  +    +  E  + ++  +G       +   P L +T+SGK +RR L  +  N  D   ++ V +P         +INH F
Sbjct:   47 YRELHRRSVEEPREFWGNIAKEFYWKTACPGPFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQFSNVL-RKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQGKLREKSKCIRPQICWNEGVDLWWHELMQQAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSASFPFFGVAPAILNESG-EELEGEAEGYLVFKQPW-PGIMRTVYGNHTRFETTYFKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGEC-LYCFVTLCDGHTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDTSTVADPS--------VINHLF 706          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|A0A0G2K047|ACSS3_RAT (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acss3 PE=1 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 4.041e-141
Identity = 223/627 (35.57%), Postives = 354/627 (56.46%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            +Y   +  S+  PE+ W + A+++ W + +T  L  +  P+  WFV G +N+ YN +DRH+  G G+KIAI+++SP +     I+YKE+L++V  LAGV+V K  ++ GD V++Y P+IPQ +  +LAC RIGA +S ++GGF+S  ++T+IDH++P +++T +          Y   +++A+   +HKP   +IYNRP      L+  RDLDWE +M  A+ H  VP+ S HP+ I+YTSG+TG PKG+V  TG       + M    GLK  EV W   D  W+ G  ++ +G LL+  T++LYE    G P+  A   ++  H  A  F++P  +R  R+        +++     K+ F+ GE  D     W    F  PV D W QTE  S      IG+G +         + VP  G N  I+D    + L+  +LG IV+K P+ P      +K+ E +   YF ++PG+YDTMD G     G + + SRVDDVI +AGHR+S+ ++EE  L +  ++   V+  ED L  ++P+AL V  +D  +++E++  E V+ V+  +G    F+  V V  L +T+SGK  R +L+ ++NGK YK++  + +P  +  I +VL
Sbjct:   57 EYKTHFAASVADPERFWGKAAEQISWYKPWTKTLENRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYAMLACARIGAIHSLIFGGFASKELSTRIDHVKPKVVVTASFGIEPGRKVEYMPLLEEALRIGQHKPDRLLIYNRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKCVP--GYNVMILDDNM-QKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVTDCAVVGKEDPLKGHVPLALCVLKKDVNATEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVTPTIEDPSIFGHIEEVL 679          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|Q9H6R3|ACSS3_HUMAN (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSS3 PE=1 SV=1)

HSP 1 Score: 429.098 bits (1102), Expect = 3.217e-140
Identity = 221/627 (35.25%), Postives = 356/627 (56.78%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            +Y   +  S+  PE+ W + A+++ W + +T  L  K SP+ +WFV G +N+ YN +DRH+  G G+KIAI+++SP +      TYKE+L++V  LAGV+V K  I+ GD V++Y P+IPQ M  +LAC RIGA +S ++GGF+S  ++++IDH++P +++T +          Y   +++A+   +HKP   +IYNRP      L   RDLDW+ +M  A+ H  VP+ S HP+ I+YTSG+TG PKG++  TG       + M    GL+  EV W   D  W+ G  ++ +G LL+  T++LYE    G P+  A   ++  H  A  F++P  +R  R+        +++     K+ F+ GE  D     W  + F  PV D W QTE  S      +G+G +         +SVP  G N  I+D    + L+   LG IV+K P+ P      +K+ E +   YF ++PG+YDTMD G     G + + SRVDDVI +AGHR+S+ ++EE  L +  ++   V+  ED L  ++P+AL V  +D  +++E++  E V+ V+  +G    F+  V V  L +T+SGK  R +L+ ++NGK YK+++ + +P  +  + ++L
Sbjct:   61 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVP--GYNVMILDDNM-QKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEML 683          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|Q5REB8|ACSS3_PONAB (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Pongo abelii OX=9601 GN=ACSS3 PE=2 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 4.943e-140
Identity = 221/627 (35.25%), Postives = 355/627 (56.62%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            +Y   +  S+  PE+ W + A+++ W + +T  L  K SP+  WFV G +N+ YN +DRH+  G G+KIAI+++SP +      TYKE+L++V  LAGV+V K  I+ GD V++Y P+IPQ M  +LAC RIGA +S ++GGF+S  ++++IDH++P +++T +          Y   +++A+   +HKP   +IYNRP      L   RDLDW+ +M  A+ H  VP+ S HP+ I+YTSG+TG PKG++  TG       + M    GL+  EV W   D  W+ G  ++ +G LL+  T++LYE    G P+  A   ++  H  A  F++P  +R  R+        +++     K+ F+ GE  D     W  + F  PV D W QTE  S      +G+G +         +SVP  G N  I+D    + L+   LG IV+K P+ P      +K+ E +   YF ++PG+YDTMD G     G + + SRVDDVI +AGHR+S+ ++EE  L +  ++   V+  ED L  ++P+AL V  +D  +++E++  E V+ V+  +G    F+  V V  L +T+SGK  R +L+ ++NGK YK+++ + +P  +  + ++L
Sbjct:   61 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTSWFVEGMLNVCYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLNWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVP--GYNVMILDDNM-QKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYVYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEML 683          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|A7MB45|ACSS3_BOVIN (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Bos taurus OX=9913 GN=ACSS3 PE=2 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 1.559e-139
Identity = 227/627 (36.20%), Postives = 352/627 (56.14%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            +Y   +  S+  PE+ W + A+++ W + +T  L  + SP+  WFV G +N+ YN +DRH+  G G+KIAI+++SP +     ITYKE+L++V  LAGV+V K  ++ GD V++Y P+IPQ M  +LAC RIGA +S ++GGF+S  ++T+IDH +P L++T +          Y   +++A+   +HKP   +IYNRP T    L     LDW+ ++  A+ H  VP+ S HP+ I+YTSG+TG PKG+V  TG       + M    GLK  EV W   D  W+ G  ++ +G LL+  T++LYE    G P+  A   ++  H  A  F++P  +R  R+        +++     K+ F+ GE  D     W    F  PV D W QTE  S      IG+G +         +SVP  G N  I+D    + L+   LG IV+K P+ P      +K+ E +   YF ++PG+YDTMD G     G + + SRVDDVI +AGHR+S+ ++EE  L    ++   V+  ED L  ++P+AL V  +D  +++E +  E V+ V+  +G    F+K V V  L +T+SGK  R +L+ ++NGK YK+S  + +PG ++ I  +L
Sbjct:   60 EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENRHSPSTSWFVEGMLNICYNAIDRHIENGKGDKIAIIYDSPVTNTKATITYKEVLEQVSKLAGVLV-KHGVKKGDTVVIYMPMIPQAMYAMLACARIGAIHSLIFGGFASKELSTRIDHAKPKLVITASFGIEPGRKVEYVPLVEEALRIGQHKPDKVLIYNRPHTDMVPLAPGYYLDWDEELSKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWSMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKSVP--GYNVMILDDNM-QKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYVYVMSRVDDVINVAGHRISAGALEESILSLGIVADCAVVGKEDSLKGHIPLALCVLKKDINTTEEHVLEEIVKHVRQTIGPVAAFRKAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVSPTIEDPGIFEHIEAML 682          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|Q14DH7|ACSS3_MOUSE (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Mus musculus OX=10090 GN=Acss3 PE=1 SV=2)

HSP 1 Score: 427.172 bits (1097), Expect = 1.738e-139
Identity = 222/627 (35.41%), Postives = 353/627 (56.30%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            +Y   +  S+  PE+ W + A+++ W + +T  L  +  P+  WFV G +N+ YN +DRH+  G G+KIAI+++SP +     I+YKE+L++V  LAGV+V K  ++ GD V++Y P+IPQ +  +LAC RIGA +S ++GGF+S  ++T+IDH +P +++T +          Y   +++A+   +H+P   +IY+RP      L+  RDLDWE +M  A+ H  VP+ S HP+ I+YTSG+TG PKG+V  TG       + M    GLK  EV W   D  W+ G  ++ +G LL+  T++LYE    G P+  A   ++  H  A  F++P  +R  R+        +++     K+ F+ GE  D     W    F  PV D W QTE  S      IG+G +         + VP  G N  I+D    + L+  +LG IV+K P+ P      +K+ E +   YF ++PG+YDTMD G     G + + SRVDDVI +AGHR+S+ ++EE  L +  ++   V+  ED L  ++P+AL V  +D  +S+E++  E V+ V+  +G    F+  V V  L +T+SGK  R +L+ ++NGK YK++  + +P  +  I +VL
Sbjct:   56 EYKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHRPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKCVP--GYNVMILDDNM-QKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVPLALCVLKKDVNASEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVTPTIEDPSIFGHIEEVL 678          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A402F3A3 (Uncharacterized protein OS=Paroedura picta OX=143630 GN=parPi_0011888 PE=4 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 1.857e-145
Identity = 233/628 (37.10%), Postives = 366/628 (58.28%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRP--GTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            Y+ +Y+ S+ +P K+W E AQ + W + +T  +  ++  +  WFVGG++N+ YN +DRHVL G G++IAI+H+SP +     ITYKE+L++V  LAGVMV K  ++ GD V++Y P+IPQ M  +LAC RIGA +S ++GGF+S  ++T+IDH +P LI+T            Y   ++KA+   +H+P   +IY+RP  GTVP  L   RD+DW+ +M   +    VP+ S+HP+ I+YTSG+TG PKG+V  TG       + M    GL+  EV W   D  W+ G  ++ +G LL+  T++LYE    G P+  A   ++  H  A  F++P  +R  R+  +E    ++++    ++ F+ GE  D     W    F  PV D W QTE  S      +G+G +L        + VP  G N  I+D K  + ++  TLG IV+K P+ P   +  +++   Y   YF ++PG+YDTMD G    +G + + SRVDDVI +AGHR+S+ ++EE  L ++ ++   V+  ED L  ++P+AL V   D  + +E +K E VQ V+  +G    F+KVV V  + +T+SGK  R +L+ ++N K Y++S  + +P A+Q + D L
Sbjct:   64 YEAVYRASVEEPGKLWAEAAQGIEWHKPWTKTMERRDPCSTSWFVGGELNICYNAVDRHVLNGQGDQIAIIHDSPVTNTKEVITYKEVLEQVSKLAGVMV-KHGVKKGDTVVIYMPMIPQTMYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKLIVTSTFGVEPGRKVEYVPLLEKALQMIEHQPDRVLIYSRPKMGTVP--LTQGRDIDWQEEMANTKSCDCVPVLSDHPLYILYTSGTTGTPKGVVRPTGGYAVMLNWTMSAVYGLRPKEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDSEATLGKQYNLTKFRTLFVAGERCDVDTLEWCKKIFKVPVLDHWWQTETGSAITATCVGLGNSLTPPPGQTGRLVP--GYNVVILDDKK-QPVKANTLGNIVVKLPLAPGAFLGLWRNEALYKELYFQKFPGYYDTMDAGYMDEDGYLYVMSRVDDVINVAGHRISAGALEEAVLSHKAVADCAVVGHEDSLKGHVPLALCVLRNDVNTEEERLKEEIVQRVRENIGPVAAFRKVVFVKLIPKTRSGKIPRSALSSLVNRKPYQISPTIEDPAAFQHVEDAL 685          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A1L8GY84 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=acss3 PE=4 SV=1)

