Tubulin polyglutamylase ttll6

Overview
NameTubulin polyglutamylase ttll6
Smed IDSMED30031141
Length (bp)3362
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubulin polyglutamylase ttll6 (SMED30031141) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubulin polyglutamylase ttll6 (SMED30031141) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubulin polyglutamylase ttll6 (SMED30031141) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubulin polyglutamylase ttll6 (SMED30031141) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031141

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031141SMESG000075764.1 dd_Smed_v4_8131_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031141SMESG000075764.1 dd_Smed_v4_8131_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031141SMESG000075764.1 dd_Smed_v4_8131_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031141SMESG000075764.1 dd_Smed_v4_8131_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Human
Match: TTLL13P (tubulin tyrosine ligase like 13, pseudogene [Source:HGNC Symbol;Acc:HGNC:32484])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 296/538 (55.02%), Postives = 405/538 (75.28%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGS--ACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQ--KQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDS--ILKRKDRKDVRPESPEERPK-RKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALH 1978
             I L+NCKYESVRR ++  G +EV E+++W L WTD +V++ERV  MK++QKINH+PGM EICRKD LARN+NRM KL+  EYNI P++WCLPADY + Q+Y RQ+K +TYI KPD+GCQGRGI+IT+NP+EIKP E+M+CQ Y+SKP LIDGFKFD+R+YVL+TSCDPLR+F Y++GL RF TT Y EP+ NN+DN+ MHLTNY++ KH++NFV+D    G+KR+++TLN W  +  YN  ++W D++DIIIKT+ISAH++L+HNYRTCFP ++ G   ACFEILGFD++ D KLKP L+EVNHSPSF TDS LD+E+K+AL+ D + LVN    DK+++++E+KR+++ERLFQ  +Q R+  K++ +      ++ QE+YED HLG +RRIYPGP + KY +FF  N SL+QETAA KAR ECARQQ EEI+ KQE+ ++    ++K R   + ES  E+ + R  L S+S          R+R + ++      D  +PQEI ++EE+ER+  LLQR+ LIR+LGIVE + +  H
Sbjct:   89 AINLTNCKYESVRRAAQMCGLKEVGEDEEWTLYWTDCAVSLERVMDMKRFQKINHFPGMTEICRKDLLARNLNRMYKLYPSEYNIFPRTWCLPADYGDFQSYGRQRKARTYICKPDSGCQGRGIFITRNPREIKPGEHMICQQYISKPLLIDGFKFDMRVYVLITSCDPLRIFTYEEGLARFATTPYMEPSHNNLDNVCMHLTNYAINKHNENFVRDGAV-GSKRKLSTLNIWLQEHSYNPGELWGDIEDIIIKTIISAHSVLRHNYRTCFPQYLNGGTCACFEILGFDILLDHKLKPWLLEVNHSPSFTTDSCLDQEVKDALLCDAMTLVNLRGCDKRKVMEEDKRRVKERLFQCYRQPRESRKEKTESSHVAMLD-QERYEDSHLGKYRRIYPGPDTEKYARFFKHNGSLFQETAASKAREECARQQLEEIRLKQEQQETSGTKRQKARDQNQGESAGEKSRPRAGLQSLSTHLA-----YRNRNWEKELLPGQLDTMRPQEIVEEEELERMKALLQRETLIRSLGIVEQLTRLQH 619          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Human
Match: TTLL13P (tubulin tyrosine ligase like 13, pseudogene [Source:HGNC Symbol;Acc:HGNC:32484])

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 296/538 (55.02%), Postives = 405/538 (75.28%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGS--ACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQ--KQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDS--ILKRKDRKDVRPESPEERPK-RKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALH 1978
             I L+NCKYESVRR ++  G +EV E+++W L WTD +V++ERV  MK++QKINH+PGM EICRKD LARN+NRM KL+  EYNI P++WCLPADY + Q+Y RQ+K +TYI KPD+GCQGRGI+IT+NP+EIKP E+M+CQ Y+SKP LIDGFKFD+R+YVL+TSCDPLR+F Y++GL RF TT Y EP+ NN+DN+ MHLTNY++ KH++NFV+D    G+KR+++TLN W  +  YN  ++W D++DIIIKT+ISAH++L+HNYRTCFP ++ G   ACFEILGFD++ D KLKP L+EVNHSPSF TDS LD+E+K+AL+ D + LVN    DK+++++E+KR+++ERLFQ  +Q R+  K++ +      ++ QE+YED HLG +RRIYPGP + KY +FF  N SL+QETAA KAR ECARQQ EEI+ KQE+ ++    ++K R   + ES  E+ + R  L S+S          R+R + ++      D  +PQEI ++EE+ER+  LLQR+ LIR+LGIVE + +  H
Sbjct:   89 AINLTNCKYESVRRAAQMCGLKEVGEDEEWTLYWTDCAVSLERVMDMKRFQKINHFPGMTEICRKDLLARNLNRMYKLYPSEYNIFPRTWCLPADYGDFQSYGRQRKARTYICKPDSGCQGRGIFITRNPREIKPGEHMICQQYISKPLLIDGFKFDMRVYVLITSCDPLRIFTYEEGLARFATTPYMEPSHNNLDNVCMHLTNYAINKHNENFVRDGAV-GSKRKLSTLNIWLQEHSYNPGELWGDIEDIIIKTIISAHSVLRHNYRTCFPQYLNGGTCACFEILGFDILLDHKLKPWLLEVNHSPSFTTDSCLDQEVKDALLCDAMTLVNLRGCDKRKVMEEDKRRVKERLFQCYRQPRESRKEKTESSHVAMLD-QERYEDSHLGKYRRIYPGPDTEKYARFFKHNGSLFQETAASKAREECARQQLEEIRLKQEQQETSGTKRQKARDQNQGESAGEKSRPRAGLQSLSTHLA-----YRNRNWEKELLPGQLDTMRPQEIVEEEELERMKALLQRETLIRSLGIVEQLTRLQH 619          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Human
Match: TTLL13P (tubulin tyrosine ligase like 13, pseudogene [Source:HGNC Symbol;Acc:HGNC:32484])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 296/538 (55.02%), Postives = 405/538 (75.28%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGS--ACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQ--KQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDS--ILKRKDRKDVRPESPEERPK-RKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALH 1978
             I L+NCKYESVRR ++  G +EV E+++W L WTD +V++ERV  MK++QKINH+PGM EICRKD LARN+NRM KL+  EYNI P++WCLPADY + Q+Y RQ+K +TYI KPD+GCQGRGI+IT+NP+EIKP E+M+CQ Y+SKP LIDGFKFD+R+YVL+TSCDPLR+F Y++GL RF TT Y EP+ NN+DN+ MHLTNY++ KH++NFV+D    G+KR+++TLN W  +  YN  ++W D++DIIIKT+ISAH++L+HNYRTCFP ++ G   ACFEILGFD++ D KLKP L+EVNHSPSF TDS LD+E+K+AL+ D + LVN    DK+++++E+KR+++ERLFQ  +Q R+  K++ +      ++ QE+YED HLG +RRIYPGP + KY +FF  N SL+QETAA KAR ECARQQ EEI+ KQE+ ++    ++K R   + ES  E+ + R  L S+S          R+R + ++      D  +PQEI ++EE+ER+  LLQR+ LIR+LGIVE + +  H
Sbjct:   89 AINLTNCKYESVRRAAQMCGLKEVGEDEEWTLYWTDCAVSLERVMDMKRFQKINHFPGMTEICRKDLLARNLNRMYKLYPSEYNIFPRTWCLPADYGDFQSYGRQRKARTYICKPDSGCQGRGIFITRNPREIKPGEHMICQQYISKPLLIDGFKFDMRVYVLITSCDPLRIFTYEEGLARFATTPYMEPSHNNLDNVCMHLTNYAINKHNENFVRDGAV-GSKRKLSTLNIWLQEHSYNPGELWGDIEDIIIKTIISAHSVLRHNYRTCFPQYLNGGTCACFEILGFDILLDHKLKPWLLEVNHSPSFTTDSCLDQEVKDALLCDAMTLVNLRGCDKRKVMEEDKRRVKERLFQCYRQPRESRKEKTESSHVAMLD-QERYEDSHLGKYRRIYPGPDTEKYARFFKHNGSLFQETAASKAREECARQQLEEIRLKQEQQETSGTKRQKARDQNQGESAGEKSRPRAGLQSLSTHLA-----YRNRNWEKELLPGQLDTMRPQEIVEEEELERMKALLQRETLIRSLGIVEQLTRLQH 619          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Human
Match: TTLL6 (tubulin tyrosine ligase like 6 [Source:HGNC Symbol;Acc:HGNC:26664])

HSP 1 Score: 525.783 bits (1353), Expect = 3.308e-170
Identity = 244/426 (57.28%), Postives = 320/426 (75.12%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQ----EKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECA 1651
             I LS+C+YESVRR ++++GFRE  E+DDW L WTD+SV++ERV  MK YQKINH+PGM EICRKD LARNM+RMLK+F K++   P++WCLPAD+ +LQ Y+R +K+KTYI KPD+GCQG+GI+IT+  KEIKP E+M+CQ+Y+SKPF+IDGFKFDLRIYVLVTSCDPLR+F Y +GL RF TT YS P  +N+D+I MHLTNYS+ KHS NF + D   G+KR+++T + +  D  YN+E+IW D++D+IIKTLISAH +++HNY TCFPNH   SACFEILGFD++ D KLKP L+EVNHSPSF TDS+LDKE+K+ L++DTL L+N  +    +    E+ + R +  Q+   ++++ E   E   F  +Q    E YE  + G FR IYP   S KY+KFF  N SL+Q T A +AR E A
Sbjct:  110 VINLSSCRYESVRRAAQQYGFREGGEDDDWTLYWTDYSVSLERVMEMKSYQKINHFPGMSEICRKDLLARNMSRMLKMFPKDFRFFPRTWCLPADWGDLQTYSRSRKNKTYICKPDSGCQGKGIFITRTVKEIKPGEDMICQLYISKPFIIDGFKFDLRIYVLVTSCDPLRIFVYNEGLARFATTSYSRPCTDNLDDICMHLTNYSINKHSSNFSR-DAHSGSKRKLSTFSAYLEDHSYNVEQIWRDIEDVIIKTLISAHPIIRHNYHTCFPNHTLNSACFEILGFDILLDHKLKPWLLEVNHSPSFSTDSRLDKEVKDGLLYDTLVLINLESC--DKKKVLEEERQRGQFLQQCCSREMRIE---EAKGFRAVQLKKTETYEKENCGGFRLIYPSLNSEKYEKFFQDNNSLFQNTVASRAREEYA 529          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Human
Match: TTLL7 (tubulin tyrosine ligase like 7 [Source:HGNC Symbol;Acc:HGNC:26242])

HSP 1 Score: 337.035 bits (863), Expect = 4.689e-103
Identity = 175/446 (39.24%), Postives = 279/446 (62.56%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDW-NLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHK----TYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEG-GTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRG--SACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLF-----------------QKQNRKDIKDEVDKEMAKFME--IQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            T  ++  K+E VR V    GF +  +ED+  NLIW D +V  E+++ ++ YQ+INH+PGM EICRKD LARNM +M+K    +Y   P++W  PA+Y + Q Y ++ K K    T+I+KP  G  G GI + +N  ++   ++++ Q Y+ KPFL++G+KFDLRIY+LVTSCDPL++F Y DGLVR  T KY  PN +N+  +YMHLTNYS+ KH+++F +D+ E  G+KR I     +     +++ K W+D+ ++++KTLI A   + H YR C P    G  S CFE+LGFD++ DRKLKP L+E+N +PSF TD K+D ++K  ++ + L+L+N   +DK+R + ++K + + RL+                 Q+   +  K+E+ + +A+  +   +E++E+ H+GN+RRIYP    +  +K+ +     +Q   + +A S
Sbjct:   42 TANVAGTKFEIVRLVIDEMGFMKTPDEDETSNLIWCDSAVQQEKISELQNYQRINHFPGMGEICRKDFLARNMTKMIKSRPLDYTFVPRTWIFPAEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKLPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNEHFERDETENKGSKRSIKWFTEFLQANQHDVAKFWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVKRGVLLNALKLLNIRTSDKRRNLAKQKAEAQRRLYGQNSIKRLLPGSSDWEQQRHQLERRKEELKERLAQVRKQISREEHENRHMGNYRRIYPPEDKALLEKYENLLAVAFQTFLSGRAAS 487          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Celegans
Match: ttll-11 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:H2KZM9])

HSP 1 Score: 194.126 bits (492), Expect = 5.933e-52
Identity = 106/307 (34.53%), Postives = 170/307 (55.37%), Query Frame = 2
Query:  539 KINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQ-----KKHKTYILKPDAGCQGRGIWITKNPKEIK-PSENMVCQVYLSKPFLI-DGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQD----DEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTD------------------SKLDKEIKEALIWDTLQLV 1372
            ++N +PGM E+ +K SL  +++ M KLF  EY   P SW LPA  A+  A+ R+     K    +I+KPD G QG GI++  +P +I+   +  + Q Y++ P L+ D  KFD R+Y ++ S +PL ++  ++G+ RF T KY +P+ +N  N+Y HLTNYSL K ++ +V      D+  G+KR ++T+      +G   +++W D+  I++KT ++    +  +Y   F +   G  CF+I+GFDV+      P L+EVN +PS   D                  S +D+ IK  L+ DTL LV
Sbjct:   83 RVNKFPGMTELAKKISLTHSISSMQKLFPDEYAFYPNSWFLPAHLADFHAFYRKAQALGKTEMWFIVKPDEGAQGTGIYLINSPNQIRNVDQRQLVQEYVADPLLMNDKLKFDFRVYGVIKSINPLSIYVAREGMARFCTEKYEKPDSSNFKNLYAHLTNYSLNKANEAYVHSNTLQDQTRGSKRLLSTVFHQLESRGVKTKRLWHDIKLILVKTTLAMLPEIMLHYEHHFYDST-GPQCFQIMGFDVMIREDGTPILLEVNAAPSLTADHIVPHPGRTLLEGGQRVRSIVDEVIKIPLVRDTLLLV 388          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Celegans
Match: ttll-11 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:H2KZM9])

HSP 1 Score: 194.512 bits (493), Expect = 1.573e-51
Identity = 106/307 (34.53%), Postives = 170/307 (55.37%), Query Frame = 2
Query:  539 KINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQ-----KKHKTYILKPDAGCQGRGIWITKNPKEIK-PSENMVCQVYLSKPFLI-DGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQD----DEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTD------------------SKLDKEIKEALIWDTLQLV 1372
            ++N +PGM E+ +K SL  +++ M KLF  EY   P SW LPA  A+  A+ R+     K    +I+KPD G QG GI++  +P +I+   +  + Q Y++ P L+ D  KFD R+Y ++ S +PL ++  ++G+ RF T KY +P+ +N  N+Y HLTNYSL K ++ +V      D+  G+KR ++T+      +G   +++W D+  I++KT ++    +  +Y   F +   G  CF+I+GFDV+      P L+EVN +PS   D                  S +D+ IK  L+ DTL LV
Sbjct:  183 RVNKFPGMTELAKKISLTHSISSMQKLFPDEYAFYPNSWFLPAHLADFHAFYRKAQALGKTEMWFIVKPDEGAQGTGIYLINSPNQIRNVDQRQLVQEYVADPLLMNDKLKFDFRVYGVIKSINPLSIYVAREGMARFCTEKYEKPDSSNFKNLYAHLTNYSLNKANEAYVHSNTLQDQTRGSKRLLSTVFHQLESRGVKTKRLWHDIKLILVKTTLAMLPEIMLHYEHHFYDST-GPQCFQIMGFDVMIREDGTPILLEVNAAPSLTADHIVPHPGRTLLEGGQRVRSIVDEVIKIPLVRDTLLLV 488          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Celegans
Match: ttll-4 (Tubulin polyglutamylase ttll-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09647])

HSP 1 Score: 190.274 bits (482), Expect = 4.612e-51
Identity = 117/384 (30.47%), Postives = 193/384 (50.26%), Query Frame = 2
Query:  521 GMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRW--FHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDE------------VDKEMAKFMEIQE-----KYED--GHLGNFRRIYPGPGSSKYDKFFSTNVSL 1609
             ++ +QK+NH+PG   I RKD L  ++ +  + F  E++I P ++ LP D  EL  Y      +  I+KP A  +G GI +T+ PK+   +  +V Q Y+ +P  I+  KFDLR+Y  V + +PLRV+ Y  GLVRF +  YS  + + + N YMHLTNYS+ K ++    D        + T  + W  F + G + EKI  +++++IIK  IS    ++ +             C+E+ G D+I D   KP L+EVN SPS H+ + LD  +K  L  D L L           + +     R R  +K   + IK+             +D  + K +  ++     ++ED    +G+F+ ++P   +S Y K+F+  + +
Sbjct:  148 ALQPHQKVNHFPGAFHIGRKDRLWMHIRKQQERFEGEFDIMPFTYILPTDRQELLKYLETDASRHVIVKPPASARGTGISVTRKPKDFPTTATLVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSH-SVSTISNKYMHLTNYSINKLAE---ADGVANKPVPKWTLHHLWEHFDEMGVDREKIQREIEEVIIKAFISTEKPIREHMSRFLEQEF---ICYELFGIDIILDEDYKPWLLEVNISPSLHSGTPLDVSVKAPLAKDVLNLAGVYVPPSFDKLSDADYSTRPRNGRKNREQLIKEASWVAAYKDQLGVIDNRIFKRLTPEDTRALVEFEDELERIGDFKLVFPTAHTSHYQKYFAETIYM 524          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Celegans
Match: ttll-4 (Tubulin polyglutamylase ttll-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09647])

HSP 1 Score: 190.274 bits (482), Expect = 4.612e-51
Identity = 117/384 (30.47%), Postives = 193/384 (50.26%), Query Frame = 2
Query:  521 GMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRW--FHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDE------------VDKEMAKFMEIQE-----KYED--GHLGNFRRIYPGPGSSKYDKFFSTNVSL 1609
             ++ +QK+NH+PG   I RKD L  ++ +  + F  E++I P ++ LP D  EL  Y      +  I+KP A  +G GI +T+ PK+   +  +V Q Y+ +P  I+  KFDLR+Y  V + +PLRV+ Y  GLVRF +  YS  + + + N YMHLTNYS+ K ++    D        + T  + W  F + G + EKI  +++++IIK  IS    ++ +             C+E+ G D+I D   KP L+EVN SPS H+ + LD  +K  L  D L L           + +     R R  +K   + IK+             +D  + K +  ++     ++ED    +G+F+ ++P   +S Y K+F+  + +
Sbjct:  148 ALQPHQKVNHFPGAFHIGRKDRLWMHIRKQQERFEGEFDIMPFTYILPTDRQELLKYLETDASRHVIVKPPASARGTGISVTRKPKDFPTTATLVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSH-SVSTISNKYMHLTNYSINKLAE---ADGVANKPVPKWTLHHLWEHFDEMGVDREKIQREIEEVIIKAFISTEKPIREHMSRFLEQEF---ICYELFGIDIILDEDYKPWLLEVNISPSLHSGTPLDVSVKAPLAKDVLNLAGVYVPPSFDKLSDADYSTRPRNGRKNREQLIKEASWVAAYKDQLGVIDNRIFKRLTPEDTRALVEFEDELERIGDFKLVFPTAHTSHYQKYFAETIYM 524          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Celegans
Match: ttll-4 (Tubulin polyglutamylase ttll-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09647])

HSP 1 Score: 191.045 bits (484), Expect = 5.126e-51
Identity = 117/384 (30.47%), Postives = 193/384 (50.26%), Query Frame = 2
Query:  521 GMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRW--FHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDE------------VDKEMAKFMEIQE-----KYED--GHLGNFRRIYPGPGSSKYDKFFSTNVSL 1609
             ++ +QK+NH+PG   I RKD L  ++ +  + F  E++I P ++ LP D  EL  Y      +  I+KP A  +G GI +T+ PK+   +  +V Q Y+ +P  I+  KFDLR+Y  V + +PLRV+ Y  GLVRF +  YS  + + + N YMHLTNYS+ K ++    D        + T  + W  F + G + EKI  +++++IIK  IS    ++ +             C+E+ G D+I D   KP L+EVN SPS H+ + LD  +K  L  D L L           + +     R R  +K   + IK+             +D  + K +  ++     ++ED    +G+F+ ++P   +S Y K+F+  + +
Sbjct:  186 ALQPHQKVNHFPGAFHIGRKDRLWMHIRKQQERFEGEFDIMPFTYILPTDRQELLKYLETDASRHVIVKPPASARGTGISVTRKPKDFPTTATLVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSH-SVSTISNKYMHLTNYSINKLAE---ADGVANKPVPKWTLHHLWEHFDEMGVDREKIQREIEEVIIKAFISTEKPIREHMSRFLEQEF---ICYELFGIDIILDEDYKPWLLEVNISPSLHSGTPLDVSVKAPLAKDVLNLAGVYVPPSFDKLSDADYSTRPRNGRKNREQLIKEASWVAAYKDQLGVIDNRIFKRLTPEDTRALVEFEDELERIGDFKLVFPTAHTSHYQKYFAETIYM 562          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Fly
Match: TTLL6B (gene:FBgn0039501 transcript:FBtr0085180)

HSP 1 Score: 438.728 bits (1127), Expect = 1.939e-139
Identity = 240/569 (42.18%), Postives = 358/569 (62.92%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNF-VQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDI----------KDEVDKEM----AKFMEI------------QEKYEDGHLGNFRRIYPGPGSSK---YDKFF--STNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSK---PQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALHNTG 1987
            TIC+SN +Y  + ++SK  G++ V E   WN++W+D    +E    MK++Q+INH+PGM+EICRKD L+RN+NRMLK+F ++Y I PK+W LPADY +   YA   K +T+ILKPD+G QGRGIW+T + K I P E ++CQ Y+ +P LIDG+KFDLR+Y L+TS DPLR+F Y +GL RF T KY EP   N +++YMHLTNYS+ K + ++ + D+++ G+KR+++ +N W     Y++E+ W++VDD+IIKT++SA  +LKHNY  CFP H +  ACFEILGFD++ D KLKP ++EVNHSPSFHT+ ++D+E+K  LI DTL LV+   ADK++I+ E+++++++RL + +    +          K ++D +     A+ +++            Q  +E+ HLGNFR+I P P  SK   Y +F+  S  VS++ ETAA K R + AR+ R ++++K+ K   +L  K ++D R                     K+   L  R   EK+    F + +   P  I+D EE  R + L  R   IR L I E +Y  L+ TG
Sbjct:  147 TICVSNSRYAMIGKISKTLGYKLVKESKMWNILWSDSFPGVELFKNMKRFQQINHFPGMIEICRKDLLSRNLNRMLKIFPQDYKIFPKTWMLPADYGDAMNYALNHK-RTFILKPDSGAQGRGIWLTNDLKTIGPHERLICQTYIHRPLLIDGYKFDLRVYTLITSVDPLRIFVYNEGLARFATNKYVEPTPGNANDLYMHLTNYSVNKRNSHYELCDNDDCGSKRKLSAINNWMRRHNYDVEEFWSNVDDVIIKTVLSAWPVLKHNYHACFPGHDKIQACFEILGFDILVDWKLKPYILEVNHSPSFHTNEQVDREVKRPLIRDTLNLVSTVLADKRQILKEDRKRVKQRLLKIRGDPPVQRPRLGGGTSKPKIDAQKGSPDAQPVDVEPEAEDHGPLAQQIAWEESHLGNFRKIMPPPDLSKLDYYTRFYAQSHQVSIFAETAASKKREDLARKMRIQLEEKKAKQQQMLNGKAKRDAR---------------------KRHTVLLPRAVREKNRINFFRLRENWSPGFISDAEERLRHTWLHMRAEAIRTLKITENIYSNLYETG 693          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Fly
Match: TTLL6A (gene:FBgn0034459 transcript:FBtr0300829)

HSP 1 Score: 374.4 bits (960), Expect = 1.393e-113
Identity = 187/441 (42.40%), Postives = 279/441 (63.27%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSL-QKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEI----------------QEKYEDGHLGNFRRIYPGPGSSK---YDKFFSTN-VSLYQETAAFKARSE 1645
            ++C+ + +++ V +V++  GF+ V E   WN+ W+D + + + +  MK++Q+INH+PGM+EICRKD L+RN+NRMLK+F  +Y I PK+W +P D  ++  YA + K +T+ILKP +  QGRGIWIT + + +   E ++CQ Y+ +P LIDG+KFDLR+Y LVTS DPLR+F Y +GL RF T KY  P   N  N++MHLTNY L +++S   V +  E G+KR+++  N+W  D  Y++ + W  VDD IIKTLISA   LKHNY  CFP H +  A F++LGFD++ D KLKP ++EVNH+PS   D  +D E+K  LI DTL +++ A  DK++II +++ + R RL +    K    ++    +   E+                Q  +E+ HLGN+RRI P   SSK   Y KF+  N   ++ +T A + R +
Sbjct:  132 SVCVEHTRFQLVAKVTRNMGFQHVPEHRLWNIQWSDSTPHHDLLRNMKRFQQINHFPGMVEICRKDLLSRNLNRMLKMFPGDYRIFPKTWLMPTDAYDVAIYANKHK-RTFILKPYSAGQGRGIWITTDLRTVGKREKLICQTYIERPLLIDGYKFDLRVYTLVTSVDPLRIFVYNEGLARFATQKYVPPTTGNSHNVFMHLTNYCLNRRNSQYMVGNGPEAGSKRKLSAFNKWLVDHNYDVGEFWASVDDAIIKTLISAWPTLKHNYNVCFPKHDKIQASFQLLGFDILVDWKLKPYILEVNHTPSLSADESVDMEVKRPLIRDTLNMLSTALVDKEQIIRDDRTEHRARLLRNIYNKKAAAQMPGYSSPIREVGGHDVRQACSIGALTQQIAWEESHLGNYRRIMPPRDSSKVNYYCKFYEQNKQPMFADTVASRRREQ 571          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Fly
Match: TTLL5 (gene:FBgn0051108 transcript:FBtr0084802)

HSP 1 Score: 221.861 bits (564), Expect = 1.793e-59
Identity = 120/328 (36.59%), Postives = 190/328 (57.93%), Query Frame = 2
Query:  419 VRRVSKRFGFREV-NEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFG-KEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQD----DEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAA 1384
            +R++    G  EV  E +++NL+WT   + ++ V  +  YQ++NH+P   E+ RKD L +N+ RM  L G K ++I P+++ LP +  +L   A  K    +I+KP A  +GRGI+I  +P +I   E  V   Y+  P  IDG K DLR+YVLVTS DPL ++ Y++G+VR  T KY   + +N+ N  MHL NYS+ K+  ++++     DE+ G K  ++ L R    +  +  ++  +++D+IIK +++    +    R   PN   G+ CFE+ GFD++ D  LKP L+E+N SPS   DS LD ++K  L+ D L  V   A
Sbjct:  228 LRKLFNVHGLTEVQGENNNFNLLWTGVHMKLDIVRNLAPYQRVNHFPRSYEMTRKDRLYKNIERMQHLRGMKHFDIVPQTFVLPIESRDL-VVAHNKHRGPWIVKPAASSRGRGIFIVNSPDQIPQDEQAVVSKYIVDPLCIDGHKCDLRVYVLVTSFDPLIIYLYEEGIVRLATVKYDR-HADNLWNPCMHLCNYSINKYHSDYIRSSDAQDEDVGHKWTLSALLRHLKLQSCDTRQLMLNIEDLIIKAVLACAQSIISACRMFVPN---GNNCFELYGFDILIDNALKPWLLEINLSPSMGVDSPLDTKVKSCLMADLLTCVGIPA 550          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Fly
Match: TTLL5 (gene:FBgn0051108 transcript:FBtr0339247)

HSP 1 Score: 221.861 bits (564), Expect = 1.793e-59
Identity = 120/328 (36.59%), Postives = 190/328 (57.93%), Query Frame = 2
Query:  419 VRRVSKRFGFREV-NEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFG-KEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQD----DEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAA 1384
            +R++    G  EV  E +++NL+WT   + ++ V  +  YQ++NH+P   E+ RKD L +N+ RM  L G K ++I P+++ LP +  +L   A  K    +I+KP A  +GRGI+I  +P +I   E  V   Y+  P  IDG K DLR+YVLVTS DPL ++ Y++G+VR  T KY   + +N+ N  MHL NYS+ K+  ++++     DE+ G K  ++ L R    +  +  ++  +++D+IIK +++    +    R   PN   G+ CFE+ GFD++ D  LKP L+E+N SPS   DS LD ++K  L+ D L  V   A
Sbjct:  228 LRKLFNVHGLTEVQGENNNFNLLWTGVHMKLDIVRNLAPYQRVNHFPRSYEMTRKDRLYKNIERMQHLRGMKHFDIVPQTFVLPIESRDL-VVAHNKHRGPWIVKPAASSRGRGIFIVNSPDQIPQDEQAVVSKYIVDPLCIDGHKCDLRVYVLVTSFDPLIIYLYEEGIVRLATVKYDR-HADNLWNPCMHLCNYSINKYHSDYIRSSDAQDEDVGHKWTLSALLRHLKLQSCDTRQLMLNIEDLIIKAVLACAQSIISACRMFVPN---GNNCFELYGFDILIDNALKPWLLEINLSPSMGVDSPLDTKVKSCLMADLLTCVGIPA 550          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Fly
Match: TTLL4A (gene:FBgn0026147 transcript:FBtr0304950)

HSP 1 Score: 201.445 bits (511), Expect = 4.191e-53
Identity = 111/333 (33.33%), Postives = 187/333 (56.16%), Query Frame = 2
Query:  395 LSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNR-MLKLFGKEYNIAPKSWCLPADYAELQAYARQ--KKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEG---GTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISA----HTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTL 1363
            ++N   + VR +    G R + + +DW  +W    +       ++ YQKINH PG   I RKDS  +N+ R M K   KE+   P+++ +P D   L+ +  +  +++  +I+KP A  +G GI +     +I     ++ Q Y+ +P LI+G KFDLR+YVLVTS +PLRVF Y +GL RF + KYS    + +++  MHLTNYS+ K S N+ ++++     G K  I +L  +  ++G   + +W  +  ++++T+++     +++++ N  + +       +CFE+ GFDVI D  L P L+EVN SPS H++  LD  +K  L+   L
Sbjct:  328 ITNIMPKVVRLILANSGMRMLKKTNDWMGVWGKH-LKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSA-KTDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVESKY-------SCFELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVL 651          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Zebrafish
Match: ttll6 (tubulin tyrosine ligase-like family, member 6 [Source:NCBI gene;Acc:564075])

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 295/532 (55.45%), Postives = 398/532 (74.81%), Query Frame = 2
Query:  389 ICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALHNT 1984
            I L+NCKYESVRR ++R+G RE  E +DW L WTD SV+++RV  MK+YQKINH+PGM EICRKD LARNMNRMLKLF KEYNI P++WCLPADY++ QAY R KKHKT+I KPD+GCQGRGI++TK+ K+I+P E+M+CQVY+SKPF+IDGFKFDLRIYVLVTSCDP RVF Y +GLVRF TT Y+EP  +N++++ MHLTNY++ KHS+NFV+ DE+ G+KR++++  +   D  Y+ EK+WTD++D+IIKTLISAH +LKHNY+TCFPNH  GSACFEILGFDV+ DR+LKP L+EVNHSPSF TDS+LD+E+K++L++DTL L+N  A D+++I +EEKR+++ERL Q ++R+   +E+ +  A  ME  +KYE  H+G FRRI+P  G  KY+K+F  + SL+QETAA KAR ECARQQ +E++ KQE+ +   K   ++D++ ES  E+ K +        +   P  L      E++   L  + K       EE ER+  L QR+ L+  +G+V  V + L + 
Sbjct:   56 INLTNCKYESVRRAARRYGIREAAEGEDWTLYWTDCSVSLDRVMDMKRYQKINHFPGMNEICRKDLLARNMNRMLKLFPKEYNIFPRTWCLPADYSDFQAYTRAKKHKTFICKPDSGCQGRGIYLTKSNKDIRPGEHMICQVYMSKPFIIDGFKFDLRIYVLVTSCDPFRVFMYDEGLVRFCTTHYTEPTVSNLEDVCMHLTNYAINKHSENFVR-DEDTGSKRKLSSFKKHMEDMSYDTEKLWTDIEDVIIKTLISAHPILKHNYQTCFPNHASGSACFEILGFDVLLDRRLKPWLLEVNHSPSFTTDSRLDREVKDSLLYDTLVLINLGACDRRKITEEEKRRVKERLQQNRSREARNEELRQSQAASMEQMQKYEAKHMGGFRRIFPRDGGEKYEKYFQHSSSLFQETAASKAREECARQQLQELRLKQEQKERDKKGSRKQDLQGESAGEKVKPRKSQPPHKTSNSLPAMLELSSVREETPVSLERIEK-------EEAERVRELQQRETLLLNMGVVNQVRQLLQSA 579          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Zebrafish
Match: ttll6 (tubulin tyrosine ligase-like family, member 6 [Source:NCBI gene;Acc:564075])