HSP 1 Score: 441.81 bits (1135), Expect = 2.876e-142
Identity = 226/627 (36.04%), Postives = 364/627 (58.05%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            +YD +++ S+ QPE+VW E ++++ W + ++ ++     P  KWF+ G++N+ YN +DRH+  G G++ AI+H+SP + I   ITY+E+ ++V  LA V+  K  ++ GD+V++Y P+IPQ    +LAC RIGA +S ++GGF+S  +A +IDH +P LI+T +          Y   +++A+  ++HKP   +IY+RP    A L+  RDLDW  ++  A  H  VP+ S HP+ ++YTSG+TG PKG+V +T        + M    GL   +V W   D  W+ G  ++ +G LL+  TS+LYE    G P+ SA   ++  H  A  F++P  +R  R+   +    + F     ++ F+ GE  D     W    F+ PV D W QTE  S      IG+G +  LK        PV G N KI+D+   E   N TLG IV+K P+ P    T +K+   +   YF ++PG+YDTMD G + ++G I + SRVDDVI +AGHR+S+ ++EE  L +++++   V+ LED L  ++P+AL V       + E+I+ E V  V+ ++G    F+KVVIV  L +T+SGK  R +L+ ++NGK YK+ + + +P  ++ + + +
Sbjct:   86 NYDHVFESSVQQPERVWGEASEKISWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQTAIIHDSPVTGIKQAITYREIYEQVSRLASVL-SKYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPNKILIYSRPNMKEARLMDDRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSTAGYTVMLNWTMSAVYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPDAEMGKPFSLTKFRTLFVAGERCDVETLEWSRKIFNVPVLDHWWQTETGSPITATCIGLGNS--LKPPAGQAGKPVPGYNVKILDNNMQEAKPN-TLGNIVVKLPLPPGAFATLWKNDAMFKDIYFQKFPGYYDTMDAGYKDDDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKDVADCAVVALEDPLKGHVPLALCVLKNGVGQTKEKIESEIVASVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKIGSTIEDPDVFRSVEEAV 708          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A2Y9F581 (acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Physeter macrocephalus OX=9755 GN=ACSS3 PE=4 SV=1)

HSP 1 Score: 439.113 bits (1128), Expect = 1.570e-141
Identity = 229/627 (36.52%), Postives = 356/627 (56.78%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            +Y   +  S+  PE+ W + A+++ W + +T  L  + SP+  WFV G +N+ YN +DRH+  G G+KIAI+++SP +     ITYKE+L++V  LAGV+V K  ++ GD V++Y P+IPQ M  +LAC RIGA +S ++GGF+S  ++++IDH +P +++T +          Y   +++A+   +HKP   +IYNRP   P  L   RDLDW+ +M  A+ H  VP+ S HP+ I+YTSG+TG PKG+V  TG       + M    GLK  EV W   D  W+ G  ++ +G LL+  T++LYE    G P+  A   ++  H  A  F++P  +R  R+        +++     K+ F+ GE  D     W    F  PV D W QTE  S      IG+G +         +SVP  G N  I+D    + L+   LG IV+K P+ P      +K+ E +   YF ++PG+YDTMD G     G I + SRVDDVI +AGHR+S+ ++EE  L +  ++   V+  ED L  ++P+AL V  +D  +++E++  E V+ V+  +G    F+K V V  L +T+SGK  R +L+D++NGK YK+S  + +P  +  I ++L
Sbjct:   60 EYKTHFAASVADPERFWGKAAEQISWYKPWTKTLENRHSPSTSWFVEGMLNICYNAIDRHIENGKGDKIAIIYDSPVTNTKATITYKEVLEQVSKLAGVLV-KHGVKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASRELSSRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHKPDKVLIYNRPNMEPVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWSMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKSVP--GYNVMILDDNM-QKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFRHLYFEKFPGYYDTMDAGYMDEEGYIYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVPLALCVLKKDINTTEEQVLEEIVKHVRQSIGPVAAFRKAVFVKQLPKTRSGKIPRSALSDLVNGKPYKVSPTIEDPSIFGHIEEML 682          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A2Y9M1R1 (acyl-CoA synthetase short-chain family member 3, mitochondrial isoform X5 OS=Delphinapterus leucas OX=9749 GN=ACSS3 PE=4 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 1.304e-140
Identity = 228/627 (36.36%), Postives = 356/627 (56.78%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            +Y   +  S+  PE+ W + A+++ W + +T  L  + SP+  WFV G +N+ YN +DRH+  G G+KIAI+++SP +     ITYKE+L++V  LAGV+V K +++ GD V++Y P+IPQ M  +LAC RIGA +S ++GGF+S  ++++IDH +P +++T +          Y   +++A+   +HKP   +IYNRP   P  L   RDLDW+ +M  A+ H  VP+ S HP+ I+YTSG+TG PKG+V  TG       + M    GLK  EV W   D  W+ G  ++ +G LL+  T++LYE    G P+  A   ++  H  A  F++P  +R  R+        +++     K+ F+ GE  D     W    F  PV D W QTE  S      IG+G +         +SVP  G N  I+D    + L+   LG IV+K P+ P      +K+ E +   YF ++PG+YDTMD G     G I + SRVDDVI +AGHR+S+ ++EE  L +  ++   V+  ED L  ++P+AL V  +D  +++E++  E V+ V+  +G    F+K V V  L +T+SGK  R +L+ ++NGK YK+S  + +P  +  I ++L
Sbjct:   60 EYKTHFAASVADPERFWGKAAEQISWYKPWTKTLENRHSPSTSWFVEGMLNICYNAIDRHIENGKGDKIAIIYDSPVTNTKATITYKEVLEQVSKLAGVLV-KHDVKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASRELSSRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHKPDKVLIYNRPNMEPVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWSMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKSVP--GYNVMILDDNM-QKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYIYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVPLALCVLKKDINTTEEQVLEEIVKHVRQSIGPVAAFRKAVFVKQLPKTRSGKIPRSALSALVNGKPYKVSPTIEDPSIFGHIEEML 682          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A5G3KCT6 (Acyl-CoA synthetase short chain family member 3 OS=Xenopus tropicalis OX=8364 GN=acss3 PE=4 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 1.630e-140
Identity = 227/627 (36.20%), Postives = 359/627 (57.26%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVL 1886
            +Y+ +++ S+ +PEKVW E A  + W + ++ ++     P  KWF+ G++N+ YN +DRH+  G G++ AI+++SP +     ITYKE+ ++V  LA V+  K  ++ GD+V++Y P+IPQ    +LAC RIGA +S ++GGF+S  +A +IDH +P LI+T +          Y   +++A+  ++HKP+  +IY+RP      L   RDLDW  ++  A  H  VP+ S HP+ ++YTSG+TG PKG+V ++        + M    GL   +V W   D  W+ G  ++ +G LL+  TS+LYE    G P+ SA   ++  H  A  F++P  +R  R+   E    + F     ++ F+ GE  D     W    F  PV D W QTE  S      IG+G +  LK        PV G N KI+D+   E   N TLG IV+K P+ P    T +K+   +   YFT++PG+YDTMD G +  +G I + SRVDDVI +AGHR+S+ ++EE  L ++ ++   V+ LED L  ++P+AL V       + E+I+ E V LV+ ++G    F+KVVIV  L +T+SGK  R +L+ ++NGK YK+ + + +P  ++ + D +
Sbjct:   86 NYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNS--LKPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKIGSTIEDPDVFKYVEDAV 708          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: ENSAMXT00000036840.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000552.1:6561:23509:-1 gene:ENSAMXG00000036566.1 transcript:ENSAMXT00000036840.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.58 bits (610), Expect = 2.496e-71
Identity = 121/306 (39.54%), Postives = 178/306 (58.17%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE 962
            Y+  ++ +  +PE+ W E A+ V W   +   L       P+WFVGG++NM YN +DRHV  G G + AI+H+SP +      TY+E+ DEV  LAGV+V K  +R GD V++Y P++PQ M  +LAC RIGA +S ++GGF+S  ++ +IDH +P L++T +          Y   ++KA+  S HKP   +IYNRPG V   L     LDW+ +M  AR    V + S+HP+ ++YTSG+TG PKG+V  TG       + M    GL   EV W   D  W+ G  ++ +  LL+  T++LYE
Sbjct:   68 YEGAFRGARDEPERFWGEAARGVSWFTSWEKTLDCSHPAFPRWFVGGELNMCYNAVDRHVESGRGEQPAIIHDSPVTGSKQIFTYREVQDEVSRLAGVLV-KHGVRKGDLVVIYMPMVPQAMFTMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLLVTASFGVEPGQRVEYIPLVEKALELSSHKPHKVLIYNRPGMVRPCL----GLDWDEEMATARPQDCVGVPSDHPLYVLYTSGTTGTPKGVVRDTGGYAVILNWTMNSVYGLNPGEVWWAASDLGWVVGHSYICYAPLLHGNTTVLYE 368          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: ENSAMXT00000043882.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000552.1:6561:22941:-1 gene:ENSAMXG00000036566.1 transcript:ENSAMXT00000043882.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 241.121 bits (614), Expect = 9.370e-71
Identity = 119/306 (38.89%), Postives = 178/306 (58.17%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE 962
            Y+  ++ +  +PE+ W E A+ V W   +   L       P+WFVGG++NM YN +DRHV  G G + AI+H+SP +      TY+E+ DEV  LAGV+V K  +R GD V++Y P++PQ M  +LAC RIGA +S ++GGF+S  ++ +IDH +P L++T +          Y   ++KA+  S HKP   +IYNRPG    ++     LDW+ +M  AR    V + S+HP+ ++YTSG+TG PKG+V  TG       + M    GL   EV W   D  W+ G  ++ +  LL+  T++LYE
Sbjct:  167 YEGAFRGARDEPERFWGEAARGVSWFTSWEKTLDCSHPAFPRWFVGGELNMCYNAVDRHVESGRGEQPAIIHDSPVTGSKQIFTYREVQDEVSRLAGVLV-KHGVRKGDLVVIYMPMVPQAMFTMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLLVTASFGVEPGQRVEYIPLVEKALELSSHKPHKVLIYNRPGMERVAMSSGLGLDWDEEMATARPQDCVGVPSDHPLYVLYTSGTTGTPKGVVRDTGGYAVILNWTMNSVYGLNPGEVWWAASDLGWVVGHSYICYAPLLHGNTTVLYE 471          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:NCBI gene;Acc:103041660])