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 295/532 (55.45%), Postives = 398/532 (74.81%), Query Frame = 2
Query:  389 ICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALHNT 1984
            I L+NCKYESVRR ++R+G RE  E +DW L WTD SV+++RV  MK+YQKINH+PGM EICRKD LARNMNRMLKLF KEYNI P++WCLPADY++ QAY R KKHKT+I KPD+GCQGRGI++TK+ K+I+P E+M+CQVY+SKPF+IDGFKFDLRIYVLVTSCDP RVF Y +GLVRF TT Y+EP  +N++++ MHLTNY++ KHS+NFV+ DE+ G+KR++++  +   D  Y+ EK+WTD++D+IIKTLISAH +LKHNY+TCFPNH  GSACFEILGFDV+ DR+LKP L+EVNHSPSF TDS+LD+E+K++L++DTL L+N  A D+++I +EEKR+++ERL Q ++R+   +E+ +  A  ME  +KYE  H+G FRRI+P  G  KY+K+F  + SL+QETAA KAR ECARQQ +E++ KQE+ +   K   ++D++ ES  E+ K +        +   P  L      E++   L  + K       EE ER+  L QR+ L+  +G+V  V + L + 
Sbjct:   56 INLTNCKYESVRRAARRYGIREAAEGEDWTLYWTDCSVSLDRVMDMKRYQKINHFPGMNEICRKDLLARNMNRMLKLFPKEYNIFPRTWCLPADYSDFQAYTRAKKHKTFICKPDSGCQGRGIYLTKSNKDIRPGEHMICQVYMSKPFIIDGFKFDLRIYVLVTSCDPFRVFMYDEGLVRFCTTHYTEPTVSNLEDVCMHLTNYAINKHSENFVR-DEDTGSKRKLSSFKKHMEDMSYDTEKLWTDIEDVIIKTLISAHPILKHNYQTCFPNHASGSACFEILGFDVLLDRRLKPWLLEVNHSPSFTTDSRLDREVKDSLLYDTLVLINLGACDRRKITEEEKRRVKERLQQNRSREARNEELRQSQAASMEQMQKYEAKHMGGFRRIFPRDGGEKYEKYFQHSSSLFQETAASKAREECARQQLQELRLKQEQKERDKKGSRKQDLQGESAGEKVKPRKSQPPHKTSNSLPAMLELSSVREETPVSLERIEK-------EEAERVRELQQRETLLLNMGVVNQVRQLLQSA 579          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Zebrafish
Match: ttll6 (tubulin tyrosine ligase-like family, member 6 [Source:NCBI gene;Acc:564075])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 283/515 (54.95%), Postives = 383/515 (74.37%), Query Frame = 2
Query:  440 FGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALHNT 1984
            +G RE  E +DW L WTD SV+++RV  MK+YQKINH+PGM EICRKD LARNMNRMLKLF KEYNI P++WCLPADY++ QAY R KKHKT+I KPD+GCQGRGI++TK+ K+I+P E+M+CQVY+SKPF+IDGFKFDLRIYVLVTSCDP RVF Y +GLVRF TT Y+EP  +N++++ MHLTNY++ KHS+NFV+ DE+ G+KR++++  +   D  Y+ EK+WTD++D+IIKTLISAH +LKHNY+TCFPNH  GSACFEILGFDV+ DR+LKP L+EVNHSPSF TDS+LD+E+K++L++DTL L+N  A D+++I +EEKR+++ERL Q ++R+   +E+ +  A  ME  +KYE  H+G FRRI+P  G  KY+K+F  + SL+QETAA KAR ECARQQ +E++ KQE+ +   K   ++D++ ES  E+ K +        +   P  L      E++   L  + K       EE ER+  L QR+ L+  +G+V  V + L + 
Sbjct:   67 YGIREAAEGEDWTLYWTDCSVSLDRVMDMKRYQKINHFPGMNEICRKDLLARNMNRMLKLFPKEYNIFPRTWCLPADYSDFQAYTRAKKHKTFICKPDSGCQGRGIYLTKSNKDIRPGEHMICQVYMSKPFIIDGFKFDLRIYVLVTSCDPFRVFMYDEGLVRFCTTHYTEPTVSNLEDVCMHLTNYAINKHSENFVR-DEDTGSKRKLSSFKKHMEDMSYDTEKLWTDIEDVIIKTLISAHPILKHNYQTCFPNHASGSACFEILGFDVLLDRRLKPWLLEVNHSPSFTTDSRLDREVKDSLLYDTLVLINLGACDRRKITEEEKRRVKERLQQNRSREARNEELRQSQAASMEQMQKYEAKHMGGFRRIFPRDGGEKYEKYFQHSSSLFQETAASKAREECARQQLQELRLKQEQKERDKKGSRKQDLQGESAGEKVKPRKSQPPHKTSNSLPAMLELSSVREETPVSLERIEK-------EEAERVRELQQRETLLLNMGVVNQVRQLLQSA 573          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Zebrafish
Match: ttll7 (tubulin tyrosine ligase-like family, member 7 [Source:ZFIN;Acc:ZDB-GENE-070112-2112])

HSP 1 Score: 327.405 bits (838), Expect = 3.235e-100
Identity = 183/439 (41.69%), Postives = 271/439 (61.73%), Query Frame = 2
Query:  407 KYESVRRVSKRFGFREVNEEDD-WNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYA----RQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDE-EGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSA--CFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLF-QKQNRKDIKDEVDKEMAKFMEI------------------QEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            KYE VR V +   F +  ++D+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM +M+K   +EY+  PK+W  PA+  + Q Y     R+ K KT+I+KP  G  G GI + +N +++   ++ + Q YL KPFL++G+KFDLR Y+LVTSCDPLRVF Y DGLVR  T KY  PN +N++ +YMHLTNYS+ KH++NF +D+  + G+KR I     +     Y++ K W DV ++++KTL+ A   + H YR C P    GSA  CFE+LGFD+I DRKLKP L+E+N +PSF TD K+D ++K+  + + L+L+N  A+DK+R + ++K + + RL+ Q   RK      + E  + +                    ++++E  HLGN+RRIYP       +K+ S   + +Q   A +A S
Sbjct:   51 KYEIVRIVIEELTFHKARDDDETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMAKMIKSQPQEYSFIPKTWIFPAECTQFQNYVKELKRKGKQKTFIVKPANGAMGHGISLIRNCEKLPVQDHFIVQEYLDKPFLMEGYKFDLRFYILVTSCDPLRVFLYNDGLVRMGTEKYHTPNESNLNQLYMHLTNYSVNKHNENFERDETVDKGSKRSIGWFTEFLRINDYDVAKFWGDVSELVVKTLLVAEPHVLHAYRMCRPGQPPGSASVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDYDVKKGALLNALKLLNIRASDKRRNLAQQKAEAQRRLYGQGSMRKLTAGSSEWEKQRHLLERRREELKERLAQVRKQVSRDEHEKRHLGNYRRIYPPDDKLLLEKYESLLSAAFQTFLAGRAAS 489          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Zebrafish
Match: ttll7 (tubulin tyrosine ligase-like family, member 7 [Source:ZFIN;Acc:ZDB-GENE-070112-2112])

HSP 1 Score: 328.946 bits (842), Expect = 2.257e-96
Identity = 183/439 (41.69%), Postives = 271/439 (61.73%), Query Frame = 2
Query:  407 KYESVRRVSKRFGFREVNEEDD-WNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYA----RQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDE-EGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSA--CFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLF-QKQNRKDIKDEVDKEMAKFMEI------------------QEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            KYE VR V +   F +  ++D+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM +M+K   +EY+  PK+W  PA+  + Q Y     R+ K KT+I+KP  G  G GI + +N +++   ++ + Q YL KPFL++G+KFDLR Y+LVTSCDPLRVF Y DGLVR  T KY  PN +N++ +YMHLTNYS+ KH++NF +D+  + G+KR I     +     Y++ K W DV ++++KTL+ A   + H YR C P    GSA  CFE+LGFD+I DRKLKP L+E+N +PSF TD K+D ++K+  + + L+L+N  A+DK+R + ++K + + RL+ Q   RK      + E  + +                    ++++E  HLGN+RRIYP       +K+ S   + +Q   A +A S
Sbjct:   51 KYEIVRIVIEELTFHKARDDDETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMAKMIKSQPQEYSFIPKTWIFPAECTQFQNYVKELKRKGKQKTFIVKPANGAMGHGISLIRNCEKLPVQDHFIVQEYLDKPFLMEGYKFDLRFYILVTSCDPLRVFLYNDGLVRMGTEKYHTPNESNLNQLYMHLTNYSVNKHNENFERDETVDKGSKRSIGWFTEFLRINDYDVAKFWGDVSELVVKTLLVAEPHVLHAYRMCRPGQPPGSASVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDYDVKKGALLNALKLLNIRASDKRRNLAQQKAEAQRRLYGQGSMRKLTAGSSEWEKQRHLLERRREELKERLAQVRKQVSRDEHEKRHLGNYRRIYPPDDKLLLEKYESLLSAAFQTFLAGRAAS 489          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Xenopus
Match: ENSXETT00000044160.1 (tubulin tyrosine ligase like 13, pseudogene [Source:NCBI gene;Acc:100492422])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 297/541 (54.90%), Postives = 401/541 (74.12%), Query Frame = 2
Query:  404 CKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQ-NRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSIL--KRKDRKDV-RPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEK--FLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALH-NTGGTMAYQ 2005
            C   SVRR ++R G +EV +E++W + WTD SV++ERV  MK++QKINH+PGM EICRKD LARNMNR+ KLF KEYNI P++WCLPADY +LQA+ R KK+ TYI KPD+GCQGRGI+++KN K+IK  +NM+CQ Y+ KPFL+DGFKFDLRIY LVTSC+PLR+F YK+GL RF T  Y EP+ +N+D++ MHLTNY++ KH++NF++DD   G+KR+++TLN W  +  Y+  ++W D+DD+IIKTLISAH +LKHNYRTCFPN+V GSACFEILGFD++ DRKLKP L+EVNHSPSF TDS LD+E+K+ LI DTL L+N  A DK+++I+E+KR+++ERLFQ+   R+  +++++   A  +   EKYED HLG +RRIYP      Y+KFF  + SL+QETAA KAR ECARQQ EE++ K+E+ ++ L  K+K+ KD+ + ES  E+       ++  K +K+P    +       EK    +D  KP +I++ EE ERL GL QR+ LI  LGIV+ V+KAL     GT+  Q
Sbjct:   19 CNCLSVRRAARRCGLKEVGDEEEWTVYWTDCSVSLERVMDMKRFQKINHFPGMNEICRKDLLARNMNRLSKLFPKEYNIFPRTWCLPADYGDLQAHCRTKKNSTYICKPDSGCQGRGIFLSKNLKDIKHGDNMICQQYIPKPFLVDGFKFDLRIYALVTSCEPLRIFVYKEGLARFATMNYVEPSHSNLDDVCMHLTNYAINKHNENFIRDD-LTGSKRKLSTLNTWLENNHYDTCRLWEDIDDVIIKTLISAHPILKHNYRTCFPNYVAGSACFEILGFDILLDRKLKPWLIEVNHSPSFTTDSILDREVKDPLIQDTLNLLNLRACDKRKVIEEDKRRVKERLFQRNVPRETRREQLETSQASRLAQMEKYEDSHLGGYRRIYPRDNGEVYEKFFKHSGSLFQETAASKAREECARQQLEELRIKKEQMEAPLGRKKKETKDILQGESAGEK-------ALKPKVMKRPVTRTTSACYRNVEKKEGKYDPMKPVDIDEKEERERLQGLQQREKLIYELGIVDQVHKALSLQDHGTLDLQ 551          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Xenopus
Match: trub2 (TruB pseudouridine (psi) synthase family member 2 [Source:Xenbase;Acc:XB-GENE-996199])

HSP 1 Score: 357.066 bits (915), Expect = 1.135e-108
Identity = 181/437 (41.42%), Postives = 279/437 (63.84%), Query Frame = 2
Query:  413 ESVRRVSKRFGFREVNEEDD-WNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQ----KKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEG-GTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNH--VRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDI-----------------KDEVDKEMAKFME--IQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            E VR V++   F +  ++D+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM +M+K    EYN  P++W  PA+Y + Q Y ++    ++ KT+I+KP  G  G GI +T+N ++++  ++++ Q YL KPFL++ +KFDLRIY+LVTSCDPLR+F Y DGLVR  T KY  P+ +N+  +YMHLTNYS+ KH++NF +D+ E  G+KR I     +     Y+I K W D+ D+++KTLI A   + H YR C P       S CFE+LGFD+I DRKLKP L+E+N +PSF TD K+D ++K+ ++ + L+L+N  A+DKK+ + ++K + ++RL+ + + K +                 K+E+ + +A+  +   +E+YE+ HLGN+RRIYP       +K+     + +Q   A +A S
Sbjct:   52 EIVRLVTEEMMFTKARDDDETANLIWNDCAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMTKMIKCQPHEYNFIPRTWIFPAEYTQFQTYIKELKKKRRQKTFIIKPANGAMGHGISLTRNGEKLQAQDHLIVQEYLEKPFLLESYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHPPSESNLSQLYMHLTNYSVNKHNENFERDETENRGSKRSIKWFTEFLRANDYDISKFWNDISDLVVKTLIVAEPHVLHAYRMCRPGQHPTSESVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDHDVKKGVLLNALKLLNIRASDKKKNLAKQKAEAQKRLYGQGSMKRLSPASSDWEKQRHTLERRKEELKERLAQVRKQISREEYENRHLGNYRRIYPPEDKLLLEKYEGLLATAFQTFLAGRAAS 488          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Xenopus
Match: trub2 (TruB pseudouridine (psi) synthase family member 2 [Source:Xenbase;Acc:XB-GENE-996199])

HSP 1 Score: 356.295 bits (913), Expect = 3.791e-107
Identity = 181/436 (41.51%), Postives = 279/436 (63.99%), Query Frame = 2
Query:  416 SVRRVSKRFGFREVNEEDD-WNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQ----KKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEG-GTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNH--VRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDI-----------------KDEVDKEMAKFME--IQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            SVR V++   F +  ++D+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM +M+K    EYN  P++W  PA+Y + Q Y ++    ++ KT+I+KP  G  G GI +T+N ++++  ++++ Q YL KPFL++ +KFDLRIY+LVTSCDPLR+F Y DGLVR  T KY  P+ +N+  +YMHLTNYS+ KH++NF +D+ E  G+KR I     +     Y+I K W D+ D+++KTLI A   + H YR C P       S CFE+LGFD+I DRKLKP L+E+N +PSF TD K+D ++K+ ++ + L+L+N  A+DKK+ + ++K + ++RL+ + + K +                 K+E+ + +A+  +   +E+YE+ HLGN+RRIYP       +K+     + +Q   A +A S
Sbjct:    4 SVRLVTEEMMFTKARDDDETANLIWNDCAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMTKMIKCQPHEYNFIPRTWIFPAEYTQFQTYIKELKKKRRQKTFIIKPANGAMGHGISLTRNGEKLQAQDHLIVQEYLEKPFLLESYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHPPSESNLSQLYMHLTNYSVNKHNENFERDETENRGSKRSIKWFTEFLRANDYDISKFWNDISDLVVKTLIVAEPHVLHAYRMCRPGQHPTSESVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDHDVKKGVLLNALKLLNIRASDKKKNLAKQKAEAQKRLYGQGSMKRLSPASSDWEKQRHTLERRKEELKERLAQVRKQISREEYENRHLGNYRRIYPPEDKLLLEKYEGLLATAFQTFLAGRAAS 439          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Xenopus
Match: trub2 (TruB pseudouridine (psi) synthase family member 2 [Source:Xenbase;Acc:XB-GENE-996199])

HSP 1 Score: 355.14 bits (910), Expect = 8.189e-106
Identity = 181/437 (41.42%), Postives = 278/437 (63.62%), Query Frame = 2
Query:  413 ESVRRVSKRFGFREVNEEDD-WNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQ----KKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEG-GTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNH--VRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLF-----------------QKQNRKDIKDEVDKEMAKFME--IQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            E VR V++   F +  ++D+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM +M+K    EYN  P++W  PA+Y + Q Y ++    ++ KT+I+KP  G  G GI +T+N ++++  ++++ Q YL KPFL++ +KFDLRIY+LVTSCDPLR+F Y DGLVR  T KY  P+ +N+  +YMHLTNYS+ KH++NF +D+ E  G+KR I     +     Y+I K W D+ D+++KTLI A   + H YR C P       S CFE+LGFD+I DRKLKP L+E+N +PSF TD K+D ++K+ ++ + L+L+N  A+DKK+ + ++K + ++RL+                 Q+   +  K+E+ + +A+  +   +E+YE+ HLGN+RRIYP       +K+     + +Q   A +A S
Sbjct:   52 EIVRLVTEEMMFTKARDDDETANLIWNDCAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMTKMIKCQPHEYNFIPRTWIFPAEYTQFQTYIKELKKKRRQKTFIIKPANGAMGHGISLTRNGEKLQAQDHLIVQEYLEKPFLLESYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHPPSESNLSQLYMHLTNYSVNKHNENFERDETENRGSKRSIKWFTEFLRANDYDISKFWNDISDLVVKTLIVAEPHVLHAYRMCRPGQHPTSESVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDHDVKKGVLLNALKLLNIRASDKKKNLAKQKAEAQKRLYGQGSMKRLSPASSDWEKQRHTLERRKEELKERLAQVRKQISREEYENRHLGNYRRIYPPEDKLLLEKYEGLLATAFQTFLAGRAAS 488          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Xenopus
Match: trub2 (TruB pseudouridine (psi) synthase family member 2 [Source:Xenbase;Acc:XB-GENE-996199])

HSP 1 Score: 353.214 bits (905), Expect = 1.990e-105
Identity = 179/435 (41.15%), Postives = 277/435 (63.68%), Query Frame = 2
Query:  419 VRRVSKRFGFREVNEEDD-WNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQ----KKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEG-GTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNH--VRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLF-----------------QKQNRKDIKDEVDKEMAKFME--IQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            +R V++   F +  ++D+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM +M+K    EYN  P++W  PA+Y + Q Y ++    ++ KT+I+KP  G  G GI +T+N ++++  ++++ Q YL KPFL++ +KFDLRIY+LVTSCDPLR+F Y DGLVR  T KY  P+ +N+  +YMHLTNYS+ KH++NF +D+ E  G+KR I     +     Y+I K W D+ D+++KTLI A   + H YR C P       S CFE+LGFD+I DRKLKP L+E+N +PSF TD K+D ++K+ ++ + L+L+N  A+DKK+ + ++K + ++RL+                 Q+   +  K+E+ + +A+  +   +E+YE+ HLGN+RRIYP       +K+     + +Q   A +A S
Sbjct:   12 IRLVTEEMMFTKARDDDETANLIWNDCAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMTKMIKCQPHEYNFIPRTWIFPAEYTQFQTYIKELKKKRRQKTFIIKPANGAMGHGISLTRNGEKLQAQDHLIVQEYLEKPFLLESYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHPPSESNLSQLYMHLTNYSVNKHNENFERDETENRGSKRSIKWFTEFLRANDYDISKFWNDISDLVVKTLIVAEPHVLHAYRMCRPGQHPTSESVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDHDVKKGVLLNALKLLNIRASDKKKNLAKQKAEAQKRLYGQGSMKRLSPASSDWEKQRHTLERRKEELKERLAQVRKQISREEYENRHLGNYRRIYPPEDKLLLEKYEGLLATAFQTFLAGRAAS 446          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Mouse
Match: Ttll13 (tubulin tyrosine ligase-like family, member 13 [Source:MGI Symbol;Acc:MGI:1920845])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 294/535 (54.95%), Postives = 405/535 (75.70%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGS--ACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLF--QKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALH 1978
             I L+NCKYESVRR ++  G +EV E+++W + WTD SV++ERV  MK++QKINH+PGM EICRKD LARN+NRM KL+  EYNI P++WCLPADY + QAY RQ+K +TYI KPD+GCQGRGI+IT+ PKEIKP E+M+CQ Y++KPFLIDGFKFD+RIYVL+TSCDPLR+F Y++GL RF T  Y EP+ NN++ + MHLTNY++ KH++NFV+DD   G+KR+++TLN W  +  ++ +++W D++DIIIKT+ISAH++L+HNYRTCFP ++ G   ACFEILGFD++ D KLKP L+EVNHSPSF TDS+LD+E+K+AL+ D + LVN    DKK++I+E+KR+++ERLF   +Q R+  +++ +   A  M  QE+YED HLG +RRIYPGP S KY  FF  N SL+QETAA KAR ECARQQ EEI+ KQE+ ++   +K RK+ + ++  E    K  +  + + L      R+R   ++      D ++PQ+I ++EE+ER+  LLQR+NLIR+LGIVE + + L+
Sbjct:   89 AINLTNCKYESVRRAAQMCGLKEVGEDEEWTVYWTDCSVSLERVMDMKRFQKINHFPGMTEICRKDLLARNLNRMQKLYPTEYNIFPRTWCLPADYGDFQAYGRQRKTRTYICKPDSGCQGRGIFITRTPKEIKPGEHMICQQYITKPFLIDGFKFDMRIYVLITSCDPLRIFMYEEGLARFATMPYVEPSHNNLEEVCMHLTNYAINKHNENFVRDD-AVGSKRKLSTLNAWLREHSHDPQELWGDIEDIIIKTIISAHSVLRHNYRTCFPQYLCGGTCACFEILGFDILLDHKLKPWLLEVNHSPSFTTDSRLDREVKDALLCDAMNLVNLRGCDKKKVIEEDKRRVKERLFPCHQQPRETRREQFELSQAA-MHDQERYEDSHLGGYRRIYPGPDSEKYAPFFKHNGSLFQETAASKAREECARQQLEEIRLKQEQQENPGTKK-RKENKEQNQGESAGEKSRSRTATRVLATSLAYRNRNREKELLPVQLDTTQPQDIVEEEELERMKLLLQRENLIRSLGIVEQLTRMLY 620          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Mouse
Match: Ttll13 (tubulin tyrosine ligase-like family, member 13 [Source:MGI Symbol;Acc:MGI:1920845])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 294/535 (54.95%), Postives = 405/535 (75.70%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGS--ACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLF--QKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALH 1978
             I L+NCKYESVRR ++  G +EV E+++W + WTD SV++ERV  MK++QKINH+PGM EICRKD LARN+NRM KL+  EYNI P++WCLPADY + QAY RQ+K +TYI KPD+GCQGRGI+IT+ PKEIKP E+M+CQ Y++KPFLIDGFKFD+RIYVL+TSCDPLR+F Y++GL RF T  Y EP+ NN++ + MHLTNY++ KH++NFV+DD   G+KR+++TLN W  +  ++ +++W D++DIIIKT+ISAH++L+HNYRTCFP ++ G   ACFEILGFD++ D KLKP L+EVNHSPSF TDS+LD+E+K+AL+ D + LVN    DKK++I+E+KR+++ERLF   +Q R+  +++ +   A  M  QE+YED HLG +RRIYPGP S KY  FF  N SL+QETAA KAR ECARQQ EEI+ KQE+ ++   +K RK+ + ++  E    K  +  + + L      R+R   ++      D ++PQ+I ++EE+ER+  LLQR+NLIR+LGIVE + + L+
Sbjct:   58 AINLTNCKYESVRRAAQMCGLKEVGEDEEWTVYWTDCSVSLERVMDMKRFQKINHFPGMTEICRKDLLARNLNRMQKLYPTEYNIFPRTWCLPADYGDFQAYGRQRKTRTYICKPDSGCQGRGIFITRTPKEIKPGEHMICQQYITKPFLIDGFKFDMRIYVLITSCDPLRIFMYEEGLARFATMPYVEPSHNNLEEVCMHLTNYAINKHNENFVRDDAV-GSKRKLSTLNAWLREHSHDPQELWGDIEDIIIKTIISAHSVLRHNYRTCFPQYLCGGTCACFEILGFDILLDHKLKPWLLEVNHSPSFTTDSRLDREVKDALLCDAMNLVNLRGCDKKKVIEEDKRRVKERLFPCHQQPRETRREQFELSQAA-MHDQERYEDSHLGGYRRIYPGPDSEKYAPFFKHNGSLFQETAASKAREECARQQLEEIRLKQEQQENPGTKK-RKENKEQNQGESAGEKSRSRTATRVLATSLAYRNRNREKELLPVQLDTTQPQDIVEEEELERMKLLLQRENLIRSLGIVEQLTRMLY 589          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Mouse
Match: Ttll6 (tubulin tyrosine ligase-like family, member 6 [Source:MGI Symbol;Acc:MGI:2683461])

HSP 1 Score: 537.339 bits (1383), Expect = 1.278e-175
Identity = 259/462 (56.06%), Postives = 345/462 (74.68%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPKRKVL 1771
             I LSNC+Y+SVRR ++++G RE  + DDW L WTD+SV++ERV  MK YQKINH+PGM EICRKD LARNM+RMLKLF K+++  P++WCLPAD+ +LQ Y+R +K+KTYI KPD+GCQGRGI+IT++ KEIKP E+M+CQ+Y+SKPF+IDGFKFDLR+YVLVTSCDPLRVF Y +GL RF TT YS PN +N+D I MHLTNYS+ KHS NFVQ D   G+KR+++T N +    GY++E+IW  ++D+IIKTLISAH ++KHNY TCFP+H   SACFEILGFD++ DRKLKP L+EVNHSPSF TDSKLDKE+K++L++D L L+N      K+ + EE+R+    L Q  NR+   +EV    A  ++  E+YE  + G FR IYPG    KYDKFF  N SL+Q T A +AR E   +Q  +  +++++    LK+  +++ + ES  E+ + KV+
Sbjct:   61 VINLSNCRYDSVRRAAQQYGLREAGDNDDWTLYWTDYSVSLERVMEMKSYQKINHFPGMSEICRKDLLARNMSRMLKLFPKDFHFFPRTWCLPADWGDLQTYSRTRKNKTYICKPDSGCQGRGIFITRSVKEIKPGEDMICQLYISKPFIIDGFKFDLRVYVLVTSCDPLRVFVYNEGLARFATTSYSHPNLDNLDEICMHLTNYSINKHSSNFVQ-DAFSGSKRKLSTFNSYMKTHGYDVEQIWRGIEDVIIKTLISAHPVIKHNYHTCFPSHTLNSACFEILGFDILLDRKLKPWLLEVNHSPSFSTDSKLDKEVKDSLLYDALVLINLGNC-DKKKVLEEERQRGRFLQQCPNREIRLEEVKGFQAMRLQKTEEYEKKNCGGFRLIYPGLNLEKYDKFFQDNSSLFQNTVASRAR-ELYARQLIQELRQKQEKKVFLKKARKEETQGESAGEQARDKVV 519          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Mouse
Match: Ttll6 (tubulin tyrosine ligase-like family, member 6 [Source:MGI Symbol;Acc:MGI:2683461])

HSP 1 Score: 478.404 bits (1230), Expect = 2.448e-154
Identity = 225/372 (60.48%), Postives = 286/372 (76.88%), Query Frame = 2
Query:  524 MKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKAR 1639
            MK YQKINH+PGM EICRKD LARNM+RMLKLF K+++  P++WCLPAD+ +LQ Y+R +K+KTYI KPD+GCQGRGI+IT++ KEIKP E+M+CQ+Y+SKPF+IDGFKFDLR+YVLVTSCDPLRVF Y +GL RF TT YS PN +N+D I MHLTNYS+ KHS NFVQ D   G+KR+++T N +    GY++E+IW  ++D+IIKTLISAH ++KHNY TCFP+H   SACFEILGFD++ DRKLKP L+EVNHSPSF TDSKLDKE+K++L++D L L+N      K+ + EE+R+    L Q  NR+   +EV    A  ++  E+YE  + G FR IYPG    KYDKFF  N SL+Q T A +AR
Sbjct:    3 MKSYQKINHFPGMSEICRKDLLARNMSRMLKLFPKDFHFFPRTWCLPADWGDLQTYSRTRKNKTYICKPDSGCQGRGIFITRSVKEIKPGEDMICQLYISKPFIIDGFKFDLRVYVLVTSCDPLRVFVYNEGLARFATTSYSHPNLDNLDEICMHLTNYSINKHSSNFVQ-DAFSGSKRKLSTFNSYMKTHGYDVEQIWRGIEDVIIKTLISAHPVIKHNYHTCFPSHTLNSACFEILGFDILLDRKLKPWLLEVNHSPSFSTDSKLDKEVKDSLLYDALVLINLGNC-DKKKVLEEERQRGRFLQQCPNREIRLEEVKGFQAMRLQKTEEYEKKNCGGFRLIYPGLNLEKYDKFFQDNSSLFQNTVASRAR 372          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Mouse
Match: Ttll7 (tubulin tyrosine ligase-like family, member 7 [Source:MGI Symbol;Acc:MGI:1918142])

HSP 1 Score: 334.724 bits (857), Expect = 1.018e-98
Identity = 171/448 (38.17%), Postives = 277/448 (61.83%), Query Frame = 2
Query:  380 LYTICLSNCKYESVRRVSKRFGFREVNEEDDW-NLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHK----TYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDD-EEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRG--SACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQK--------------QNRKDIKDEVDKEMAKFMEI-----QEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            + T  ++  K+E VR V    GF +  +ED+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM +M+K    +Y   P++W  P++Y + Q Y ++ K K    T+I+KP  G  G GI + +N  ++   ++++ Q Y+ KPFL++G+KFDLRIY+LVTSCDPL++F Y DGLVR  T KY  PN +N+  +YMHLTNYS+ KH++ F +++ E+ G+KR I     +     +++ K W+D+ ++++KTLI A   + H YR C P    G  S CFE+LGFD++ DRKLKP L+E+N +PSF TD K+D ++K  ++ + L+L+N   +DK++ + ++K + + RL+ +              Q R  ++   ++   + +++     QE++E+ H+GN+RRIYP    +  +K+       +Q   + +A S
Sbjct:   40 IITANVAGTKFEIVRLVIDEMGFMKTPDEDETSNLIWCDAAVQQEKITDLQNYQRINHFPGMGEICRKDFLARNMTKMIKSRPMDYTFVPRTWIFPSEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKVPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNERFERNETEDKGSKRSIKWFTEFLQANQHDVTKFWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVKRGVLLNALKLLNIRTSDKRKNLAKQKAEAQRRLYGQNPVRRLSPGSSDWEQQRHQLERRKEELKERLLQVRKQVSQEEHENRHMGNYRRIYPPEDKALLEKYEGLLAVAFQTFLSGRAAS 487          
BLAST of Tubulin polyglutamylase ttll6 vs. UniProt/SwissProt
Match: sp|A8CVX7|TTLL6_DANRE (Tubulin polyglutamylase ttll6 OS=Danio rerio OX=7955 GN=ttll6 PE=2 SV=1)

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 295/532 (55.45%), Postives = 397/532 (74.62%), Query Frame = 2
Query:  389 ICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALHNT 1984
            I L+NCKYESVRR ++R+G RE  E +DW L WTD SV+++RV  MK+YQKINH+PGM EICRKD LARNMNRMLKLF KEYNI P++WCLPADY++ QAY R KKHKT+I KPD+GCQGRGI++TK+ K+I+P E+M+CQVY+SKPF+IDGFKFDLRIYVLVTSCDP RVF Y +GLVRF TT Y+EP  +N++++ MHLTNY++ KHS+NFV+ DE+ G+KR++++  +   D  Y+ EK+WTD++D IIKTLISAH +LKHNY+TCFPNH  GSACFEILGFDV+ DR+LKP L+EVNHSPSF TDS+LD+E+K++L++DTL L+N  A D+++I +EEKR+++ERL Q ++R+   +E  +  A  ME+ +KYE  H+G FRRI+P  G  KY+K+F  + SL+QETAA KAR ECARQQ +E++ KQE+ +   K   ++D++ ES  E+ K +        +   P  L      E++   L  + K       EE ER+  L QR+ L+  +G+V  V + L + 
Sbjct:   56 INLTNCKYESVRRAARRYGIREAAEGEDWTLYWTDCSVSLDRVMDMKRYQKINHFPGMNEICRKDLLARNMNRMLKLFPKEYNIFPRTWCLPADYSDFQAYTRAKKHKTFICKPDSGCQGRGIYLTKSSKDIRPGEHMICQVYMSKPFIIDGFKFDLRIYVLVTSCDPFRVFMYDEGLVRFCTTHYTEPTVSNLEDVCMHLTNYAINKHSENFVR-DEDTGSKRKLSSFKKHMEDMSYDTEKLWTDIEDAIIKTLISAHPILKHNYQTCFPNHASGSACFEILGFDVLLDRRLKPWLLEVNHSPSFTTDSRLDREVKDSLLYDTLVLINLGACDRRKITEEEKRRVKERLQQNRSREARNEEPRQSQAASMELMQKYEAKHMGGFRRIFPRDGGEKYEKYFQHSSSLFQETAASKAREECARQQLQELRLKQEQKERDKKGSRKQDLQGESAGEKVKPRKSQPPHKTSNSLPAMLELSSVREETPVSLERIEK-------EEAERVRELQQRETLLLNMGVVNQVRQLLQSA 579          
BLAST of Tubulin polyglutamylase ttll6 vs. UniProt/SwissProt
Match: sp|A4Q9F6|TTL13_MOUSE (Tubulin polyglutamylase TTLL13 OS=Mus musculus OX=10090 GN=Ttll13 PE=2 SV=1)

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 294/535 (54.95%), Postives = 405/535 (75.70%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGS--ACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLF--QKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALH 1978
             I L+NCKYESVRR ++  G +EV E+++W + WTD SV++ERV  MK++QKINH+PGM EICRKD LARN+NRM KL+  EYNI P++WCLPADY + QAY RQ+K +TYI KPD+GCQGRGI+IT+ PKEIKP E+M+CQ Y++KPFLIDGFKFD+RIYVL+TSCDPLR+F Y++GL RF T  Y EP+ NN++ + MHLTNY++ KH++NFV+DD   G+KR+++TLN W  +  ++ +++W D++DIIIKT+ISAH++L+HNYRTCFP ++ G   ACFEILGFD++ D KLKP L+EVNHSPSF TDS+LD+E+K+AL+ D + LVN    DKK++I+E+KR+++ERLF   +Q R+  +++ +   A  M  QE+YED HLG +RRIYPGP S KY  FF  N SL+QETAA KAR ECARQQ EEI+ KQE+ ++   +K RK+ + ++  E    K  +  + + L      R+R   ++      D ++PQ+I ++EE+ER+  LLQR+NLIR+LGIVE + + L+
Sbjct:   89 AINLTNCKYESVRRAAQMCGLKEVGEDEEWTVYWTDCSVSLERVMDMKRFQKINHFPGMTEICRKDLLARNLNRMQKLYPTEYNIFPRTWCLPADYGDFQAYGRQRKTRTYICKPDSGCQGRGIFITRTPKEIKPGEHMICQQYITKPFLIDGFKFDMRIYVLITSCDPLRIFMYEEGLARFATMPYVEPSHNNLEEVCMHLTNYAINKHNENFVRDD-AVGSKRKLSTLNAWLREHSHDPQELWGDIEDIIIKTIISAHSVLRHNYRTCFPQYLCGGTCACFEILGFDILLDHKLKPWLLEVNHSPSFTTDSRLDREVKDALLCDAMNLVNLRGCDKKKVIEEDKRRVKERLFPCHQQPRETRREQFELSQAA-MHDQERYEDSHLGGYRRIYPGPDSEKYAPFFKHNGSLFQETAASKAREECARQQLEEIRLKQEQQENPGTKK-RKENKEQNQGESAGEKSRSRTATRVLATSLAYRNRNREKELLPVQLDTTQPQDIVEEEELERMKLLLQRENLIRSLGIVEQLTRMLY 620          
BLAST of Tubulin polyglutamylase ttll6 vs. UniProt/SwissProt
Match: sp|A6NNM8|TTL13_HUMAN (Tubulin polyglutamylase TTLL13P OS=Homo sapiens OX=9606 GN=TTLL13P PE=1 SV=2)