HSP 1 Score: 233.417 bits (594), Expect = 7.440e-67
Identity = 183/658 (27.81%), Postives = 310/658 (47.11%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIE------KESPTPKWFVGGKINMSYNCLDRHVLEG-YGNKIAILHESPNSPITIKI-TYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP---QHCIIYNR----------------PG--TVPASLVGHR---DLDWEYQMQGARHH-RHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGP-NLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVA-----LIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMI-NGKDY-KMSTMVNNPGAYQLI 1874
            ++ +LY  S+  PE+ W ++A+E  W  ++T   ++      K     K   G   N+ YN LDR+V E   G+++A   E  N P   KI TY+ELL +V   A V+  +  ++ GD+V +Y P++ + ++ +LAC RIGA +S V+ GFS+ ++  +I      L++T +  Y      N K   D+A+ + + K    + CI+                   P   + P   V  +   D+ W   M+GA      V  +S  P+ I+YTSGSTG+PKG++      +       K       D++ W   D  W+TG  ++T+G L N  TS+L+EG   YP+ S + E++  +  + F+++P  +R   K   +     K  +LK     GE  +     W   +  +  CPV D + QTE     + P       K  S + P  G+   I++ ++GE L     G +V K P  P +  T + +H+R+  TYF ++PG+Y T D   +  +G   I  R+DD++ ++GH +S+  VE   +++E ++   V      + T  PV        V   D  +    ++ E  + V+  +G       +   P L +T+SGK +RR L  +  N +D   +ST+ +     QL 
Sbjct:   29 NFKELYVKSVESPEEFWGDVAKEFFWKTKHTGQFLDYNFDVTKGEIFVKCMEGATTNICYNVLDRNVYEKKLGDRVAFYWEG-NEPGDEKIVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSAESLCERIIDSRCSLLITADGFYRGDKLINLKLIADEALQKCRDKSFPVERCIVLKHLSKEEHESLSLGSLSPPAKRSCPDLQVPWKPEVDVCWHSLMEGASDECEPVWCESEDPLFILYTSGSTGKPKGVLHTVSGYMLYTATTFKLVFDYHPDDIYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGNDPVHKYKRSSLKILGTVGEPINPEAWQWYYNVVGEGRCPVVDTFWQTETGGHVLTPLPAATPLKPGSATFPFFGVVPAILN-ESGEELEGPNEGYLVFKQPW-PGVMRTVFGNHQRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAV------VGTPHPVKGESLYCFVTLADGMNYTTTLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRLLRKIASNQRDLGDVSTLADTSVIEQLF 676          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:NCBI gene;Acc:103041660])

HSP 1 Score: 230.72 bits (587), Expect = 1.101e-65
Identity = 182/674 (27.00%), Postives = 307/674 (45.55%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIE------KESPTPKWFVGGKINMSYNCLDRHVLEG-YGNKIAILHESPNSPITIKI-TYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP---QHCIIYNR-----------PGTVPASLVGHRDLDWEYQMQGARHHRHVP---------------------------LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGP-NLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVA-----LIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMI-NGKDY-KMSTMVNNPGAYQLI 1874
            ++ +LY  S+  PE+ W ++A+E  W  ++T   ++      K     K   G   N+ YN LDR+V E   G+++A   E  N P   KI TY+ELL +V   A V+  +  ++ GD+V +Y P++ + ++ +LAC RIGA +S V+ GFS+ ++  +I      L++T +  Y      N K   D+A+ + + K    + CI+                  P +     DL  E Q    R  R +P                            +S  P+ I+YTSGSTG+PKG++      +       K       D++ W   D  W+TG  ++T+G L N  TS+L+EG   YP+ S + E++  +  + F+++P  +R   K   +     K  +LK     GE  +     W   +  +  CPV D + QTE     + P       K  S + P  G+   I++ ++GE L     G +V K P  P +  T + +H+R+  TYF ++PG+Y T D   +  +G   I  R+DD++ ++GH +S+  VE   +++E ++   V      + T  PV        V   D  +    ++ E  + V+  +G       +   P L +T+SGK +RR L  +  N +D   +ST+ +     QL 
Sbjct:   29 NFKELYVKSVESPEEFWGDVAKEFFWKTKHTGQFLDYNFDVTKGEIFVKCMEGATTNICYNVLDRNVYEKKLGDRVAFYWEG-NEPGDEKIVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSAESLCERIIDSRCSLLITADGFYRGDKLINLKLIADEALQKCRDKSFPVERCIVLKHLSKEEHESLSLGSLSPPAKRSCPDLQQEKQKGNVRKVRSIPKVPWKPEVDVCWHSLMEGASDECEPVWCESEDPLFILYTSGSTGKPKGVLHTVSGYMLYTATTFKLVFDYHPDDIYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGNDPVHKYKRSSLKILGTVGEPINPEAWQWYYNVVGEGRCPVVDTFWQTETGGHVLTPLPAATPLKPGSATFPFFGVVPAILN-ESGEELEGPNEGYLVFKQPW-PGVMRTVFGNHQRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAV------VGTPHPVKGESLYCFVTLADGMNYTTTLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRLLRKIASNQRDLGDVSTLADTSVIEQLF 692          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: acss2l (acetyl-coenzyme A synthetase, cytoplasmic-like [Source:NCBI gene;Acc:107197877])

HSP 1 Score: 226.483 bits (576), Expect = 2.158e-64
Identity = 176/641 (27.46%), Postives = 302/641 (47.11%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIE------KESPTPKWFVGGKINMSYNCLDRHVLE-GYGNKIAILHESPNSPIT-IKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP----QHCIIYNRPG----------TVPASLVGHRDLDWEYQMQGARHHRHVP-LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWISSKF---HCPVYDIWGQTELHSIGVGP-NLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMI-NGKDYKMSTMVNNPGAYQLI 1874
            Y  LYK SI +PE+ W ++AQE  W +  +  +++      K     K+  G K NM YN LDR+VL+   G+++A  H   NSP   + ITY +LL +V   A  +  +  ++ GD+V +Y P+IP+ +  +LAC RIGA +S V+ GFSS ++A +I   +  +++T +  Y        K+  D+A+   + K     + C++                +        D+ W+  ++G         +++  P+ I+YTSGSTG+PKG++      +       KY      D+V W   D  W+TG  ++T+G L N  TS+L+EG   +P      E++  ++ + F+++P  +R   K   E        +L+     GE  +     W         CPV D + QTE     + P       K  S ++P  G+   II ++ GE L  E  G +V + P  P +    Y + ER+  TYF ++PGFY T D   +  +G   I  R+DD++ ++GH +S+  VE    ++  ++   V+     +     +   V  +D R  +  +  E  + V+  +G       +   P L +T+SGK +RR L  +  N KD    + + +P   +++
Sbjct:   32 YLALYKKSIEEPEEFWRDVAQEFYWKEPPSGQMLQYNFDATKGKVYVKFMEGAKTNMCYNVLDRNVLDRNLGSRVA-FHWEGNSPDHHMTITYSQLLKQVCRCANAL-KQMGVKKGDRVAIYLPMIPELVYSMLACARIGAVHSIVFAGFSSESLAERIMDAQCTVLVTADGVYRGDKLIKLKQISDEALDHCREKNSLTVRKCLVVKHHAFRIHGNDTCNKLQTLWNAECDVWWDEAVEGVSDECDPEWMEAEDPLFILYTSGSTGKPKGVLHTIAGYLLYTSLTFKYVFDHHRDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGIPVHPHVGRFWEIIEKYRVSKFYTAPTAIRLLMKYGREPLSKYDLSSLRVLGTVGEPINPEAWLWYHDAVGQGRCPVVDTFWQTETGGHVLTPLPAATPLKPGSATLPFFGV-LPIILNEHGEELEGEAEGYLVFQKPW-PGIMRGVYGNQERFENTYFKKFPGFYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTSEVEAALSEHSAVAEAAVVSRPHTIKGEC-LYCFVTLKDCREFNHTLLEELKRKVREKIGPIATPDFIQNAPALPKTRSGKIMRRVLRQIARNEKDLGDLSTLADPKVVEVL 667          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006895.1 (pep scaffold:Pmarinus_7.0:GL476378:330410:368976:-1 gene:ENSPMAG00000006232.1 transcript:ENSPMAT00000006895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 311.997 bits (798), Expect = 2.447e-99
Identity = 168/479 (35.07%), Postives = 263/479 (54.91%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNF-------SEKFDNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRY 1430
            YD  +KL+  +PE+ W E A+ V W + +  VL + +SP  +WFV G++NM YN LDRHV  G G++ AI+H+SP + I   ITY++ L EV  LA V+V K  ++ GD+V++Y P+IPQ M  +LAC RIGA +S ++GGF+S  +A +I+H +  ++L+ +          YK  ++ A+  + HKP+  ++Y+RPG   ASL+  RD+ W+ ++  A+ H  VP+ S+HP+ I+YTSG+TG PKG+V  TG       + M    GLK  EV W   D  W+ G  ++ +G LL+  T++LYE      P      E+   H   + F    R       ++           +      +S F+ GE+ D    NW  + F+ P+ D W QTE  S       G+G +L        +SVP  G + +++DS   E+ R   LG IV+K P+ P    T ++++++Y  TYF  +
Sbjct:    1 YDAAFKLAKSEPERFWAEAAKGVAWTKSWDRVLDDSKSPYTRWFVDGQLNMCYNALDRHVEAGRGDQAAIIHDSPVTGIIQTITYRQALSEVTRLASVLV-KNGVQKGDRVVIYMPMIPQAMFAMLACARIGAIHSLIFGGFASKELAVRINHAKVSMVLSASFGIEPGRQVAYKPLLEAALDIATHKPEKVLVYSRPGMARASLIPGRDMCWQEEVSAAKPHDCVPVSSDHPLYILYTSGTTGAPKGVVRPTGGHAVMLNWSMSAIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEPAPPVSPPPKVFYEVDEKHGLNLCFIPSPRSHYISLPMSNPQLLYHLYIKTPCVPRFRSMFVAGEICDKETLNWGKATFNVPLLDHWWQTETGSAITATCTGLGGSLYPPAGQCGKSVP--GYDVRVVDSNNQESKRG-NLGNIVVKLPLAPGCMATLWENNQKYEDTYFKSF 475          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 159.458 bits (402), Expect = 5.602e-43
Identity = 112/412 (27.18%), Postives = 189/412 (45.87%), Query Frame = 3
Query:  669 RDLDWEYQMQGARHH-RHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWISSKF---HCPVYDIWGQTELHSIGVGPNLGLKR-KDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMI-NGKDYKMSTMVNNPGAYQLIY 1877
            RD  W   M GA         D+  P+ ++YTSGSTG+PKG++  T   +       K    ++  +V W   D  W+TG  ++ +G L N  TS+L+EG   +P+     + +  +  + F+++P  +R   K+           +L+     GE  +    +W+        CP+ D + QTE     + P  G    K  S ++P  G+   I+D + GE LR E  G +V K P  P +  T + DHER   TYF ++PG+Y T D   +  +G   I  R DD++ ++GH +S+  VE   L + +++   V+     L        +  N      +  +  E  + V+  +G       +   P L +T+SGK +RR L  +  +  D+   + + +PG  QL+Y
Sbjct:   12 RDSWWHELMCGASTTCEPAWCDAEDPLFVLYTSGSTGKPKGVLHTTAGYLLFVATTHKLVFDIRPQDVYWCTADIGWITGHSYIVYGPLANGVTSVLFEGIPTFPDAGRFWQTVEKYAVSKFYTAPTAVRLLMKHGDAFVLKHSRRSLRVLGTVGEPINREAWHWLHGVVGGGRCPIVDTFWQTETGGHVLTPLPGATPLKPGSATLPFFGVEPAILDER-GEELRGEAEGFLVFKRPW-PGILRTVFGDHERLEATYFGKFPGYYATGDGCRRDKDGYYWITGRTDDMLNVSGHLLSTAEVESALLSHGSVAEAAVVGRPHALKGESLYCFVTLNH-GLELNPCLAAELKKRVREKIGPIATPDFIQSAPSLPKTRSGKIMRRLLRKIAQDDSDFGDLSTLADPGVVQLLY 420          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005866.1 (pep scaffold:Pmarinus_7.0:GL495638:310:2296:-1 gene:ENSPMAG00000005307.1 transcript:ENSPMAT00000005866.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.708e-9
Identity = 30/84 (35.71%), Postives = 47/84 (55.95%), Query Frame = 3
Query:  210 LDRHVLEGYGNKIAILHESPNSPITI-KITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAV 458
            L + V E        +H   N P    +ITYKELLD+V   + V++    +  GD+V +Y P+I + ++ +LAC R+GA +S V
Sbjct:   10 LPQQVCEATWVGFVFVHREGNEPGDCNQITYKELLDQVCKCSNVLLSH-GVGKGDRVAIYMPMITELVVAMLACARVGAVHSIV 92          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Match: ACS1 (Acetyl-coA synthetase isoform; along with Acs2p, acetyl-coA synthetase isoform is the nuclear source of acetyl-coA for histone acetylation; expressed during growth on nonfermentable carbon sources and under aerobic conditions [Source:SGD;Acc:S000000050])