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 296/538 (55.02%), Postives = 405/538 (75.28%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGS--ACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQ--KQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDS--ILKRKDRKDVRPESPEERPK-RKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALH 1978
             I L+NCKYESVRR ++  G +EV E+++W L WTD +V++ERV  MK++QKINH+PGM EICRKD LARN+NRM KL+  EYNI P++WCLPADY + Q+Y RQ+K +TYI KPD+GCQGRGI+IT+NP+EIKP E+M+CQ Y+SKP LIDGFKFD+R+YVL+TSCDPLR+F Y++GL RF TT Y EP+ NN+DN+ MHLTNY++ KH++NFV+D    G+KR+++TLN W  +  YN  ++W D++DIIIKT+ISAH++L+HNYRTCFP ++ G   ACFEILGFD++ D KLKP L+EVNHSPSF TDS LD+E+K+AL+ D + LVN    DK+++++E+KR+++ERLFQ  +Q R+  K++ +      ++ QE+YED HLG +RRIYPGP + KY +FF  N SL+QETAA KAR ECARQQ EEI+ KQE+ ++    ++K R   + ES  E+ + R  L S+S          R+R + ++      D  +PQEI ++EE+ER+  LLQR+ LIR+LGIVE + +  H
Sbjct:   89 AINLTNCKYESVRRAAQMCGLKEVGEDEEWTLYWTDCAVSLERVMDMKRFQKINHFPGMTEICRKDLLARNLNRMYKLYPSEYNIFPRTWCLPADYGDFQSYGRQRKARTYICKPDSGCQGRGIFITRNPREIKPGEHMICQQYISKPLLIDGFKFDMRVYVLITSCDPLRIFTYEEGLARFATTPYMEPSHNNLDNVCMHLTNYAINKHNENFVRDGAV-GSKRKLSTLNIWLQEHSYNPGELWGDIEDIIIKTIISAHSVLRHNYRTCFPQYLNGGTCACFEILGFDILLDHKLKPWLLEVNHSPSFTTDSCLDQEVKDALLCDAMTLVNLRGCDKRKVMEEDKRRVKERLFQCYRQPRESRKEKTESSHVAMLD-QERYEDSHLGKYRRIYPGPDTEKYARFFKHNGSLFQETAASKAREECARQQLEEIRLKQEQQETSGTKRQKARDQNQGESAGEKSRPRAGLQSLSTHLA-----YRNRNWEKELLPGQLDTMRPQEIVEEEELERMKALLQRETLIRSLGIVEQLTRLQH 619          
BLAST of Tubulin polyglutamylase ttll6 vs. UniProt/SwissProt
Match: sp|A4Q9E8|TTLL6_MOUSE (Tubulin polyglutamylase TTLL6 OS=Mus musculus OX=10090 GN=Ttll6 PE=2 SV=1)

HSP 1 Score: 537.339 bits (1383), Expect = 8.942e-175
Identity = 259/462 (56.06%), Postives = 345/462 (74.68%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPKRKVL 1771
             I LSNC+Y+SVRR ++++G RE  + DDW L WTD+SV++ERV  MK YQKINH+PGM EICRKD LARNM+RMLKLF K+++  P++WCLPAD+ +LQ Y+R +K+KTYI KPD+GCQGRGI+IT++ KEIKP E+M+CQ+Y+SKPF+IDGFKFDLR+YVLVTSCDPLRVF Y +GL RF TT YS PN +N+D I MHLTNYS+ KHS NFVQ D   G+KR+++T N +    GY++E+IW  ++D+IIKTLISAH ++KHNY TCFP+H   SACFEILGFD++ DRKLKP L+EVNHSPSF TDSKLDKE+K++L++D L L+N      K+ + EE+R+    L Q  NR+   +EV    A  ++  E+YE  + G FR IYPG    KYDKFF  N SL+Q T A +AR E   +Q  +  +++++    LK+  +++ + ES  E+ + KV+
Sbjct:   61 VINLSNCRYDSVRRAAQQYGLREAGDNDDWTLYWTDYSVSLERVMEMKSYQKINHFPGMSEICRKDLLARNMSRMLKLFPKDFHFFPRTWCLPADWGDLQTYSRTRKNKTYICKPDSGCQGRGIFITRSVKEIKPGEDMICQLYISKPFIIDGFKFDLRVYVLVTSCDPLRVFVYNEGLARFATTSYSHPNLDNLDEICMHLTNYSINKHSSNFVQ-DAFSGSKRKLSTFNSYMKTHGYDVEQIWRGIEDVIIKTLISAHPVIKHNYHTCFPSHTLNSACFEILGFDILLDRKLKPWLLEVNHSPSFSTDSKLDKEVKDSLLYDALVLINLGNC-DKKKVLEEERQRGRFLQQCPNREIRLEEVKGFQAMRLQKTEEYEKKNCGGFRLIYPGLNLEKYDKFFQDNSSLFQNTVASRAR-ELYARQLIQELRQKQEKKVFLKKARKEETQGESAGEQARDKVV 519          
BLAST of Tubulin polyglutamylase ttll6 vs. UniProt/SwissProt
Match: sp|Q8N841|TTLL6_HUMAN (Tubulin polyglutamylase TTLL6 OS=Homo sapiens OX=9606 GN=TTLL6 PE=1 SV=2)

HSP 1 Score: 526.168 bits (1354), Expect = 3.194e-170
Identity = 244/426 (57.28%), Postives = 320/426 (75.12%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQ----EKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECA 1651
             I LS+C+YESVRR ++++GFRE  E+DDW L WTD+SV++ERV  MK YQKINH+PGM EICRKD LARNM+RMLK+F K++   P++WCLPAD+ +LQ Y+R +K+KTYI KPD+GCQG+GI+IT+  KEIKP E+M+CQ+Y+SKPF+IDGFKFDLRIYVLVTSCDPLR+F Y +GL RF TT YS P  +N+D+I MHLTNYS+ KHS NF + D   G+KR+++T + +  D  YN+E+IW D++D+IIKTLISAH +++HNY TCFPNH   SACFEILGFD++ D KLKP L+EVNHSPSF TDS+LDKE+K+ L++DTL L+N  +    +    E+ + R +  Q+   ++++ E   E   F  +Q    E YE  + G FR IYP   S KY+KFF  N SL+Q T A +AR E A
Sbjct:   62 VINLSSCRYESVRRAAQQYGFREGGEDDDWTLYWTDYSVSLERVMEMKSYQKINHFPGMSEICRKDLLARNMSRMLKMFPKDFRFFPRTWCLPADWGDLQTYSRSRKNKTYICKPDSGCQGKGIFITRTVKEIKPGEDMICQLYISKPFIIDGFKFDLRIYVLVTSCDPLRIFVYNEGLARFATTSYSRPCTDNLDDICMHLTNYSINKHSSNFSR-DAHSGSKRKLSTFSAYLEDHSYNVEQIWRDIEDVIIKTLISAHPIIRHNYHTCFPNHTLNSACFEILGFDILLDHKLKPWLLEVNHSPSFSTDSRLDKEVKDGLLYDTLVLINLESC--DKKKVLEEERQRGQFLQQCCSREMRIE---EAKGFRAVQLKKTETYEKENCGGFRLIYPSLNSEKYEKFFQDNNSLFQNTVASRAREEYA 481          
BLAST of Tubulin polyglutamylase ttll6 vs. TrEMBL
Match: A0A1S3J6P2 (tubulin polyglutamylase TTLL13P-like OS=Lingula unguis OX=7574 GN=LOC106170573 PE=4 SV=1)

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 359/565 (63.54%), Postives = 453/565 (80.18%), Query Frame = 2
Query:  389 ICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQN-RKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNV-SLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEKF-----LFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALHNTGGTMAYQHTSNATQPIIPQINNLSQF 2062
            IC  NCKYE VRRVSKR  F+EV+E+++WNL WTD+SV +ERV  MKKYQKINH+PGM EICRKD L+RN+NRM+KLF K+YNI P+SWCLPADY + QA+ARQKK KTYILKP++GCQG+GIW+TKNPKEIKP+E+MVCQ Y+S+PFLIDGFKFDLR+Y LVTSCDP R+F +KDGL RF TTKY+EP+ NNVDN+YMHLTNY++ KHS++F++DDEEGG+KRRI T+N+W    GYN+EK+W D+DD++IKTLISAH +LKHNYRTCFPNHV+GSACFEILG DV+ DRKLKP ++EVNHSPSFHTD+KLDKEIKEALI+D+L L+N  A DK++ I+EE+R+I+ERLFQ+Q  +K+ K+E+++   +++E   KYED HLGNFRRIYP  G+ KYDK+F  +  SL+QETAAFKARSECARQQREEI +K+EK + +L  K++K  RPESP  R +R    SV  + L       SR   E +E       L D +KP +I ++EE+ER+SGLLQRDNL+R LGIVE VY+ LH T GTM    +++  Q     INNL ++
Sbjct:    6 ICTVNCKYEVVRRVSKRLNFKEVSEDEEWNLYWTDYSVALERVMEMKKYQKINHFPGMSEICRKDLLSRNLNRMVKLFPKDYNIFPRSWCLPADYGDFQAFARQKKSKTYILKPESGCQGKGIWVTKNPKEIKPNEHMVCQQYISRPFLIDGFKFDLRVYTLVTSCDPFRIFVFKDGLARFATTKYTEPHGNNVDNVYMHLTNYAINKHSEDFIRDDEEGGSKRRIITMNKWLTHHGYNVEKMWNDIDDVLIKTLISAHPILKHNYRTCFPNHVKGSACFEILGMDVLLDRKLKPYILEVNHSPSFHTDAKLDKEIKEALIYDSLNLINCGAVDKRKCIEEERRRIKERLFQRQGYKKESKEELEQAQQEWLESLTKYEDQHLGNFRRIYPAHGTDKYDKYFQHSAGSLFQETAAFKARSECARQQREEILRKKEKMEMMLN-KNKKAARPESPGSRKRRLKRPSVPRRQLAS-----SRQGAEGTEHVNIESELIDTTKPLDILEEEELERISGLLQRDNLVRGLGIVEHVYRLLHCTPGTMGVMKSNDPRQQF--GINNLQKY 562          
BLAST of Tubulin polyglutamylase ttll6 vs. TrEMBL
Match: A0A2C9JJH7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106073697 PE=4 SV=1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 347/547 (63.44%), Postives = 443/547 (80.99%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDV-RPESPEERPKRKVLNSVSNKTLKQPGYLR------SRG---YLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALHNTGGTM 1996
            TICLSNCKY+ VRR S+++GFREV++EDDW L WTDFSV +ERV  MKKYQKINH+PGM EICRKD LARNMNRM KLF KEYN+ PK+WCLPADY + QAY RQKK+KTYILKP++GCQGRGIW+TK PK+IKP+E+M+CQVY+++PFLIDGFKFDLR+Y LVTSCDP R+F +KDGL RF T KYSEPN NN DN+YMHLTNY++ KHS +FV+DD E G+KRRI+T+N++  + GY+++K+W+D+DD+IIKTLISAH++LKHNYRTCFPNHV+GSACFEILGFD+IFDRKLKP ++EVNHSPSF TD+ +D+EIK ALIWDTL LVNF A D+++ ++EEKR+I++RL  K  +K+ K+E++    +++E  EKYE+ H+GN+RRIYP PG+ +YDK+F ++ SL+QETAAFKAR E ARQQREEI +K+EK + +LK K +KDV RPESP  R  R+ L+S     L+  G  +      S G     +  E    D  KPQ+I ++EE+ERLSGLLQRDNL+R LG+VE  Y+ LH+T G +
Sbjct:   17 TICLSNCKYDVVRRTSRKYGFREVSDEDDWTLYWTDFSVALERVMDMKKYQKINHFPGMSEICRKDMLARNMNRMQKLFPKEYNVFPKTWCLPADYGDFQAYTRQKKNKTYILKPESGCQGRGIWVTKYPKDIKPNEHMICQVYITRPFLIDGFKFDLRVYTLVTSCDPFRIFVFKDGLARFATFKYSEPNHNNTDNVYMHLTNYAINKHSQDFVRDD-EAGSKRRISTINKYLRENGYDVDKLWSDIDDVIIKTLISAHSVLKHNYRTCFPNHVKGSACFEILGFDIIFDRKLKPIVLEVNHSPSFTTDADIDREIKGALIWDTLGLVNFGAVDRRKCVEEEKRRIKDRLLGKYVKKETKEELEAAYNQYLEQLEKYEEKHMGNYRRIYPIPGTERYDKYFHSSGSLFQETAAFKARQEMARQQREEIMRKKEKNEMMLKGKAKKDVLRPESPGRR--RRKLSSRPTLPLRHIGNQQMPNNEPSNGTAILYDVKEYEPVDTKKPQDIVEEEELERLSGLLQRDNLVRGLGVVEHAYRLLHSTPGIL 560          
BLAST of Tubulin polyglutamylase ttll6 vs. TrEMBL
Match: A0A2C9JJI9 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106073697 PE=4 SV=1)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 347/561 (61.85%), Postives = 445/561 (79.32%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDV-RPESPEERPKRKVLNSVSNKTLKQPG---------------YLRSRGYLEKSEKFLFDM--------SKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALHNTGGTM 1996
            TICLSNCKY+ VRR S+++GFREV++EDDW L WTDFSV +ERV  MKKYQKINH+PGM EICRKD LARNMNRM KLF KEYN+ PK+WCLPADY + QAY RQKK+KTYILKP++GCQGRGIW+TK PK+IKP+E+M+CQVY+++PFLIDGFKFDLR+Y LVTSCDP R+F +KDGL RF T KYSEPN NN DN+YMHLTNY++ KHS +FV+DD E G+KRRI+T+N++  + GY+++K+W+D+DD+IIKTLISAH++LKHNYRTCFPNHV+GSACFEILGFD+IFDRKLKP ++EVNHSPSF TD+ +D+EIK ALIWDTL LVNF A D+++ ++EEKR+I++RL  K  +K+ K+E++    +++E  EKYE+ H+GN+RRIYP PG+ +YDK+F ++ SL+QETAAFKAR E ARQQREEI +K+EK + +LK K +KDV RPESP  R  R+ L+S     L+  G                  S+  L +  +  FD+         KPQ+I ++EE+ERLSGLLQRDNL+R LG+VE  Y+ LH+T G +
Sbjct:   17 TICLSNCKYDVVRRTSRKYGFREVSDEDDWTLYWTDFSVALERVMDMKKYQKINHFPGMSEICRKDMLARNMNRMQKLFPKEYNVFPKTWCLPADYGDFQAYTRQKKNKTYILKPESGCQGRGIWVTKYPKDIKPNEHMICQVYITRPFLIDGFKFDLRVYTLVTSCDPFRIFVFKDGLARFATFKYSEPNHNNTDNVYMHLTNYAINKHSQDFVRDD-EAGSKRRISTINKYLRENGYDVDKLWSDIDDVIIKTLISAHSVLKHNYRTCFPNHVKGSACFEILGFDIIFDRKLKPIVLEVNHSPSFTTDADIDREIKGALIWDTLGLVNFGAVDRRKCVEEEKRRIKDRLLGKYVKKETKEELEAAYNQYLEQLEKYEEKHMGNYRRIYPIPGTERYDKYFHSSGSLFQETAAFKARQEMARQQREEIMRKKEKNEMMLKGKAKKDVLRPESPGRR--RRKLSSRPTLPLRHIGNQQMPNNEPSNGTAILYYSKTLLARDRQLSFDVKEYEPVDTKKPQDIVEEEELERLSGLLQRDNLVRGLGVVEHAYRLLHSTPGIL 574          
BLAST of Tubulin polyglutamylase ttll6 vs. TrEMBL
Match: A0A2C9JJJ6 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106073697 PE=4 SV=1)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 347/561 (61.85%), Postives = 445/561 (79.32%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDV-RPESPEERPKRKVLNSVSNKTLKQPG---------------YLRSRGYLEKSEKFLFDM--------SKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALHNTGGTM 1996
            TICLSNCKY+ VRR S+++GFREV++EDDW L WTDFSV +ERV  MKKYQKINH+PGM EICRKD LARNMNRM KLF KEYN+ PK+WCLPADY + QAY RQKK+KTYILKP++GCQGRGIW+TK PK+IKP+E+M+CQVY+++PFLIDGFKFDLR+Y LVTSCDP R+F +KDGL RF T KYSEPN NN DN+YMHLTNY++ KHS +FV+DD E G+KRRI+T+N++  + GY+++K+W+D+DD+IIKTLISAH++LKHNYRTCFPNHV+GSACFEILGFD+IFDRKLKP ++EVNHSPSF TD+ +D+EIK ALIWDTL LVNF A D+++ ++EEKR+I++RL  K  +K+ K+E++    +++E  EKYE+ H+GN+RRIYP PG+ +YDK+F ++ SL+QETAAFKAR E ARQQREEI +K+EK + +LK K +KDV RPESP  R  R+ L+S     L+  G                  S+  L +  +  FD+         KPQ+I ++EE+ERLSGLLQRDNL+R LG+VE  Y+ LH+T G +
Sbjct:   17 TICLSNCKYDVVRRTSRKYGFREVSDEDDWTLYWTDFSVALERVMDMKKYQKINHFPGMSEICRKDMLARNMNRMQKLFPKEYNVFPKTWCLPADYGDFQAYTRQKKNKTYILKPESGCQGRGIWVTKYPKDIKPNEHMICQVYITRPFLIDGFKFDLRVYTLVTSCDPFRIFVFKDGLARFATFKYSEPNHNNTDNVYMHLTNYAINKHSQDFVRDD-EAGSKRRISTINKYLRENGYDVDKLWSDIDDVIIKTLISAHSVLKHNYRTCFPNHVKGSACFEILGFDIIFDRKLKPIVLEVNHSPSFTTDADIDREIKGALIWDTLGLVNFGAVDRRKCVEEEKRRIKDRLLGKYVKKETKEELEAAYNQYLEQLEKYEEKHMGNYRRIYPIPGTERYDKYFHSSGSLFQETAAFKARQEMARQQREEIMRKKEKNEMMLKGKAKKDVLRPESPGRR--RRKLSSRPTLPLRHIGNQQMPNNEPSNGTAILYYSKTLLARDRQLSFDVKEYEPVDTKKPQDIVEEEELERLSGLLQRDNLVRGLGVVEHAYRLLHSTPGIL 574          
BLAST of Tubulin polyglutamylase ttll6 vs. TrEMBL
Match: A0A2C9JJI2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106073697 PE=4 SV=1)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 347/561 (61.85%), Postives = 445/561 (79.32%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDV-RPESPEERPKRKVLNSVSNKTLKQPG---------------YLRSRGYLEKSEKFLFDM--------SKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALHNTGGTM 1996
            TICLSNCKY+ VRR S+++GFREV++EDDW L WTDFSV +ERV  MKKYQKINH+PGM EICRKD LARNMNRM KLF KEYN+ PK+WCLPADY + QAY RQKK+KTYILKP++GCQGRGIW+TK PK+IKP+E+M+CQVY+++PFLIDGFKFDLR+Y LVTSCDP R+F +KDGL RF T KYSEPN NN DN+YMHLTNY++ KHS +FV+DD E G+KRRI+T+N++  + GY+++K+W+D+DD+IIKTLISAH++LKHNYRTCFPNHV+GSACFEILGFD+IFDRKLKP ++EVNHSPSF TD+ +D+EIK ALIWDTL LVNF A D+++ ++EEKR+I++RL  K  +K+ K+E++    +++E  EKYE+ H+GN+RRIYP PG+ +YDK+F ++ SL+QETAAFKAR E ARQQREEI +K+EK + +LK K +KDV RPESP  R  R+ L+S     L+  G                  S+  L +  +  FD+         KPQ+I ++EE+ERLSGLLQRDNL+R LG+VE  Y+ LH+T G +
Sbjct:   17 TICLSNCKYDVVRRTSRKYGFREVSDEDDWTLYWTDFSVALERVMDMKKYQKINHFPGMSEICRKDMLARNMNRMQKLFPKEYNVFPKTWCLPADYGDFQAYTRQKKNKTYILKPESGCQGRGIWVTKYPKDIKPNEHMICQVYITRPFLIDGFKFDLRVYTLVTSCDPFRIFVFKDGLARFATFKYSEPNHNNTDNVYMHLTNYAINKHSQDFVRDD-EAGSKRRISTINKYLRENGYDVDKLWSDIDDVIIKTLISAHSVLKHNYRTCFPNHVKGSACFEILGFDIIFDRKLKPIVLEVNHSPSFTTDADIDREIKGALIWDTLGLVNFGAVDRRKCVEEEKRRIKDRLLGKYVKKETKEELEAAYNQYLEQLEKYEEKHMGNYRRIYPIPGTERYDKYFHSSGSLFQETAAFKARQEMARQQREEIMRKKEKNEMMLKGKAKKDVLRPESPGRR--RRKLSSRPTLPLRHIGNQQMPNNEPSNGTAILYYSKTLLARDRQLSFDVKEYEPVDTKKPQDIVEEEELERLSGLLQRDNLVRGLGVVEHAYRLLHSTPGIL 574          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Cavefish
Match: ttll6 (tubulin tyrosine ligase like 6 [Source:NCBI gene;Acc:103042535])

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 298/541 (55.08%), Postives = 401/541 (74.12%), Query Frame = 2
Query:  389 ICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEI---------ERLSGLLQRDNLIRALGIVEMVYKALHNT 1984
            I L+NCKYESVRR ++++G RE  E +DW L WTD SV+++RV  MK+YQKINH+PGM EICRKD LARNMNRMLKLF K+YNI P++WCLPADY++ QAY R KKHK YI KPD+GCQGRGI++TK+ K+I+P E+M+CQVY+S+PF+IDGFKFDLR+YVLVTSCDP R+F Y +GL RF T  Y+EP  +N+ ++ MHLTNY++ KHS+NFV+DD+  G+KR+++TLN+      YN EK+W D++D+IIKTLISAH +LKHNY TCFPNH  GSACFEILGFDV+ D +LKP L+EVNHSPSF TDS+LD+E+K+ L++DTL L+N  A D+++I++EEKR+++ERL Q ++R+   +E+ +  A  ME  E+YE  HLG FRRIYP  G  KY+K+F  + SL+QETAA KAR ECARQQ +E++ K+E+     K   R+D++ ES  ER K +   + S             G   + + FL   S+P    D+ ++         ER++GLLQR+NL+R LG+V+ VY+   +T
Sbjct:   57 INLTNCKYESVRRAARKYGLREAGEGEDWTLFWTDCSVSLDRVMDMKRYQKINHFPGMSEICRKDLLARNMNRMLKLFPKDYNIFPRTWCLPADYSDFQAYTRAKKHKMYICKPDSGCQGRGIFLTKSNKDIRPGEHMICQVYVSRPFIIDGFKFDLRVYVLVTSCDPFRIFVYNEGLARFCTNLYNEPTSSNMGDVCMHLTNYAINKHSENFVRDDDT-GSKRKLSTLNKHLEAMCYNTEKVWVDIEDVIIKTLISAHPILKHNYHTCFPNHASGSACFEILGFDVLLDHRLKPWLLEVNHSPSFTTDSRLDREVKDGLLYDTLVLINLGACDRRKIMEEEKRRVKERLQQNRSREARSEELRQSHATNMEQMERYESKHLGGFRRIYPREGGEKYEKYFKHSSSLFQETAASKAREECARQQLQELRLKEEQ-----KGNHRRDLQGESAGERAKPRKSQTHSTHP----------GTNSEQQDFLSMPSQPSSGVDNSQVLDVSEEEEVERVNGLLQRENLLRDLGVVDQVYRLFQDT 581          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Cavefish
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:103028996])

HSP 1 Score: 356.681 bits (914), Expect = 1.754e-107
Identity = 185/448 (41.29%), Postives = 282/448 (62.95%), Query Frame = 2
Query:  380 LYTICLSNCKYESVRRVSKRFGFREVNEEDD-WNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYA----RQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDE-EGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRG--SACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDI-----------------KDEVDKEMAKFME--IQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            + T  ++  KYE VR   +   F +  +ED+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM +M+K+  +EY+ +PK+W  PA+Y + Q Y     R++K KT+I+KP  G  G GI + +N +++   ++ + Q YL KPFL++G+KFDLRIY+LVTSCDPLR+F Y DGLVR  T KY  PN +N+  +YMHLTNYS+ KH++NF +D+  + G+KR I     +     Y++ K W DV ++++KTLI A   + H YR C P    G  S CFE+LGFD+I DRKLKP L+E+N +PSF TD K+D ++K+ ++ + L+L+N  A+DK+R + ++K + + RL+ +   K +                 K+E+ + +A+  +   +E++E  HLGN+RRIYP       +K+     + +Q   A +A S
Sbjct:   40 VITANVAGTKYEIVRIAIREIDFHKTRDEDETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMAKMIKIQPQEYSFSPKTWIFPAEYTQFQNYVKELRRKRKQKTFIVKPANGAMGHGISLIRNCEKLPAQDHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHTPNDSNLSQLYMHLTNYSVNKHNENFERDETVDKGSKRSIGWFTEFLRTNDYDVAKFWGDVSELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDFDVKKGVLLNALKLLNVRASDKRRNLAQQKAEAQRRLYGQGTMKKLSAGSSEWEKQRLTLERRKEELKERLAQVRKQISREEHEKRHLGNYRRIYPPDDKLLLEKYEGLLSAAFQTFLAGRAAS 487          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Cavefish
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:103028996])

HSP 1 Score: 358.221 bits (918), Expect = 3.466e-107
Identity = 185/448 (41.29%), Postives = 282/448 (62.95%), Query Frame = 2
Query:  380 LYTICLSNCKYESVRRVSKRFGFREVNEEDD-WNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYA----RQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDE-EGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRG--SACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDI-----------------KDEVDKEMAKFME--IQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            + T  ++  KYE VR   +   F +  +ED+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM +M+K+  +EY+ +PK+W  PA+Y + Q Y     R++K KT+I+KP  G  G GI + +N +++   ++ + Q YL KPFL++G+KFDLRIY+LVTSCDPLR+F Y DGLVR  T KY  PN +N+  +YMHLTNYS+ KH++NF +D+  + G+KR I     +     Y++ K W DV ++++KTLI A   + H YR C P    G  S CFE+LGFD+I DRKLKP L+E+N +PSF TD K+D ++K+ ++ + L+L+N  A+DK+R + ++K + + RL+ +   K +                 K+E+ + +A+  +   +E++E  HLGN+RRIYP       +K+     + +Q   A +A S
Sbjct:   40 VITANVAGTKYEIVRIAIREIDFHKTRDEDETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMAKMIKIQPQEYSFSPKTWIFPAEYTQFQNYVKELRRKRKQKTFIVKPANGAMGHGISLIRNCEKLPAQDHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHTPNDSNLSQLYMHLTNYSVNKHNENFERDETVDKGSKRSIGWFTEFLRTNDYDVAKFWGDVSELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDFDVKKGVLLNALKLLNVRASDKRRNLAQQKAEAQRRLYGQGTMKKLSAGSSEWEKQRLTLERRKEELKERLAQVRKQISREEHEKRHLGNYRRIYPPDDKLLLEKYEGLLSAAFQTFLAGRAAS 487          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Cavefish
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:103028996])

HSP 1 Score: 357.451 bits (916), Expect = 6.437e-107
Identity = 185/448 (41.29%), Postives = 282/448 (62.95%), Query Frame = 2
Query:  380 LYTICLSNCKYESVRRVSKRFGFREVNEEDD-WNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYA----RQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDE-EGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRG--SACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDI-----------------KDEVDKEMAKFME--IQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            + T  ++  KYE VR   +   F +  +ED+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM +M+K+  +EY+ +PK+W  PA+Y + Q Y     R++K KT+I+KP  G  G GI + +N +++   ++ + Q YL KPFL++G+KFDLRIY+LVTSCDPLR+F Y DGLVR  T KY  PN +N+  +YMHLTNYS+ KH++NF +D+  + G+KR I     +     Y++ K W DV ++++KTLI A   + H YR C P    G  S CFE+LGFD+I DRKLKP L+E+N +PSF TD K+D ++K+ ++ + L+L+N  A+DK+R + ++K + + RL+ +   K +                 K+E+ + +A+  +   +E++E  HLGN+RRIYP       +K+     + +Q   A +A S
Sbjct:   40 VITANVAGTKYEIVRIAIREIDFHKTRDEDETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMAKMIKIQPQEYSFSPKTWIFPAEYTQFQNYVKELRRKRKQKTFIVKPANGAMGHGISLIRNCEKLPAQDHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHTPNDSNLSQLYMHLTNYSVNKHNENFERDETVDKGSKRSIGWFTEFLRTNDYDVAKFWGDVSELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDFDVKKGVLLNALKLLNVRASDKRRNLAQQKAEAQRRLYGQGTMKKLSAGSSEWEKQRLTLERRKEELKERLAQVRKQISREEHEKRHLGNYRRIYPPDDKLLLEKYEGLLSAAFQTFLAGRAAS 487          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Cavefish
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:103028996])

HSP 1 Score: 357.451 bits (916), Expect = 1.013e-106
Identity = 185/448 (41.29%), Postives = 282/448 (62.95%), Query Frame = 2
Query:  380 LYTICLSNCKYESVRRVSKRFGFREVNEEDD-WNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYA----RQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDE-EGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRG--SACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDI-----------------KDEVDKEMAKFME--IQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            + T  ++  KYE VR   +   F +  +ED+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM +M+K+  +EY+ +PK+W  PA+Y + Q Y     R++K KT+I+KP  G  G GI + +N +++   ++ + Q YL KPFL++G+KFDLRIY+LVTSCDPLR+F Y DGLVR  T KY  PN +N+  +YMHLTNYS+ KH++NF +D+  + G+KR I     +     Y++ K W DV ++++KTLI A   + H YR C P    G  S CFE+LGFD+I DRKLKP L+E+N +PSF TD K+D ++K+ ++ + L+L+N  A+DK+R + ++K + + RL+ +   K +                 K+E+ + +A+  +   +E++E  HLGN+RRIYP       +K+     + +Q   A +A S
Sbjct:   40 VITANVAGTKYEIVRIAIREIDFHKTRDEDETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMAKMIKIQPQEYSFSPKTWIFPAEYTQFQNYVKELRRKRKQKTFIVKPANGAMGHGISLIRNCEKLPAQDHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHTPNDSNLSQLYMHLTNYSVNKHNENFERDETVDKGSKRSIGWFTEFLRTNDYDVAKFWGDVSELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDFDVKKGVLLNALKLLNVRASDKRRNLAQQKAEAQRRLYGQGTMKKLSAGSSEWEKQRLTLERRKEELKERLAQVRKQISREEHEKRHLGNYRRIYPPDDKLLLEKYEGLLSAAFQTFLAGRAAS 487          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008895.1 (pep scaffold:Pmarinus_7.0:GL476825:58484:82827:1 gene:ENSPMAG00000008053.1 transcript:ENSPMAT00000008895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 200.29 bits (508), Expect = 1.520e-56
Identity = 112/325 (34.46%), Postives = 189/325 (58.15%), Query Frame = 2
Query:  419 VRRVSKRFGFREVN-EEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFG-KEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDD----EEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVN 1375
            VR +    GF EV+   +D+NL+WT        +  +  +QK+NH+P   E+ RKD L +N+ RM +  G K +NI P ++ LPA+Y +  + A  K    +I+KP A  +GRG+++  +P ++   EN++   YL  P LID FKFD+R+YVLVTS +PL ++ Y++GL RF T KY   N   + N +MHLTNYS+ K S ++V  D    E+ G K  ++ + R     G++   +   ++D+I+KT++S    +  + R   P+  RG+ CF ++G  V+  ++ +  L+ ++ S +  +D+ LD ++K +++ D   LV 
Sbjct:   77 VRNILGSHGFHEVHPSSNDFNLMWTGTHPKPFSLRSLTDFQKVNHFPRSYELTRKDRLCKNVQRMQQSHGHKHFNIIPATFLLPAEYQDFCS-AHSKDRGPWIVKPVASSRGRGVYLVNSPNQVTMDENILVSRYLGNPLLIDDFKFDVRLYVLVTSYEPLVIYLYEEGLTRFATVKYDR-NSKFIKNQFMHLTNYSVNKKSRDYVSCDDPEVEDFGNKWSMSAMLRCLKQDGHDTTALMARIEDLIVKTILSVEQTIASSVRMFVPH--RGN-CFGMMGLGVLLYKRGRTFLLHLDLSLTLCSDAPLDLKVKASMVSDMFSLVG 396          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004193.1 (pep scaffold:Pmarinus_7.0:GL495833:1191:3921:-1 gene:ENSPMAG00000003831.1 transcript:ENSPMAT00000004193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 1.182e-15
Identity = 40/95 (42.11%), Postives = 54/95 (56.84%), Query Frame = 2
Query: 1091 DKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVN 1375
            DKG +   IW  + DI +KT+I++   +         N     +C E+ GFDV+ D KLKP L+EVN SPS H++S LD  +K  LI D   LVN
Sbjct:   11 DKGVDCRTIWEQIKDIAVKTVIASEPFVSSLLAQFVGNR---RSCHELFGFDVMLDEKLKPWLLEVNISPSLHSNSPLDVAVKVQLIKD---LVN 99          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Sea Lamprey
Match: TTLL10 (tubulin tyrosine ligase like 10 [Source:HGNC Symbol;Acc:HGNC:26693])

HSP 1 Score: 70.0922 bits (170), Expect = 1.042e-12
Identity = 60/241 (24.90%), Postives = 106/241 (43.98%), Query Frame = 2
Query:  716 YILKPDAGCQGRGIWITKN---------------------PKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLIS-AHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLV 1372
            +I KP    QGRGI++ ++                     P+   P   +V Q Y++ P L+DG KFD+R Y+L+ S  P  +  ++ G  R +   YS P  N   ++  HLTN  +QK S  + +  EE      + T++R+      +         D ++ T       ++ H +             F+++G D + D   K  L+E+N +P+  T+  + KE+   ++ +TL L 
Sbjct:  127 WICKPTGLNQGRGIFLLRSAGDVAALRERLLLDADAGPRTPRAHVPQARIV-QRYVTNPLLLDGRKFDVRSYMLIASAAP-PIVLFRHGYARLSCQSYS-PESN---DLTAHLTNQYMQKKSPVYQEVKEET-----VWTMSRFNDHVNEHCAPHKGLPKDWVLTTFTKRMQQVMTHCFLATKSKLEGKLGLFDLIGCDFLIDEDFKVWLLEMNCNPALQTNCMVLKEVIPQVVNETLDLA 356          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Sea Lamprey
Match: ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:NCBI gene;Acc:724000])