HSP 1 Score: 299.286 bits (765), Expect = 4.850e-92
Identity = 193/641 (30.11%), Postives = 324/641 (50.55%), Query Frame = 3
Query:   42 DYDDLYKLSILQPEKVWHELAQEVI-WDQQYTDVLIEKESPTPK----------WFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGAR-HHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWISSKF---HCPVYDIWGQTELHSIGVGPNLG--LKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIV-KNEDSRSSD-----EEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMS--TMVNNPGAYQLIYD 1880
            DY  L+K SI  P K +   A + + W + +  V I    P PK          WF+ G++N  YNC+DRH L+   NK AI+ E         ITYKELL+EV  +A V+     +R GD V +Y P++P+ +I +LA +RIGA +S V+ GFSS ++  +I+  +  +++T + +         K  +D A+ E+    +H ++Y +      +    RDLDW  + +  + ++   P+DS  P+ ++YTSGSTG PKG+  +T   +      M+Y      ++V +  GD  W+TG  ++ +G LL    ++++EG   YP  S   +++  HK   F+ +P  +R  ++       +    +L+     GE     +  W S K      P+ D + QTE  S  V P  G     K  S S P  G++  ++D  TGE L       ++      PS + T +K+H+RY+ TY   YPG+Y T D   +  +G I I  RVDDV+ ++GHR+S+  +E   +++  ++   V+   D L      A +V KN+ S S+      ++IK   V  V+  +G F   + +++V  L +T+SGK +RR L  ++ G+  ++   + ++NPG  + + D
Sbjct:   75 DYQRLHKESIEDPAKFFGSKATQFLNWSKPFDKVFI----PDPKTGRPSFQNNAWFLNGQLNACYNCVDRHALKT-PNKKAIIFEGDEPGQGYSITYKELLEEVCQVAQVLTYSMGVRKGDTVAVYMPMVPEAIITLLAISRIGAIHSVVFAGFSSNSLRDRINDGDSKVVITTDESNRGGKVIETKRIVDDALRETPGV-RHVLVYRKTNNPSVAFHAPRDLDWATEKKKYKTYYPCTPVDSEDPLFLLYTSGSTGAPKGVQHSTAGYLLGALLTMRYTFDTHQEDVFFTAGDIGWITGHTYVVYGPLLYGCATLVFEGTPAYPNYSRYWDIIDEHKVTQFYVAPTALRLLKRAGDSYIENHSLKSLRCLGSVGEPIAAEVWEWYSEKIGKNEIPIVDTYWQTESGSHLVTPLAGGVTPMKPGSASFPFFGIDAVVLDPNTGEELNTSHAEGVLAVKAAWPSFARTIWKNHDRYLDTYLNPYPGYYFTGDGAAKDKDGYIWILGRVDDVVNVSGHRLSTAEIEAAIIEDPIVAECAVVGFNDDLTGQAVAAFVVLKNKSSWSTATDDELQDIKKHLVFTVRKDIGPFAAPKLIILVDDLPKTRSGKIMRRILRKILAGESDQLGDVSTLSNPGIVRHLID 709          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Match: ACS2 (Acetyl-coA synthetase isoform; along with Acs1p, acetyl-coA synthetase isoform is the nuclear source of acetyl-coA for histone acetylation; mutants affect global transcription; required for growth on glucose; expressed under anaerobic conditions [Source:SGD;Acc:S000004143])

HSP 1 Score: 285.804 bits (730), Expect = 3.190e-87
Identity = 194/647 (29.98%), Postives = 326/647 (50.39%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVI-WDQQYTDVLIEK-ESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVP---LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE---GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIG--GELTDDTLRNWISSKF---HCPVYDIWGQTELHSIGVGPNLG-LKRKDYSQSVPVLGMNFKIIDSKTGETLR-NETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALI------VKNEDSRSSDEEI-----KIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMS--TMVNNPGAYQLIYDVLINHGF 1901
            Y ++Y+ SI +PEK + ++A+E + WD  YT V      +    WF+ GK+N SYNC+DRH      +K A+++E+ +      IT+ ELL +V  +AGV+     ++ GD V +Y P+IP+ +I +LA  RIGA +S V+ GFS+G++  ++      +++TC+       T N K+ +D+  +         +++ R GT    +   RD  W    + A+   ++P    D+  P+ ++YTSGSTG PKG+V  TG  +       +Y   +  ++V +  GD  W+TG  +  +G L     SI++E    YP+      +++ HK   F+ +P  +R  ++ + E   + K+D      +G  GE     L  W   K    +C + D   QTE  S  + P  G +  K  S +VP  G+N  IID  TG  L  N+  G + +K+P  PS++ + +  H+RY+ TY   YPG Y T D   + ++G   I  RVDDV+ ++GHR+S+  +E     +EN+S   V+ + D L     VA +      ++N  +    E I     + E +  V+  +G F   + +++V  L  T+SGK +RR L  + + +  ++   T + NP     I   + N  F
Sbjct:   40 YQEMYQQSINEPEKFFDKMAKEYLHWDAPYTKVQSGSLNNGDVAWFLNGKLNASYNCVDRHAFAN-PDKPALIYEADDESDNKIITFGELLRKVSQIAGVL-KSWGVKKGDTVAIYLPMIPEAVIAMLAVARIGAIHSVVFAGFSAGSLKDRVVDANSKVVITCDEGKRGGKTINTKKIVDEG-LNGVDLVSRILVFQRTGTEGIPMKAGRDYWW--HEEAAKQRTYLPPVSCDAEDPLFLLYTSGSTGSPKGVVHTTGGYLLGAALTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLTLGTASIIFESTPAYPDYGRYWRIIQRHKATHFYVAPTALRLIKR-VGEAEIA-KYDTSSLRVLGSVGEPISPDLWEWYHEKVGNKNCVICDTMWQTESGSHLIAPLAGAVPTKPGSATVPFFGINACIIDPVTGVELEGNDVEGVLAVKSPW-PSMARSVWNHHDRYMDTYLKPYPGHYFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTSEIEASISNHENVSEAAVVGIPDELTGQTVVAYVSLKDGYLQNNATEGDAEHITPDNLRRELILQVRGEIGPFASPKTIILVRDLPRTRSGKIMRRVLRKVASNEAEQLGDLTTLANPEVVPAIISAVENQFF 678          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Match: PCS60 (Oxalyl-CoA synthetase; capable of catalyzing conversion of oxalate to oxalyl-CoA; catalyzes first step in pathway of oxalate degradation that functions to protect yeast from inhibitory effects of oxalate; peroxisomal protein that binds mRNA; localizes to both peroxisomal peripheral membrane and matrix, expression is highly inducible by oleic acid; similar to E. coli long chain acyl-CoA synthetase [Source:SGD;Acc:S000000426])

HSP 1 Score: 50.447 bits (119), Expect = 5.803e-7
Identity = 56/231 (24.24%), Postives = 98/231 (42.42%), Query Frame = 3
Query: 1152 ISSKFHCPVYDIWGQTELHSIGVGPNLGL-KRKDYSQSVPVLGMNFKIID--------SKTGE-TLRNE--TLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTD 1808
            +  +F+ PV + +  TE        NL   KRK  +   P  G+   I+D         K GE ++R E  TLG                Y ++ +  +  FT+   ++ T DQG     G + +  R+ ++I   G ++S   ++ I L +  I   V   + D +   +  A IV  +  + + EE+    V  ++ +L  F +  KV  V  L +T +GK  RR + +
Sbjct:  322 LEKEFNAPVLEAYAMTEASHQMTSNNLPPGKRKPGTVGQP-QGVTVVILDDNDNVLPPGKVGEVSIRGENVTLG----------------YANNPKANKENFTKRENYFRTGDQGYFDPEGFLVLTGRIKELINRGGEKISPIELDGIMLSHPKIDEAVAFGVPDDMYGQVVQAAIVLKKGEKMTYEEL----VNFLKKHLASFKIPTKVYFVDKLPKTATGKIQRRVIAE 531          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO49293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH51])