HSP 1 Score: 70.4774 bits (171), Expect = 1.256e-12
Identity = 56/201 (27.86%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  803 VCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDK----------GYNIEKIWT-DVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLV 1372
            + Q Y+ +P LI   KFD+R + LVT  +PL V+ Y+D  +RF+T  +     +N+D   +HL N S+QKH +N        G   ++   N W   +          G+  E +    +   II  L +A  ++            RGS  FE+ G D +     +P L+E+N SP+    + +  E+   +  D L++V
Sbjct:  337 IVQKYVERPLLIHATKFDIRQWFLVTDWNPLTVWFYQDCYLRFSTQPF---QLDNLDT-SIHLCNNSIQKHFEN------AQGRSAQLPRDNIWHGRQFVSYLESLGLGFAWEGVVVPGMKQAIIHALQAAQDVVDAR---------RGS--FELYGADFLLGEDQRPWLLEINSSPTMSPSTPVTAELCARVQDDLLRVV 516          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Sea Lamprey
Match: ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:NCBI gene;Acc:724000])

HSP 1 Score: 70.0922 bits (170), Expect = 1.657e-12
Identity = 56/201 (27.86%), Postives = 93/201 (46.27%), Query Frame = 2
Query:  803 VCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDK----------GYNIEKIWT-DVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLV 1372
            + Q Y+ +P LI   KFD+R + LVT  +PL V+ Y+D  +RF+T  +     +N+D   +HL N S+QKH +N        G   ++   N W   +          G+  E +    +   II  L +A  ++            RGS  FE+ G D +     +P L+E+N SP+    + +  E+   +  D L++V
Sbjct:  364 IVQKYVERPLLIHATKFDIRQWFLVTDWNPLTVWFYQDCYLRFSTQPF---QLDNLDT-SIHLCNNSIQKHFEN------AQGRSAQLPRDNIWHGRQFVSYLESLGLGFAWEGVVVPGMKQAIIHALQAAQDVVDAR---------RGS--FELYGADFLLGEDQRPWLLEINSSPTMSPSTPVTAELCARVQDDLLRVV 543          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Nematostella
Match: EDO34389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPH2])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 273/422 (64.69%), Postives = 342/422 (81.04%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECA 1651
            ++CL+NCKY+SVRRV+KRFG +EV EEDDW+L W D SV +ER   MK+YQKINH+PGM EICRKD LARNMNR+ K F K+Y + PK+W LPADY + Q+Y RQKK+KT+I KP++G QG+GI ITKNPK+IKP E++VCQ Y+SKPFLIDGFKFDLRIYVLVTSCDPLRVF Y+DGL RF T+KY+EP  NN+D+I MHLTNYS+ KHS +F++ DEE G+KRRITT+N WF + GY++++IW  ++D IIKTL++AH +LKHNYRTCFPNH +GSACFEILGFDV+ D+KLKP ++EVNHSPSF TDS LDKEIKE L+ D L L+NF A D+++II+E+KR++RERL QKQ  K+ K +  +   ++ E   KYED HLG +RRIYP     KY +FF  + SL+QETAA KAR ECA
Sbjct:    3 SVCLTNCKYDSVRRVTKRFGMKEVGEEDDWSLFWIDCSVALERCMEMKRYQKINHFPGMSEICRKDLLARNMNRLWKQFPKDYAVFPKTWVLPADYGDFQSYCRQKKNKTFITKPESGSQGKGIVITKNPKDIKPGEHLVCQQYVSKPFLIDGFKFDLRIYVLVTSCDPLRVFVYEDGLARFATSKYTEPQNNNLDDICMHLTNYSINKHSKDFIR-DEEIGSKRRITTINNWFVENGYDLKEIWDGIEDCIIKTLVTAHPILKHNYRTCFPNHNKGSACFEILGFDVLLDKKLKPWVIEVNHSPSFTTDSPLDKEIKEGLMSDALALLNFGACDRRKIIEEDKRRVRERLLQKQRPKEPKRDDCENQQQYNEWITKYEDKHLGKYRRIYPQGNEEKYARFFENSCSLFQETAASKARIECA 423          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Nematostella
Match: EDO45410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT71])

HSP 1 Score: 355.525 bits (911), Expect = 3.460e-111
Identity = 188/429 (43.82%), Postives = 268/429 (62.47%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEEDDWN--LIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQ----KKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDD-EEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRG--SACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEI-------------------QEKYEDGHLGNFRRIYPGPGSSKYDKF 1588
            T  +S  KY+ VR+     G   V  +DD +   IW+D SV  ER   +K YQ+INH+PGM EICRKDSLARN+ +M +    EY+ AP++W LPA+YA  Q Y R+    K+ KT+I+KP  G  G GI + +N   I   E +V Q Y+ +PFL+DG+KFDLR+YVLVTSCDPLR+F Y DGLVR  T  Y  P  +N+D ++MHLTNYS+ KH++NF +D+ ++ G+KR I  LN W     Y++  +W  + ++I+KTLI A   + H+YR C P    G  S CFE+LGFD++ DRKLKP L+E+N SPSF TDSKLD+E+K   + DTL+L+N   +D++R +  EK + + RL  +  R +    V +   K M +                   +E++E+ ++GNFRR+YP    +K +K+
Sbjct:    7 TANISATKYDIVRKACVHAGM-VVTRDDDPSCFFIWSDSSVGAERFIELKPYQRINHFPGMGEICRKDSLARNIAKMKRAHPDEYSFAPQTWVLPAEYAAFQMYCRELKKKKRAKTFIMKPANGAMGNGISLIRNGDRIPSHEQLVIQEYIDRPFLLDGYKFDLRVYVLVTSCDPLRIFVYNDGLVRLGTECYEPPTEDNMDELFMHLTNYSINKHNENFERDENDDMGSKRSIKWLNEWLQSMDYDVNFLWRGITEVIVKTLIVAQPHVLHSYRMCRPGAATGSDSVCFELLGFDILLDRKLKPWLLEINRSPSFGTDSKLDQEVKGGALRDTLRLLNIKPSDRRRGMAAEKAESQRRLLTQPKRSEYTMSVSELDKKKMILNKRRNELKERLNQLRRESAREEFENINMGNFRRVYPPDDRAKNEKY 434          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Nematostella
Match: EDO40146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7W3])

HSP 1 Score: 226.868 bits (577), Expect = 6.980e-65
Identity = 130/349 (37.25%), Postives = 198/349 (56.73%), Query Frame = 2
Query:  383 YTICLSNCKYESVRRVSKRFGFREVNE-EDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFG-KEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDG---------FKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFV--QDDE--EGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAA 1384
            Y    + CK   VR +     FREV+    ++NL+WT   +    + GM+ +QKINH+P   E+ RKD L +N+ R+    G K ++  P S+ LP +Y E  A A  K+   +I+KP A  +GRGI++  +P ++   ++++   Y++ P LIDG         FKFD+R+YV VT  DPLR++ Y++GL RF T KY +    N+ N  MHLTNYS+ K S+NFV  QD E  + G K  ++ + R+   KG +   +   ++D+++KT+I+    +    +   P+      CFEI GFD++ D  L+P L+EVN SPS   DS LD +IK  L+ D   L+ F A
Sbjct:   10 YKFVKTECKL--VRSILNSHAFREVHPNSSNFNLMWTGSHLKPHSLRGMQDFQKINHFPRSYELTRKDRLYKNIQRLQHSKGLKHFDFIPNSFVLPEEYNEFYA-AFMKERGHWIVKPVASSRGRGIFLISHPSQVPLDDHLLVCRYITNPLLIDGNIYCFNFIGFKFDVRLYVGVTCYDPLRIYLYEEGLSRFATVKYDKSG-KNIRNSCMHLTNYSVNKKSENFVSCQDPEVEDYGNKWSMSAMLRFIKHKGIDTTALMMRIEDVVVKTIIAGELPIASACKMFMPH---PGNCFEIYGFDILIDENLRPWLLEVNLSPSLACDSPLDLKIKSHLVTDMFNLIGFVA 351          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Nematostella
Match: EDO38145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDP2])

HSP 1 Score: 225.713 bits (574), Expect = 2.735e-64
Identity = 142/422 (33.65%), Postives = 216/422 (51.18%), Query Frame = 2
Query:  443 GFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGK-EYNIAPKSWCLPADYAELQ-AYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDE-----EGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISA----HTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQ------------------------KQNRKDIKDEVD-KEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTN 1600
            GFR      DW   W    +       +++YQK+NH+PG  +I RKD L RN+++M+   GK E+   P+++ LP D+  L+ A+      + +ILKP A  +G GI +     +I     ++ Q YL KPFLI+G KFDLRIYV VTS DPLR++ ++DGLVRF T KYS  +  ++ N +MHLTNYS+ K ++   Q +      +G     + +L  +F   G N  ++W  V D+I+K +I++    +TL+K N R         S C E+ G DV+ D  LKP L+EVN SPS H++S+LD+ IK  +I D + L  F   +                 Q                        ++ R+ I D +   ++   ME +++Y     G F+R +P   S KY +FF + 
Sbjct:   56 GFRPTKRAHDWLGYWGK-HMKSTTFKSIREYQKVNHFPGTFQIGRKDRLWRNLSKMMVHHGKKEFGFLPQTYVLPYDFKLLKRAWDEGGSRQKWILKPPASARGIGIRVIHKWTQIPRKRPVIVQKYLHKPFLINGSKFDLRIYVYVTSYDPLRIYIFEDGLVRFATCKYSS-SVKSLSNRFMHLTNYSVNKKNEGAYQSNADDSLCQGHKWYYLKSLWGYFKRMGINHAQVWDSVKDVIVKAIIASDSFVNTLIKQNVR-------HRSCCHELFGCDVMLDENLKPWLLEVNISPSLHSNSQLDRNIKGQMIRDLMNLAAFRIPENLVTTTTASASSLNSFVQDKSTTSLSSDERAKHAFYVGRNVDERTRQSILDILTPSDVRILMETEDEY--SRRGCFQRAFPSMVSHKYLRFFEST 466          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Nematostella
Match: EDO36510 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH4])

HSP 1 Score: 227.254 bits (578), Expect = 4.639e-64
Identity = 121/297 (40.74%), Postives = 173/297 (58.25%), Query Frame = 2
Query:  542 INHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENM----VCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQ-DDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTD--------------SKLDKEIKEALIWDTLQLVN 1375
            ++ +PGM E   K    R MNRM  LF  EY+  PKSW LP  Y+EL  +  + K K YI+KPD G QG GI++  NP ++  S  +    + Q Y+S P L++ FKFDLRIYVLV   DPL ++  ++G+ RF T  Y  P+  N+   YMHLTNYSL K+S ++VQ DD++ G+KR+++ + +     G NIE +WTD+D II +T+I+    L    +    +  +   CF++LGFD++ D   KP L+EVN SPS   D              S  D EIK  +I D ++LV+
Sbjct:   60 LSKFPGMSEAAHKVEFTRLMNRMKHLFPSEYSFYPKSWILPDQYSELVGHVGKHKGKVYIIKPDLGSQGDGIYLMTNPYDVHFSPLLAKPCIVQEYISNPLLLEKFKFDLRIYVLVKCLDPLEIYVCREGMGRFCTEVYRPPSQKNLHRCYMHLTNYSLNKYSSSYVQSDDDDKGSKRKLSCVFKQLQSNGCNIETLWTDIDFIICRTIIAFMPNLLIEDQIVTLDLKQKLRCFQVLGFDILIDEDFKPILLEVNSSPSLKIDHEEETSPGKVEYFLSTTDMEIKLPIIVDAMRLVH 356          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Medaka
Match: ttll6 (tubulin tyrosine ligase like 6 [Source:NCBI gene;Acc:101164261])

HSP 1 Score: 532.332 bits (1370), Expect = 1.649e-174
Identity = 268/455 (58.90%), Postives = 354/455 (77.80%), Query Frame = 2
Query:  395 LSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPK 1759
            L+NCKYESVRR ++R G RE  E++DW L+WTD SV+++RV  MK YQKINH+PGM EICRKDSLARN+NRMLKLF K+YNI PK+WCLPADY++ Q Y R KK KTYI KPD GCQG+GI+ITK+ K+I+  E+M+CQVY+SKP +IDG+KFDLRIYVLVTSCDP  +F +++GL RF T+KY+EP   NV+++ MHLTNYS+ K+S+NFV+ DE+ G+KR+++TLNR       N EK+W D++DIIIKTLISAH +LKHNY TCFPNH  GSACFEILGFDV+ D +LKP ++EVNHSPSF TDS+LD+E+K+AL++DTL L+N AA D+ +I  EE+R+ ++RL Q  +++    E+ +  A  +E  E+YE  +LG F++IYP     KYDK+F  + SL+QET A KAR ECARQQ ++++ KQE+ +   K   RKD++ E+  ER K
Sbjct:   56 LTNCKYESVRRAARRLGLREAKEDEDWTLLWTDCSVSLDRVKDMKCYQKINHFPGMNEICRKDSLARNLNRMLKLFPKDYNIFPKTWCLPADYSDFQVYTRAKKSKTYICKPDTGCQGKGIFITKSSKDIQHEEHMICQVYISKPLIIDGYKFDLRIYVLVTSCDPFSIFMFREGLARFCTSKYNEPTRTNVEHVCMHLTNYSINKNSENFVR-DEDTGSKRKLSTLNRHLESLNCNTEKMWEDIEDIIIKTLISAHPILKHNYHTCFPNHTAGSACFEILGFDVLLDHRLKPWVLEVNHSPSFTTDSQLDREVKDALLYDTLVLINLAACDRHKITKEERRRAKDRLQQTCSKEARAQELRQSHAVTVEQMEEYEAKNLGGFKKIYPRKEGEKYDKYFKHSRSLFQETTASKAREECARQQLQDLQVKQEQKERYQKGGPRKDLQGETAGERAK 509          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Medaka
Match: ttll6 (tubulin tyrosine ligase like 6 [Source:NCBI gene;Acc:101164261])