HSP 1 Score: 408.297 bits (1048), Expect = 2.175e-133
Identity = 212/631 (33.60%), Postives = 348/631 (55.15%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG----YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTE------LHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVLINHGF 1901
            YD+ +K S+  PE  W ++AQ + W + YT V+     P  KWF GG++N  +NCLDRH+  G G +IA++++SP S      +Y+ L   V   AG + +  N+  GD+V++Y P++PQ +I +LAC RIGA +S V+GGF++  +A +I+H EP +I+T +     +    YK  +D+AI  S  KP   ++Y R       ++  RD+ W+  M+ A  H  VP+ +  P+ I+YTSG+TG+PKG+V   G    +  + MK   G+   EV W   D  W+ G  ++ +  L N  T++L+EG     P+  A   ++  HK    F++P  +R  R    +     ++D  + +  F+ GE  D     W       PVYD W QTE       H++G+G  +  K +   ++VP  G N KI+     E  R E LG+I +K P+ P    T ++  ER+ +TYF +YPG+YD+ D G+   +G + I +R DDVI +AGHR+S+ S+EE  +K   +     + L+D +  ++P+  ++ ++      E++  E  + V+ ++G    F+  VIVP L +T+SGK +R  L  +++G+ YK++  ++NP     I DVLI+ G+
Sbjct:   57 YDEAFKQSVEDPEGFWDDVAQGIDWYKPYTKVVDNATPPFTKWFPGGELNTCFNCLDRHIENGIGGRIALIYDSPVSGKIEMYSYQNLQRLVAKFAGAL-NSLNVGKGDRVVIYMPMVPQAVIAMLACARIGAIHSVVFGGFAAAELARRIEHAEPRVIVTASCGIEPSRIVTYKPLVDEAIKISSFKPSTVVLYQR-DQCTGDIIPGRDITWDQVMERAEPHDCVPVLATDPLYILYTSGTTGDPKGIVRRNGGHAVALNWSMKNIYGVNPGEVWWAASDLGWVVGHSYIVYAPLFNGCTTVLFEGKPVGTPDAGAFFRVIEQHKVISMFTAPTAIRIIRTEDPKAELIRQYDLSHFRDMFLAGEHLDKDTMQWARRAISAPVYDNWWQTESGWAITAHTVGLGRPMDEKLETTGKAVP--GYNVKILREDMTEADRGE-LGQICVKLPMPPGTMGTLWRADERFKKTYFEKYPGYYDSSDAGVMDEDGYVSIMARTDDVINVAGHRISTKSLEEGMMKPSFVVDAACIGLKDGIKGHVPLGFVIVDKTVSMKKEDMIKEVKKSVREFVGPVAAFKTAVIVPALPKTRSGKTVRGILAKIVHGEPYKVTPTMDNPQCLDQIKDVLISEGY 682          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO39135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAZ3])

HSP 1 Score: 263.077 bits (671), Expect = 4.844e-79
Identity = 164/565 (29.03%), Postives = 282/565 (49.91%), Query Frame = 3
Query:  168 KWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCN-IRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQM-QGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFD--NLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPV---LGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGK 1823
            +WFVGG+IN+S NC+D H +  + N+ A++ E         ++Y +L   V  +A ++  KC+ ++ GD V LY PV P  +  +LAC RIGA +S V+ GFS+ A+A++I+  +   ++T N A       + K  +D A+ +S    +  ++      VP   +G  D+  E  M +        P+DS  P+ ++YTSGSTG+PKG+V      +   K   KY    K  +V   + D  W+TG  ++ +G L N  T++L+E    YP+     EM+   +   F+ +P  +R   K+    ++ EK+D  +LK     GE  ++   +W   +  +  C V D W QTE   I + P             P+    G++  ++D K  E   N   G +  ++ + P +  T Y  HER++ TY+  YPG+Y T D  ++  +G  RI  R+DDV+ ++G R+ +  VE+    +  ++   V+     +      A     +D++   E+ + E  +LV+  +G F + + + +VP L +T+SGK +RR L  +   K
Sbjct:   11 RWFVGGEINVSENCVDHH-MRSHPNRTALIWEKDEPGDVEHVSYIQLYGMVNRMANML--KCHGVKKGDIVCLYMPVSPLAVAAMLACARIGAPHSVVFAGFSADALASRINDAQAETVITANQAVRGGRAIDLKRVVDDAVSKSPGVKRVFVMKRTGAQVP---MGKLDIPLEEAMAEQPDECPPEPMDSEDPLFLLYTSGSTGQPKGIVHTQAGYLLYAKLTHKYCFDYKQGDVFGCVADIGWITGHSYVVYGPLANGATTVLFESTPTYPDPGRYWEMVERLRINQFYGAPTAIRLLLKSGN--SWVEKYDRSSLKVLGTVGEPINEEAWHWYNDVVGEKRCTVVDTWWQTETGGILISPRPAPDNSPVKPEFPMRPFFGVDPVLVDEKGKELTGNNVTGALCFRSSV-PGMCRTIYGHHERFLNTYYRPYPGYYFTGDGALRDKDGHYRITGRMDDVVNVSGKRLGTAEVEDAMDNHSAVAETAVVGFPHPIKGEGIYAYATLKDDAQIEPEQFREEVKKLVRQKIGAFAVPEIIQVVPGLPKTRSGKIMRRILRKVAQDK 566          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO42084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2B4])

HSP 1 Score: 253.832 bits (647), Expect = 7.845e-75
Identity = 181/627 (28.87%), Postives = 298/627 (47.53%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYT-------DVLIEKESPTPKWFVGGKINMSYNCLDRHVLE-GYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP---QHCIIYNRPGT---VPA-----------------SLVGHRDLDW-EYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGPNLGLKR-KDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENIS--GVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSL 1802
            Y   YK SI  P   W E+A +  W            +  ++  S   KW  G K N+ YN LDR+V + G G+ +A   E      T +ITY ELL +V   A V+  K  ++ GD+V +Y P+I + +I +LAC R+GA +S V+GGFS+ ++A +I      +++T + +Y      N KE  D AI++ + +    + CI+    G    VP                  S     D  W E   + +  H  V +D+  P+ ++YTSGSTG+PKG++   G  +       +Y       EV W   D  W+TG  ++T+G + N   S+L+EG   YP+     +++  +K + F+++P  +R   K   E+  S   ++LK     GE  +     W   +     C + D + QTE     + P  G  R +  + + P  G+   I+D K G  L     G +VIK P  P ++ T Y +H+R+   YF ++ G+Y T D   +  NG   +  R DD + ++GH +S+  +E   ++++ +S   VV  P ++        A +++N +    DE++  E  Q V+  +G F     +   P L +T+SGK +RR L
Sbjct:   33 YKARYKQSIEDPAGFWGEVASDFFWKVPPKSDHFLKYNFDLDNGSVDIKWMQGAKTNICYNVLDRNVHDKGLGDTVAFYWEGNVPGDTKQITYGELLKQVCKFANVLESK-GVKKGDRVAIYMPMIMELVIAMLACARLGAVHSIVFGGFSAESLAERILDSTCKILITADASYRGLKMINLKEIADHAIIKCRERSFNVEACIVVRHLGPDKRVPTDPSSSPPPKRPCHQLQTSFDSSIDCWWHEVMAEASDEHDTVWVDAEDPLFMLYTSGSTGKPKGVLHTHGGYMLYTALTFRYSFDYHPGEVYWCTADIGWITGHSYITYGPMANGAISVLFEGTPFYPDCGRFWDIVDKYKVSKFYTAPTAIRSLMKFGKEIVTSHNLESLKVLGTVGEPINPEAWLWYYHVVGHNKCAIVDTYWQTETGGHVITPLPGATRTRPGAATFPFFGVEPAIVDEK-GNELEGPCEGFLVIKRPW-PGMARTIYGNHKRFENVYFDKFRGYYTTGDGCKRDENGYYWVTGRTDDCMNVSGHLLSTAQIESALVEHDAVSEAAVVSCPHKEKGEGIYCFATLMENVE---LDEKLIRELKQKVRLKIGPFASPDVIQSAPALPKTRSGKIMRRVL 653          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO37374 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG02])

HSP 1 Score: 80.4925 bits (197), Expect = 9.226e-16
Identity = 68/302 (22.52%), Postives = 132/302 (43.71%), Query Frame = 3
Query:  111 VIWDQQYTDVL--IEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGH-------RDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEV-------GWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGY 968
            +I  Q Y +V+   ++    P+WF G ++N + N     +L+G    IA+     N  +   +T+++L ++V +LA  +  K  I+ GD+V+ Y P     +  +LA + IGA +S+    F    +  +   I+P ++ + N    N    ++   +D  +++   + +  +I    GT     +          DL      +     + +P   NHP+ I+Y+SG+TG PK MV + G  +       K    +   ++       GW +  + WL   L +   ++L  G+  +   Y
Sbjct:   60 IIHSQTYDEVIDTTKRIDEIPEWFHGARMNYAEN-----LLQGKDEDIALYTAGENQEVRT-VTFQQLREKVAVLASAL-GKLGIKMGDRVVGYIPNCALAVEAMLAASSIGAIWSSTSPDFGVSGVLDRFSQIQPKVMFSVNAVRYNGKIHDHMAKLD-GVVQGLPELEKVVIIPFVGTEEKIEISQIKNSIFLSDLLKLADDRPELEFKQLPF--NHPLFIMYSSGTTGPPKCMVHSAGGTLLQHLKEHKLHGNMGKTDIIMYYTTTGWMM--WNWLVSALAVGAALVLYDGSPFIPSPY 349          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO44212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW67])

HSP 1 Score: 74.7146 bits (182), Expect = 2.978e-14
Identity = 94/428 (21.96%), Postives = 171/428 (39.95%), Query Frame = 3
Query:  378 LLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCN-VAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGYP--EDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGE-LTDDTLRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITP-SLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIV 1646
            ++  P  P+  +  LAC+RIG+          S  I  ++      L+   N +  + AT E   E  +K    S +     + ++R G +P   +           Q +  H   P  S+   +I +TSG+TG PK       +         KY + L  D+V W + D  W        +G  +   +  ++      E   IL+ ++ +  +     P     +R  + E     +F  L+     GE L  + + +W   K    + + +GQTE  ++  G    ++ +  S   P  G + ++ID K  ET         V   P  P  L   + +D+ER +  Y   Y   Y T D+ ++  +G +    R DDVI  AG+R+  + VE   +++  ++   V+   D +   +  A ++
Sbjct:    1 MVILPRYPEWWLLNLACSRIGSVIIPGSTQLRSKDILARL------LVSRANTIVADPATAEVVDEVYNKINFLSFNL---IVSFHRKGWLPFKTL---------YKQASTVHTCAPTTSDETSIIFFTSGTTGLPKMTQHTHASQGIGHSITGKYWLDLCPDDVHWTVSDPGWAKTAYGCLYGPWIQGASVFIHHTTEKFEAKVILDHLQKYPISTMCLPPT---AYRMMIHEDLSRYQFPALRHCLSAGEPLNPEVMVDW-KEKTGLDIREGYGQTET-TLLCGTFRCIETRPGSMGKPAPGYDVRVIDEKCNETPAGIEGDIAVYLKPRRPVGLFSEYIEDYERNVSAYRGDY---YLTGDRAVRDEDGYLWFIGRSDDVIISAGYRIGPFEVESALIEHPAVAEAAVVSSPDPVRGEVVKAFVI 402          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 421.394 bits (1082), Expect = 3.890e-138
Identity = 222/622 (35.69%), Postives = 350/622 (56.27%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKF--DNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLI 1874
            Y   +  +  QP+  W E   ++ W + +T  L  ++   P WFVGG++NM YN +DRHV  G G + AI+H+SP +     ITY EL  +V  LAGV+V K  +R GD V++Y P++P+ MI +LAC RIGA +S ++GGF+S  ++ +IDH +P L++T +          Y   + KA+  S H+P   +IYNRP      L     LDW+ +M  AR H  V L SNHP+ ++YTSG+TG PKG+V  T       K+ M    GLK  ++ W   D  W+ G  ++ +  LL+  ++ILYE    G P+  A   ++  H  +  F++P  +R  R+        +K+  + L+S F+ GE  D     W    F  PV D W QTE  S      +G+G +L        + VP  G N  +ID +  E ++  TLG IV++ P+ P  +++ +++   + + YF+++PG+YDTMD G    +G + I SR DDVI +AGHR+S+ ++EE  L +  +    V+ LED L  ++P+AL V   + R ++E+++ E V+LV+  +G    F+ V+ V  L +T+SGK  R SL+++INGK YK++  + +P  ++ I
Sbjct:   55 YSRAFSAAREQPDVFWGEKGLDIDWFEPWTKTLHVEDPVFPNWFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQAQVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPKGVVRDTAGYAVMLKWTMSNIYGLKPGDIWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQQDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPAGQAGKPVP--GYNVTVIDDQMQE-VKPRTLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEESVLLHSAVGDCAVVGLEDSLKGHIPLALCVLKNEVRDTEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVFKDI 672          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 403.29 bits (1035), Expect = 7.611e-131
Identity = 213/582 (36.60%), Postives = 333/582 (57.22%), Query Frame = 3
Query:  165 PKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKF--DNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLI 1874
            P+ FVGG++NM YN +DRHV  G G + AI+H+SP +     ITY EL  +V  LAGV+V K  +R GD V++Y P++P+ MI +LAC RIGA +S ++GGF+S  ++ +IDH +P L++T +          Y   + KA+  S H+P   +IYNRP      L     LDW+ +M  AR H  V L SNHP+ ++YTSG+TG PKG+V  T       K+ M    GLK  ++ W   D  W+ G  ++ +  LL+  ++ILYE    G P+  A   ++  H  +  F++P  +R  R+        +K+  + L+S F+ GE  D     W    F  PV D W QTE  S      +G+G +L        + VP  G N  +ID +  E ++  TLG IV++ P+ P  +++ +++   + + YF+++PG+YDTMD G    +G + I SR DDVI +AGHR+S+ ++EE  L +  +    V+ LED L  ++P+AL V   + R ++E+++ E V+LV+  +G    F+ V+ V  L +T+SGK  R SL+++INGK YK++  + +P  ++ I
Sbjct:  120 PQRFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQAQVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPKGVVRDTAGYAVMLKWTMSNIYGLKPGDIWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQQDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPAGQAGKPVP--GYNVTVIDDQMQE-VKPRTLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEESVLLHSAVGDCAVVGLEDSLKGHIPLALCVLKNEVRDTEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVFKDI 697          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 386.726 bits (992), Expect = 3.124e-125
Identity = 213/622 (34.24%), Postives = 337/622 (54.18%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYE----GYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKF--DNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLI 1874
            Y   +  +  QP+  W E   ++ W + +T  L  ++   P WFVGG++NM YN +DRHV  G G + AI+H+SP +     ITY EL  +V  LAGV+V K  +R GD V++Y P++P+ MI +LAC RIGA +S ++GGF+S  ++ +IDH +P L++T +          Y   + KA+  S H+P   +IYNRP      L     LDW+ +M  AR H  V L SNHP+ ++YTSG+TG PKG+V  T       K+ M    GLK  ++ W   D  W+ G  ++ +  LL+  ++ILYE    G P+  A   ++  H  +  F++P  +R  R+        +K+  + L+S F+ GE  D     W    F  PV D W QTE  S      +G+G +L        + VP     + +ID +  E ++  TLG IV++ P+ P  +++ +++   + + YF+++PG+YDTMD G    +G + I SR DDVI +AGHR+S+ ++EE+                     N   A+ V     R ++E+++ E V+LV+  +G    F+ V+ V  L +T+SGK  R SL+++INGK YK++  + +P  ++ I
Sbjct:   55 YSRAFSAAREQPDVFWGEKGLDIDWFEPWTKTLHVEDPVFPNWFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGEL--QVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPKGVVRDTAGYAVMLKWTMSNIYGLKPGDIWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQQDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPAGQAGKPVP----GYNVIDDQMQE-VKPRTLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEEV--------------------RNPAFAVCV-----RDTEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVFKDI 643          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 379.407 bits (973), Expect = 4.686e-122
Identity = 205/582 (35.22%), Postives = 322/582 (55.33%), Query Frame = 3
Query:  165 PKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG----YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKF--DNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHS------IGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLI 1874
            P+ FVGG++NM YN +DRHV  G G + AI+H+SP +     ITY EL  +V  LAGV+V K  +R GD V++Y P++P+ MI +LAC RIGA +S ++GGF+S  ++ +IDH +P L++T +          Y   + KA+  S H+P   +IYNRP      L     LDW+ +M  AR H  V L SNHP+ ++YTSG+TG PK                           + W   D  W+ G  ++ +  LL+  ++ILYEG     P+  A   ++  H  +  F++P  +R  R+        +K+  + L+S F+ GE  D     W    F  PV D W QTE  S      +G+G +L        + VP  G N  +ID +  E ++  TLG IV++ P+ P  +++ +++   + + YF+++PG+YDTMD G    +G + I SR DDVI +AGHR+S+ ++EE  L +  +    V+ LED L  ++P+AL V   + R ++E+++ E V+LV+  +G    F+ V+ V  L +T+SGK  R SL+++INGK YK++  + +P  ++ I
Sbjct:  120 PQRFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQAQVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPK---------------------------IWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQQDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPAGQAGKPVP--GYNVTVIDDQMQE-VKPRTLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEESVLLHSAVGDCAVVGLEDSLKGHIPLALCVLKNEVRDTEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVFKDI 670          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss2l (acetyl-coenzyme A synthetase, cytoplasmic [Source:NCBI gene;Acc:101172107])

HSP 1 Score: 253.832 bits (647), Expect = 1.706e-74
Identity = 189/642 (29.44%), Postives = 306/642 (47.66%), Query Frame = 3
Query:   45 YDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIE------KESPTPKWFVGGKINMSYNCLDRHVLE-GYGNKIAILHESPNSPIT-IKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKP----QHCIIYNR--PGTVPASLVGH--------RDLDWEYQMQGARHHRHVP-LDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEG---YPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNW---ISSKFHCPVYDIWGQTELHSIGVGP-NLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMI-NGKDYKMSTMVNNPGAYQLIY 1877
            Y ++Y+ S+  PE  W E+A E  W +  T  +++      K S   K   G K NM YN LDRHV E   G K+A  H   NSP   + ITY++LL  V   A V+  K  ++ GD+V +Y P+IP+ +  +LAC RIGA +S V+ GFSS ++  +I   +  +++T +  Y      N K+  D+A+ +   K       C++ N   P T   +L           RDL W+  M  +        LD+  P+ I+YTSGSTG+PKG++  T   +       KY      D+V W   D  W+TG  ++T+G L N  TS+L+EG   YP      E++  ++   F+++P  +R   K   E         L+     GE  +     W   +  +  CPV D + QTE     + P       K  S + P  G+   I++    E L  E  G +V + P  P +  T YK+HER+  TYF ++PGFY T D   +  +G   I  R+DD++ ++GH +S+  VE    ++  +S   V+     +     +   V  +D +  ++++  E  + V+  +G       +   P L +T+SGK +RR L  +  N  D+   + + +P   ++++
Sbjct:   29 YLEIYRKSLEDPEAFWKEVADEFFWKKPATGPMLQYNFDVTKGSVYIKCMEGAKTNMCYNVLDRHVKERNLGEKVA-FHWEGNSPEHHLTITYQQLLSRVCRCANVL-KKMGVKKGDRVSIYLPMIPELIYTMLACARIGAVHSIVFAGFSSESLCERIMDAQSSVLVTADGVYRGEKLINLKQISDEALEKCGEKAPCSVTKCLVVNHQAPRTNSGTLCNKLLTPWDTKRDLWWDEAMADSPEECEPEWLDAEDPLFILYTSGSTGKPKGVLHTTAGYLLYTSLTFKYVFDHHHDDVYWCTADVGWITGHSYITYGPLANGATSVLFEGVPVYPHVGRFWEIIEKYRVNKFYTAPTAIRMLMKYGQEPLQKYDLSTLRILGTVGEPINPEAWQWYYEVVGQGRCPVVDTFWQTETGGHVLTPLPAATPLKPGSATFPFFGVEPTILNEHG-EELEGEAEGYLVFRRPW-PGIMRTVYKNHERFESTYFRKFPGFYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLMSTAEVEAALAQHPAVSEAAVVGRPHKVKGEC-LHCFVTLKDCKEFNQKLVEELKKQVRDRIGPIATPDFIQNAPALPKTRSGKIMRRILRQIARNETDFGDLSTLADPKVVEVLF 665          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043646.1 (SMESG000043646.1)

HSP 1 Score: 1276.54 bits (3302), Expect = 0.000e+0
Identity = 619/634 (97.63%), Postives = 620/634 (97.79%), Query Frame = 3
Query:   30 MLNLDYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVLINHGFKATLPRDFKI 1931
            MLNLDYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAI+HESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNAT ENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVG RDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGYPEDSAILEMMR HKPAIFFSSPIRMRKFRKNL EVNFSEKFDNLKSFFIGGELTDD LRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYP         MQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVLINHGFKATLPRDFKI
Sbjct:    1 MLNLDYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAIIHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATIENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGLRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGYPEDSAILEMMRRHKPAIFFSSPIRMRKFRKNLAEVNFSEKFDNLKSFFIGGELTDDNLRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYP-------VRMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVLINHGFKATLPRDFKI 627          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043646.1 (SMESG000043646.1)

HSP 1 Score: 1161.36 bits (3003), Expect = 0.000e+0
Identity = 564/579 (97.41%), Postives = 565/579 (97.58%), Query Frame = 3
Query:  195 MSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVLINHGFKATLPRDFKI 1931
            MSYNCLDRHVLEGYGNKIAI+HESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNAT ENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVG RDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGYPEDSAILEMMR HKPAIFFSSPIRMRKFRKNL EVNFSEKFDNLKSFFIGGELTDD LRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYP         MQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVLINHGFKATLPRDFKI
Sbjct:    1 MSYNCLDRHVLEGYGNKIAIIHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATIENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGLRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGYPEDSAILEMMRRHKPAIFFSSPIRMRKFRKNLAEVNFSEKFDNLKSFFIGGELTDDNLRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYP-------VRMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVLINHGFKATLPRDFKI 572          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043641.1 (SMESG000043641.1)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 298/631 (47.23%), Postives = 422/631 (66.88%), Query Frame = 3
Query:   30 MLNLDYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVLINHGFKATLPRD 1922
            ML+L+Y++L+KLSI  PEKVW ELA+EV+W + YT V+ +K+ P PKWFVGG+INMSYNCLD+HVL+GYG+ +AI++E   +  T KITY++LL  VE LAGVMV+KC+I  GD+VLLYFPV  Q M  +LACTRIGA Y  ++ GF+   IA ++ H EP L++T N+AY   TT NYKE ++KA    +  P + ++YNRP T PA +V  +D DWE +++ A  H  VPL+SNHP+ I YTSG+TGEPKG V  TGN + +DKY +KY  GLK  E  W + DF W++GQ  MT+G LL   T IL+EG P                                 VN     +   + ++GGEL+D  LR WIS+ F CP+Y++WGQ+EL  +  GP LG KR +Y   +P+L ++ +I++S TGE L  ET+GR+++KTPI PS ++T YK+H+R++++YFT+YPG++DTMD GM MN+GS++I SR DDVI ++  R+   + EE+CL+N+++    V+PL+D     +P+A +   +D   ++ E+  +T+  V   +G F LF+  VIVP L + K+GK LR SL++M NG+ +K+   V+NP  Y+ IYDVLI  G+KATLP D
Sbjct:    1 MLSLNYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKP---------------------------------VNKPNSAERQLAIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGYKATLPID 598          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043645.1 (SMESG000043645.1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 294/635 (46.30%), Postives = 426/635 (67.09%), Query Frame = 3
Query:   30 MLNLDYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGYPEDS----AILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDYKMSTMVNNPGAYQLIYDVLINHGFKATLPRD 1922
            M +L++ DLY+LSI QPEKVW EL  EV+W + YT V+ +K+SP PKWF GG+INMSYNCLD+HVL+GYG+ +A+++E P    T K++YK+LL  VE LAGVMV+KC+++ GD+VLLY PV  Q +  ILACTRIGA Y   +GGF+   IA +I H EP LI+T N  Y    T NYKE +D+AI +S+  P +CI+YNRP T  A+++  RDLDWE ++  A  +  V L+S  PI IIYTSG+ GEPKG+V   G  + S+KY MKY +GL   +  W  GD+ W++GQ  MTFG LL   ++ILYEG    S     I +++  +    F ++P   R  +   +E +       L+   IGGEL++  L+ W+S+ F CPVYD+WGQTEL  I  GP LG K    +   P+L ++ K+++S TGE L NET+GR+++K P+ PS + + YKDH+R+++TYF++Y G+YDTMD GM  N+G+++I +R DDVI ++  R+   ++EE+CL NE+++    + LED +N  +P A + K +D   ++E + IE+V+LV+  +G F LF + V+V  L +TK+GK LR++L +M+NG+D+K    V NP  ++ IY +LI  G+KA+LP D
Sbjct:    1 MFDLNFADLYELSISQPEKVWDELGNEVVWSKPYTSVIKDKDSPIPKWFDGGEINMSYNCLDKHVLDGYGDDVAVIYECPVINATEKVSYKQLLTLVENLAGVMVNKCHLQKGDRVLLYVPVTVQGIAAILACTRIGAVYVVTFGGFAPDLIAARIKHTEPKLIITTNFGYEPERTVNYKEIVDEAINKSQFCPDYCIVYNRPNTKCATMIDSRDLDWETEIGKATPYAPVALESGDPIFIIYTSGTLGEPKGLVMTVGGFIVSNKYFMKYVLGLNRQDCWWMFGDYGWISGQTTMTFGPLLIGCSTILYEGKELSSHHLTGIGKIIDQNNVTGFSAAPTYFRFLKNKDSEKDIKPSKAQLRFVCIGGELSNTKLKEWVSNVFLCPVYDLWGQTELGIIATGPGLGFKNISSNGLSPMLSVHPKVVNSATGEHLPNETIGRMLLKIPLCPSAASSMYKDHDRFLKTYFSKYDGYYDTMDYGMIKNDGTLQILARADDVISVSAGRICGGALEEVCLMNEDLANAAFVALEDPINGQVPFAFLEKKKDRNINNEALIIESVKLVKKEIGSFTLFHQGVVVHDLPKTKTGKILRKTLYNMLNGQDWKTPATVENPKVFEEIYSILIEAGYKASLPND 635          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043650.1 (SMESG000043650.1)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 291/634 (45.90%), Postives = 415/634 (65.46%), Query Frame = 3
Query:   30 MLNLDYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFVGGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELLAGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSGAIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIYNRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGEPKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGVLLNRGTSILYEGYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNFSEKFDNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHSIGVGPNLGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSMTFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGHRVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEEIKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMIN-GKDYKMSTMVNNPGAYQLIYDVLINHGFKATLPRDFK 1928
            ML LDY+ LY+LSI  PEKVW EL +EV+WD+ Y  V+ +  SP   WFVGGKINMSYNCLD HV  G+G+ IA+++E+P+  I+ KI++KELL+ VELLAGVM +KC I   D+V+LYFPVIPQC+IG+LACTRIGA YS ++GG     IA +I+H+EP L++TCNV      T NYKE +D AI  S+ KP  C++YNRP T PA +    DLDWE +M+ +     V L+SN+P+ +IYTSG+TG+PKG+V ATGN V   KY+MKY   +   +  W + DF +LTGQLFM FG L+ R +++LYEG P+   + E M  HK   F+S+   MR+     ++  F  ++  L S   GG+ +D  L  WI+  F CP+Y  WGQTEL   G+   LG +R D   S+P+L +N  I+++ +GE L   + GR+++KTP+ PS ++T+YK+ ER+  TYF  YPGFYDTMD G++  NG+ ++ SR DDV+++   R+S  ++EE+CLK ++I+  +++P+E +     PVA + K      S+EEI+ + + LV +++G+F   + V IVP    T +GK  R SL  M N  + Y M   + NP  Y+ I+ +L   GF  TLP+D +
Sbjct:    1 MLKLDYEKLYELSIEHPEKVWDELGKEVVWDKPYESVIEDVTSPISNWFVGGKINMSYNCLDIHVKNGFGDDIAVIYENPSMDISEKISFKELLNSVELLAGVMANKCGIGKDDRVVLYFPVIPQCLIGMLACTRIGALYSVIFGGIPPQTIANRIEHLEPKLLITCNVGAERDQTRNYKERMDIAIEISEFKPDLCLVYNRPKTKPALMKEFVDLDWETEMETSIPVGPVSLESNYPMYVIYTSGTTGQPKGLVMATGNSVVICKYMMKYIKNIGPQKCWWMLSDFGYLTGQLFMAFGPLIQRNSTLLYEGTPDLHQLFEFMNKHKVVSFYSAITFMRQLHYESSDSIFQPEYGGLHSINAGGDKSDKKLEKWITKTFKCPIYIQWGQTELGGHGMSGCLGFQRNDDPHSIPLLSINPFIVNNDSGEILPLGSQGRLLLKTPLPPSAALTYYKNKERFFETYFKSYPGFYDTMDYGIKFKNGAFKVISRADDVMKINSMRISGGAIEEVCLKCQSITNAIIVPIECLNEGQNPVAFVTKRNGQELSNEEIRKDLISLVNNHIGEFARLRHVFIVPDFPRTINGKISRSSLAAMTNENRVYTMPPTIENPEIYREIFYILKEAGFDPTLPKDLQ 634          
The following BLAST results are available for this feature:
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSS36.699e-14135.25acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS31.715e-13735.09acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS15.058e-6726.20acyl-CoA synthetase short chain family member 1 [S... [more]
ACSS22.497e-6628.11acyl-CoA synthetase short chain family member 2 [S... [more]
ACSS23.475e-6427.25acyl-CoA synthetase short chain family member 2 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acs-197.575e-6427.07Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
acs-197.575e-6427.07Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
acs-198.378e-6427.07Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
acs-212.159e-1121.93Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-114.548e-1019.88Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG64322.021e-11830.94gene:FBgn0039184 transcript:FBtr0346110[more]
CG64322.021e-11830.94gene:FBgn0039184 transcript:FBtr0084606[more]
AcCoAS3.481e-7228.04gene:FBgn0012034 transcript:FBtr0333126[more]
AcCoAS3.481e-7228.04gene:FBgn0012034 transcript:FBtr0078413[more]
AcCoAS1.341e-5226.83gene:FBgn0012034 transcript:FBtr0078414[more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss35.414e-13935.42acyl-CoA synthetase short chain family member 3 [S... [more]
acss31.957e-12934.29acyl-CoA synthetase short chain family member 3 [S... [more]
acss19.820e-8028.74acyl-CoA synthetase short chain family member 1 [S... [more]
acss22.837e-6928.09acyl-CoA synthetase short chain family member 2 [S... [more]
acss21.127e-6827.54acyl-CoA synthetase short chain family member 2 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSS31.038e-14336.20acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS31.997e-14036.89acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS38.253e-14036.71acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS32.655e-13435.74acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS34.226e-13336.07acyl-CoA synthetase short chain family member 3 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acss32.484e-14035.41acyl-CoA synthetase short-chain family member 3 [S... [more]
Acss33.501e-9134.38acyl-CoA synthetase short-chain family member 3 [S... [more]
Acss14.889e-7027.80acyl-CoA synthetase short-chain family member 1 [S... [more]
Acss25.701e-6527.77acyl-CoA synthetase short-chain family member 2 [S... [more]
Acss28.809e-6427.23acyl-CoA synthetase short-chain family member 2 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0A0G2K047|ACSS3_RAT4.041e-14135.57Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|Q9H6R3|ACSS3_HUMAN3.217e-14035.25Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|Q5REB8|ACSS3_PONAB4.943e-14035.25Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|A7MB45|ACSS3_BOVIN1.559e-13936.20Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|Q14DH7|ACSS3_MOUSE1.738e-13935.41Acyl-CoA synthetase short-chain family member 3, m... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A402F3A31.857e-14537.10Uncharacterized protein OS=Paroedura picta OX=1436... [more]
A0A1L8GY842.876e-14236.04Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A2Y9F5811.570e-14136.52acyl-CoA synthetase short-chain family member 3, m... [more]
A0A2Y9M1R11.304e-14036.36acyl-CoA synthetase short-chain family member 3, m... [more]
A0A5G3KCT61.630e-14036.20Acyl-CoA synthetase short chain family member 3 OS... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036840.12.496e-7139.54pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000043882.19.370e-7138.89pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
acss27.440e-6727.81acyl-CoA synthetase short chain family member 2 [S... [more]
acss21.101e-6527.00acyl-CoA synthetase short chain family member 2 [S... [more]
acss2l2.158e-6427.46acetyl-coenzyme A synthetase, cytoplasmic-like [So... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000006895.12.447e-9935.07pep scaffold:Pmarinus_7.0:GL476378:330410:368976:-... [more]
acss25.602e-4327.18acyl-CoA synthetase short chain family member 2 [S... [more]
ENSPMAT00000005866.11.708e-935.71pep scaffold:Pmarinus_7.0:GL495638:310:2296:-1 gen... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ACS14.850e-9230.11Acetyl-coA synthetase isoform; along with Acs2p, a... [more]
ACS23.190e-8729.98Acetyl-coA synthetase isoform; along with Acs1p, a... [more]
PCS605.803e-724.24Oxalyl-CoA synthetase; capable of catalyzing conve... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492932.175e-13333.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391354.844e-7929.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420847.845e-7528.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373749.226e-1622.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442122.978e-1421.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss33.890e-13835.69acyl-CoA synthetase short chain family member 3 [S... [more]
acss37.611e-13136.60acyl-CoA synthetase short chain family member 3 [S... [more]
acss33.124e-12534.24acyl-CoA synthetase short chain family member 3 [S... [more]
acss34.686e-12235.22acyl-CoA synthetase short chain family member 3 [S... [more]
acss2l1.706e-7429.44acetyl-coenzyme A synthetase, cytoplasmic [Source:... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043646.10.000e+097.63SMESG000043646.1[more]
SMESG000043646.10.000e+097.41SMESG000043646.1[more]
SMESG000043641.10.000e+047.23SMESG000043641.1[more]
SMESG000043645.10.000e+046.30SMESG000043645.1[more]
SMESG000043650.10.000e+045.90SMESG000043650.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031147 ID=SMED30031147|Name=Acyl-CoA synthetase short chain family member 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2049bp
AAAGTGCAAAATAATTAAATAATAAAACTATGTTAAATTTGGATTATGAT
GATCTGTATAAATTGTCAATTTTACAACCGGAAAAAGTCTGGCATGAATT
GGCACAGGAAGTTATTTGGGATCAACAATATACAGACGTCCTTATAGAGA
AAGAATCTCCGACTCCTAAATGGTTTGTTGGCGGCAAAATTAACATGTCG
TATAACTGCCTCGATAGACATGTCTTAGAGGGGTATGGAAATAAAATAGC
AATCCTTCATGAAAGTCCGAATTCCCCTATTACTATCAAGATAACTTACA
AGGAGCTCCTTGACGAGGTTGAGTTACTTGCCGGAGTGATGGTAGACAAA
TGTAATATTCGGTCTGGAGATAAAGTACTACTATACTTTCCCGTAATCCC
ACAGTGTATGATTGGAATACTGGCTTGTACGAGAATCGGGGCTACTTACT
CTGCAGTTTACGGAGGGTTTTCTTCAGGTGCCATTGCTACAAAGATCGAC
CACATTGAGCCTTACTTAATTTTGACATGCAATGTTGCGTACAATAATGC
TACAACAGAGAATTATAAAGAAACTATCGACAAAGCAATTATGGAAAGTA
AACACAAACCACAACATTGTATAATATACAACCGACCAGGAACTGTCCCT
GCTTCTTTAGTTGGACATAGAGATTTAGATTGGGAATATCAAATGCAAGG
AGCTCGACATCATCGCCATGTTCCACTGGATTCAAATCATCCAATATTAA
TTATTTATACATCTGGTTCCACTGGAGAACCAAAAGGAATGGTTTGTGCA
ACCGGAAATATTGTTGCTTCTGATAAATATGTAATGAAGTATCAGATTGG
ACTGAAATCAGATGAGGTTGGTTGGTTTATTGGAGATTTTGCATGGTTGA
CTGGCCAACTCTTCATGACATTTGGAGTGCTTTTAAATAGAGGCACTTCC
ATTCTTTATGAAGGTTATCCAGAGGATTCTGCAATACTTGAAATGATGCG
GCTACACAAACCAGCAATTTTCTTCTCCTCTCCAATAAGAATGAGAAAAT
TTCGGAAGAATCTCACTGAAGTTAATTTTTCAGAGAAGTTTGATAATTTG
AAATCATTTTTCATCGGAGGAGAATTAACGGATGACACTCTTAGAAATTG
GATATCATCGAAGTTCCACTGTCCAGTGTACGATATATGGGGCCAAACCG
AACTACACTCTATTGGAGTTGGACCCAATCTTGGTCTGAAAAGAAAGGAT
TATAGTCAATCTGTTCCCGTTCTGGGAATGAATTTCAAAATTATTGACTC
GAAAACAGGAGAAACTTTACGTAATGAAACTCTGGGAAGAATTGTGATAA
AAACTCCAATTACACCTTCACTTTCCATGACTTTTTACAAAGACCACGAG
AGATACATTAGGACCTATTTCACTCGATACCCAGGATTTTACGATACAAT
GGATCAAGGAATGCAGATGAATAATGGAAGCATAAGGATTAACTCAAGAG
TTGACGATGTCATTCGTCTCGCTGGTCACAGAGTTTCCAGTTGGTCGGTC
GAAGAAATTTGTTTGAAAAACGAAAATATTTCAGGCGTAGTGGTACTGCC
TTTGGAAGACATTTTAAACACGAACTTACCAGTGGCATTAATAGTGAAGA
ATGAAGATTCAAGATCTAGTGACGAAGAAATAAAAATAGAAACTGTTCAA
CTTGTGCAACATTACCTGGGGAAATTCATTCTATTTCAAAAGGTGGTCAT
TGTTCCATGTCTACTGGAAACGAAATCGGGAAAATTTTTAAGACGTTCGT
TAACGGATATGATAAATGGCAAGGATTACAAGATGTCGACAATGGTTAAT
AATCCAGGAGCTTACCAACTTATTTACGATGTTCTCATAAATCATGGATT
CAAGGCAACTTTACCAAGAGACTTTAAAATATGAAAAATACTTAATTATG
TTAACATCTTTTAGGTAATGGAATAAAATTAAAACTCTCTACACTTCACT
ATGAAGTTGGTGGGGTGAGTTTAAAAACAAAACTCTAACGCGTAGATCG
back to top

protein sequence of SMED30031147-orf-1

>SMED30031147-orf-1 ID=SMED30031147-orf-1|Name=SMED30031147-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=635bp
MLNLDYDDLYKLSILQPEKVWHELAQEVIWDQQYTDVLIEKESPTPKWFV
GGKINMSYNCLDRHVLEGYGNKIAILHESPNSPITIKITYKELLDEVELL
AGVMVDKCNIRSGDKVLLYFPVIPQCMIGILACTRIGATYSAVYGGFSSG
AIATKIDHIEPYLILTCNVAYNNATTENYKETIDKAIMESKHKPQHCIIY
NRPGTVPASLVGHRDLDWEYQMQGARHHRHVPLDSNHPILIIYTSGSTGE
PKGMVCATGNIVASDKYVMKYQIGLKSDEVGWFIGDFAWLTGQLFMTFGV
LLNRGTSILYEGYPEDSAILEMMRLHKPAIFFSSPIRMRKFRKNLTEVNF
SEKFDNLKSFFIGGELTDDTLRNWISSKFHCPVYDIWGQTELHSIGVGPN
LGLKRKDYSQSVPVLGMNFKIIDSKTGETLRNETLGRIVIKTPITPSLSM
TFYKDHERYIRTYFTRYPGFYDTMDQGMQMNNGSIRINSRVDDVIRLAGH
RVSSWSVEEICLKNENISGVVVLPLEDILNTNLPVALIVKNEDSRSSDEE
IKIETVQLVQHYLGKFILFQKVVIVPCLLETKSGKFLRRSLTDMINGKDY
KMSTMVNNPGAYQLIYDVLINHGFKATLPRDFKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042099AMP-dep_Synthh-like_sf
IPR000873AMP-dep_Synth/Lig
IPR032387ACAS_N
IPR020845AMP-binding_CS
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0003987acetate-CoA ligase activity
GO:0016874ligase activity
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 66..497
e-value: 5.3E-60
score: 203.2
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 28..490
e-value: 8.5E-61
score: 207.9
NoneNo IPR availableGENE3DG3DSA:3.30.300.310coord: 493..599
e-value: 4.5E-11
score: 44.9
NoneNo IPR availablePANTHERPTHR43347FAMILY NOT NAMEDcoord: 4..615
NoneNo IPR availableCDDcd05967PrpEcoord: 6..609
e-value: 0.0
score: 538.825
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 5..599
IPR032387Acetyl-coenzyme A synthetase, N-terminal domainPFAMPF16177ACAS_Ncoord: 6..60
e-value: 1.1E-16
score: 60.5
IPR020845AMP-binding, conserved sitePROSITEPS00455AMP_BINDINGcoord: 241..252