HSP 1 Score: 514.227 bits (1323), Expect = 2.318e-167
Identity = 267/484 (55.17%), Postives = 354/484 (73.14%), Query Frame = 2
Query:  395 LSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPAD-----------------------------YAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPK 1759
            L+NCKYESVRR ++R G RE  E++DW L+WTD SV+++RV  MK YQKINH+PGM EICRKDSLARN+NRMLKLF K+YNI PK+WCLPA+                             Y++ Q Y R KK KTYI KPD GCQG+GI+ITK+ K+I+  E+M+CQVY+SKP +IDG+KFDLRIYVLVTSCDP  +F +++GL RF T+KY+EP   NV+++ MHLTNYS+ K+S+NFV+ DE+ G+KR+++TLNR       N EK+W D++DIIIKTLISAH +LKHNY TCFPNH  GSACFEILGFDV+ D +LKP ++EVNHSPSF TDS+LD+E+K+AL++DTL L+N AA D+ +I  EE+R+ ++RL Q  +++    E+ +  A  +E  E+YE  +LG F++IYP     KYDK+F  + SL+QET A KAR ECARQQ ++++ KQE+ +   K   RKD++ E+  ER K
Sbjct:   56 LTNCKYESVRRAARRLGLREAKEDEDWTLLWTDCSVSLDRVKDMKCYQKINHFPGMNEICRKDSLARNLNRMLKLFPKDYNIFPKTWCLPAESVSTLFEFRPFSYINFILFLICCPILLHSYSDFQVYTRAKKSKTYICKPDTGCQGKGIFITKSSKDIQHEEHMICQVYISKPLIIDGYKFDLRIYVLVTSCDPFSIFMFREGLARFCTSKYNEPTRTNVEHVCMHLTNYSINKNSENFVR-DEDTGSKRKLSTLNRHLESLNCNTEKMWEDIEDIIIKTLISAHPILKHNYHTCFPNHTAGSACFEILGFDVLLDHRLKPWVLEVNHSPSFTTDSQLDREVKDALLYDTLVLINLAACDRHKITKEERRRAKDRLQQTCSKEARAQELRQSHAVTVEQMEEYEAKNLGGFKKIYPRKEGEKYDKYFKHSRSLFQETTASKAREECARQQLQDLQVKQEQKERYQKGGPRKDLQGETAGERAK 538          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 347.821 bits (891), Expect = 4.826e-104
Identity = 185/443 (41.76%), Postives = 282/443 (63.66%), Query Frame = 2
Query:  395 LSNCKYESVRRVSKRFGFREVNEEDD-WNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYA----RQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDE-EGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRG--SACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLF-----------------QKQNRKDIKDEVDKEMAKFME--IQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            ++  KYE VR V     F +  ++D+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM++M+K   +EY+  PK+W  PA+Y +LQ Y     R++K KT+I+KP  G  G GIW+ +N +++   E+ + Q YL KPFL++G+KFDLRIY+LVTSCDPLR+F Y DGLVR  T KY  P+  N+  +YMHLTNYS+ KH++NF +D+  + G+KR I+   ++     Y++ K W D+ ++++KTLI A   + H YR C P    G  S CFE+LGFD+I D KLKP L+E+N +PSF TD K+D ++K+  + + L+L+N  A+DKKR + ++K + + RL+                 Q+   +  ++E+ +++A+  +   +E++E  HLGN+RRIYP       +K+ S   + +Q   A +A S
Sbjct:   45 VAGTKYEIVRIVINEMDFIKARDDDETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMSKMIKCQPQEYSFIPKTWIFPAEYTQLQNYVKELRRKRKQKTFIVKPSNGAMGHGIWLIRNCEKLPAQEHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHAPSEANLSQLYMHLTNYSVNKHNENFERDETVDKGSKRSISWFTQFLRCNDYDVAKFWGDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDHKLKPWLLEINRAPSFATDQKIDYDVKKGALLNALKLLNIRASDKKRNLAQQKAEAQRRLYGHGSMKKLPAASSDWEKQRHTLERRREELKEQLAQVRKQFSREQHEKQHLGNYRRIYPPDDKLLLEKYESLLSAAFQTFLAGRAAS 487          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 347.436 bits (890), Expect = 2.855e-103
Identity = 185/443 (41.76%), Postives = 282/443 (63.66%), Query Frame = 2
Query:  395 LSNCKYESVRRVSKRFGFREVNEEDD-WNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYA----RQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDE-EGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRG--SACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLF-----------------QKQNRKDIKDEVDKEMAKFME--IQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            ++  KYE VR V     F +  ++D+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM++M+K   +EY+  PK+W  PA+Y +LQ Y     R++K KT+I+KP  G  G GIW+ +N +++   E+ + Q YL KPFL++G+KFDLRIY+LVTSCDPLR+F Y DGLVR  T KY  P+  N+  +YMHLTNYS+ KH++NF +D+  + G+KR I+   ++     Y++ K W D+ ++++KTLI A   + H YR C P    G  S CFE+LGFD+I D KLKP L+E+N +PSF TD K+D ++K+  + + L+L+N  A+DKKR + ++K + + RL+                 Q+   +  ++E+ +++A+  +   +E++E  HLGN+RRIYP       +K+ S   + +Q   A +A S
Sbjct:   45 VAGTKYEIVRIVINEMDFIKARDDDETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMSKMIKCQPQEYSFIPKTWIFPAEYTQLQNYVKELRRKRKQKTFIVKPSNGAMGHGIWLIRNCEKLPAQEHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHAPSEANLSQLYMHLTNYSVNKHNENFERDETVDKGSKRSISWFTQFLRCNDYDVAKFWGDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDHKLKPWLLEINRAPSFATDQKIDYDVKKGALLNALKLLNIRASDKKRNLAQQKAEAQRRLYGHGSMKKLPAASSDWEKQRHTLERRREELKEQLAQVRKQFSREQHEKQHLGNYRRIYPPDDKLLLEKYESLLSAAFQTFLAGRAAS 487          
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 347.436 bits (890), Expect = 6.085e-103
Identity = 185/443 (41.76%), Postives = 282/443 (63.66%), Query Frame = 2
Query:  395 LSNCKYESVRRVSKRFGFREVNEEDD-WNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYA----RQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDE-EGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRG--SACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLF-----------------QKQNRKDIKDEVDKEMAKFME--IQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARS 1642
            ++  KYE VR V     F +  ++D+  NLIW D +V  E++  ++ YQ+INH+PGM EICRKD LARNM++M+K   +EY+  PK+W  PA+Y +LQ Y     R++K KT+I+KP  G  G GIW+ +N +++   E+ + Q YL KPFL++G+KFDLRIY+LVTSCDPLR+F Y DGLVR  T KY  P+  N+  +YMHLTNYS+ KH++NF +D+  + G+KR I+   ++     Y++ K W D+ ++++KTLI A   + H YR C P    G  S CFE+LGFD+I D KLKP L+E+N +PSF TD K+D ++K+  + + L+L+N  A+DKKR + ++K + + RL+                 Q+   +  ++E+ +++A+  +   +E++E  HLGN+RRIYP       +K+ S   + +Q   A +A S
Sbjct:   45 VAGTKYEIVRIVINEMDFIKARDDDETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMSKMIKCQPQEYSFIPKTWIFPAEYTQLQNYVKELRRKRKQKTFIVKPSNGAMGHGIWLIRNCEKLPAQEHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHAPSEANLSQLYMHLTNYSVNKHNENFERDETVDKGSKRSISWFTQFLRCNDYDVAKFWGDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDHKLKPWLLEINRAPSFATDQKIDYDVKKGALLNALKLLNIRASDKKRNLAQQKAEAQRRLYGHGSMKKLPAASSDWEKQRHTLERRREELKEQLAQVRKQFSREQHEKQHLGNYRRIYPPDDKLLLEKYESLLSAAFQTFLAGRAAS 487          
BLAST of Tubulin polyglutamylase ttll6 vs. Planmine SMEST
Match: SMESG000075764.1 (SMESG000075764.1)

HSP 1 Score: 1628.99 bits (4217), Expect = 0.000e+0
Identity = 878/880 (99.77%), Postives = 880/880 (100.00%), Query Frame = 2
Query:  197 INGEDDCDSKSKTNEDSLIYEKDSGNKNEHSLNSFKLQDNVSSFLTNEPSGDTXXXXXXXXLYTICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECAXXXXXXXXXXXXXFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALHNTGGTMAYQHTSNATQPIIPQINNLSQFGKGNASNVEPLSQWDSSNSKFNLNGERGRQQVSQSNYSTLXXXXXXXXXXXXXXXGFQNKDLPETLVQNSVERSKNINSLNSLIQRFTPPMNIQNPRMMYRMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILKFQSSHHPSHIQSMNQNFPDNLNTQMELQGLSVLTANNSISKKGEHNPISIQQLPFNQLAASGRNYSKKPSNVSKASSYQSNNNSLIKFSNDENILRTNLAQYKKQLSATEMKLKDVTLPTVS 2836
            INGEDDCDSKSKTNEDSLIYEKDSGNKNEHSLNSFKLQDNVSSFLTNEPSGDTKKKKRRKKL+TICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRM+KLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAADKKRIIDEEKRKIRERLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECARQQREEIKQKQEKFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALHNTGGTMAYQHTSNATQPIIPQINNLSQFGKGNASNVEPLSQWDSSNSKFNLNGERGRQQVSQSNYSTLKSRNVKSSHNNKVNNGFQNKDLPETLVQNSVERSKNINSLNSLIQRFTPPMNIQNPRMMYRMPSNPPTTNPNNGFFSFNGLSNYSSNSNGLFNILKFQSSHHPSHIQSMNQNFPDNLNTQMELQGLSVLTANNSISKKGEHNPISIQQLPFNQLAASGRNYSKKPSNVSKASSYQSNNNSLIKFSNDENILRTNLAQYKKQLSATEMKLKDVTLPTVS
Sbjct:   58 INGEDDCDSKSKTNEDSLIYEKDSGNKNEHSLNSFKLQDNVSSFLTNEPSGDTKKKKRRKKLFTICLSNCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMVKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAADKKRIIDEEKRKIRERLFQKQNRKDIKDEVDKEMAKFMEIQEKYEDGHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECARQQREEIKQKQEKFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRGYLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKALHNTGGTMAYQHTSNATQPIIPQINNLSQFGKGNASNVEPLSQWDSSNSKFNLNGERGRQQVSQSNYSTLKSRNVKSSHNNKVNNGFQNKDLPETLVQNSVERSKNINSLNSLIQRFTPPMNIQNPRMMYRMPSNPPTTNPNNGFFSFNGLSNYSSNSNGLFNILKFQSSHHPSHIQSMNQNFPDNLNTQMELQGLSVLTANNSISKKGEHNPISIQQLPFNQLAASGRNYSKKPSNVSKASSYQSNNNSLIKFSNDENILRTNLAQYKKQLSATEMKLKDVTLPTVS 937          
BLAST of Tubulin polyglutamylase ttll6 vs. Planmine SMEST
Match: SMESG000022747.1 (SMESG000022747.1)

HSP 1 Score: 294.664 bits (753), Expect = 2.778e-82
Identity = 166/406 (40.89%), Postives = 239/406 (58.87%), Query Frame = 2
Query:  401 NCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYAR-QKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFME-IQEKYEDGHLGN---FRRIYPGPGSS-KYDKFFSTN 1600
            N KY+ V +V+K+  F+ V E ++WN+ W D S+N  +   +K+ Q++NH+PGM EI RKD L RN+  M + F  +YNI P++W LPA+  ++  Y R Q   +T+I+KP    QGRGI + K+ K +    N +CQ Y++ PFLID FKFDLRIYVL+TSCDP R++ Y++GL RF T KY +PN  N++NIYMHLTNYS+Q++S  F + +E  GTKRR +T+  WF +  ++ + IW  + +III                             +LGFDVI D KLKP ++EVNHSPS  T++ +D  IK  L+ D   LVN    + K I D E+ +  ERL+  +N+     +   E  K ++ IQ       + N   FR +YP    + KY +FF  N
Sbjct:   89 NTKYDIVEKVAKQLLFKVVKENEEWNISWIDGSINSAKAFNLKRNQRVNHFPGMNEISRKDKLQRNLKIMQRYFPLDYNIFPRTWSLPAEKNDIINYIRDQNNDETFIIKPACSSQGRGIILIKDIKSLSFVGNTICQSYIANPFLIDNFKFDLRIYVLITSCDPFRIYIYEEGLARFATHKYEKPNKENLNNIYMHLTNYSVQRNSSKFDR-NEISGTKRRSSTIYEWFKEHEFDADAIW-KIFNIII-----------------------------LLGFDVILDDKLKPFVLEVNHSPSLETETNIDVLIKSQLLKDVFNLVNSVPTNIKNISDVERIRSAERLYWSRNKYMSSRKSSFEFRKILQDIQNDLAKNEMDNRNGFRLLYPVLNQTEKYQRFFEFN 463          
BLAST of Tubulin polyglutamylase ttll6 vs. Planmine SMEST
Match: SMESG000055128.1 (SMESG000055128.1)

HSP 1 Score: 263.462 bits (672), Expect = 1.882e-73
Identity = 158/431 (36.66%), Postives = 244/431 (56.61%), Query Frame = 2
Query:  386 TICLSNCKYESVRRVSKRFGFREVNEE--DDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYARQKKHKT----YILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQ--DDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRG--SACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAK---------------FMEIQ-----EKYEDGHLGNFRRIYPGPGSSKYDKF 1588
            T  ++  ++E V+++ +  GF   ++E      LIWTD  ++ ER+  +K YQ+INH+ GM+EI RKD L +  ++M KL  K+YN  PK+W  P +   L  Y ++ K  T    +ILKP  G  G GI +      IK +E  + Q Y+ KP L+DG+K D RIYVL+T CDPLR F Y++GLVR +T KY+  +   +D+I+ HLTNYS+ K + N+ +  D+  G  +   + +NR+      N + +W  + DI++KTLI     L HNYR C    ++   S  FEILGFD++ D  L P L+EVN SPSF  D  LD+++K +L+ DT +L+N   ++K++ +  +K+K + RL     R  I+  +D E  K                + +Q     E +E+ H+GNF R++P    + YD +
Sbjct:   68 TANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYKYIKETKKPTKKKYFILKPANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDESSGSKQSLSSLMNRFKTKFNINTDALWKQIIDIVVKTLILVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYY 498          
BLAST of Tubulin polyglutamylase ttll6 vs. Planmine SMEST
Match: SMESG000022747.1 (SMESG000022747.1)

HSP 1 Score: 267.7 bits (683), Expect = 2.319e-73
Identity = 156/406 (38.42%), Postives = 228/406 (56.16%), Query Frame = 2
Query:  401 NCKYESVRRVSKRFGFREVNEEDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFGKEYNIAPKSWCLPADYAELQAYAR-QKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAAXXXXXXXXXXXXXXXXLFQKQNRKDIKDEVDKEMAKFME-IQEKYEDGHLGN---FRRIYPGPGSS-KYDKFFSTN 1600
            N KY+ V +V+K+  F+ V E ++WN+ W D S+N  +   +K+ Q++NH+PGM EI RKD L RN+  M + F  +YNI P++W LPA+  ++  Y R Q   +T+I+KP    QGRGI + K+ K +    N +CQ Y++ PFLID FKFDLRIYVL+TSCDP R++ Y++GL RF T KY +PN  N++NIYMHLTNYS+Q++S  F + +E  GTKRR +T+  WF +  ++ + IW  + +III                                          P ++EVNHSPS  T++ +D  IK  L+ D   LVN    + K I D E+ +  ERL+  +N+     +   E  K ++ IQ       + N   FR +YP    + KY +FF  N
Sbjct:   89 NTKYDIVEKVAKQLLFKVVKENEEWNISWIDGSINSAKAFNLKRNQRVNHFPGMNEISRKDKLQRNLKIMQRYFPLDYNIFPRTWSLPAEKNDIINYIRDQNNDETFIIKPACSSQGRGIILIKDIKSLSFVGNTICQSYIANPFLIDNFKFDLRIYVLITSCDPFRIYIYEEGLARFATHKYEKPNKENLNNIYMHLTNYSVQRNSSKFDR-NEISGTKRRSSTIYEWFKEHEFDADAIW-KIFNIII------------------------------------------PFVLEVNHSPSLETETNIDVLIKSQLLKDVFNLVNSVPTNIKNISDVERIRSAERLYWSRNKYMSSRKSSFEFRKILQDIQNDLAKNEMDNRNGFRLLYPVLNQTEKYQRFFEFN 450          
BLAST of Tubulin polyglutamylase ttll6 vs. Planmine SMEST
Match: SMESG000040121.1 (SMESG000040121.1)

HSP 1 Score: 225.328 bits (573), Expect = 6.548e-60
Identity = 125/340 (36.76%), Postives = 196/340 (57.65%), Query Frame = 2
Query:  383 YTICLSNCKYESVRRVSKRFGFREVNE-EDDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFG-KEYNIAPKSWCLPADYAEL-QAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDD----EEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFA 1381
            Y I  ++CK   ++ +    GF E     +D+NL+WT   V    +  M ++QK+NH+P   E+ RKD L +N+ +M +L G K ++  P S+ +P+++ EL Q ++++K   TYI+KP A  +GRGI+++ +P +I   E ++   Y+S P+LI+  KFD+R+YVLVTS DPL  + Y++GL RF T KY      N+    MHLTNYS+ K ++ F+ +D    E+ G K  +  L R+   K  +   +   ++DII+K+LIS    +    R         S CFE+ G+D+I D  L+P L+EVN SPS   DS LD +IK  ++ D   L+   
Sbjct:  129 YKIYKTDCKL--LKTILNSHGFLECQSYSNDYNLLWTGGHVKPFTLRTMSEHQKVNHFPRSYELTRKDRLFKNIQKMQQLKGLKHFDFVPPSYLIPSEFQELCQNFSKEKN--TYIIKPIALSRGRGIFLSNHPGQIPLDEQLIASKYISNPYLINELKFDIRMYVLVTSYDPLVAYLYEEGLTRFATVKYQN-TPKNLKTQCMHLTNYSVNKKNNEFIHNDDADVEDFGNKWSLGALLRYLKSKNVDTTCLMMKIEDIIVKSLISVEAPISATSRMF---QTYRSNCFELYGYDIIIDENLRPWLLEVNLSPSLSCDSPLDFKIKSHMMSDMFSLIGIG 460          
The following BLAST results are available for this feature:
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL13P0.000e+055.02tubulin tyrosine ligase like 13, pseudogene [Sourc... [more]
TTLL13P0.000e+055.02tubulin tyrosine ligase like 13, pseudogene [Sourc... [more]
TTLL13P0.000e+055.02tubulin tyrosine ligase like 13, pseudogene [Sourc... [more]
TTLL63.308e-17057.28tubulin tyrosine ligase like 6 [Source:HGNC Symbol... [more]
TTLL74.689e-10339.24tubulin tyrosine ligase like 7 [Source:HGNC Symbol... [more]
back to top
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll-115.933e-5234.53Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-111.573e-5134.53Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-44.612e-5130.47Tubulin polyglutamylase ttll-4 [Source:UniProtKB/... [more]
ttll-44.612e-5130.47Tubulin polyglutamylase ttll-4 [Source:UniProtKB/... [more]
ttll-45.126e-5130.47Tubulin polyglutamylase ttll-4 [Source:UniProtKB/... [more]
back to top
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL6B1.939e-13942.18gene:FBgn0039501 transcript:FBtr0085180[more]
TTLL6A1.393e-11342.40gene:FBgn0034459 transcript:FBtr0300829[more]
TTLL51.793e-5936.59gene:FBgn0051108 transcript:FBtr0084802[more]
TTLL51.793e-5936.59gene:FBgn0051108 transcript:FBtr0339247[more]
TTLL4A4.191e-5333.33gene:FBgn0026147 transcript:FBtr0304950[more]
back to top
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll60.000e+055.45tubulin tyrosine ligase-like family, member 6 [Sou... [more]
ttll60.000e+055.45tubulin tyrosine ligase-like family, member 6 [Sou... [more]
ttll60.000e+054.95tubulin tyrosine ligase-like family, member 6 [Sou... [more]
ttll73.235e-10041.69tubulin tyrosine ligase-like family, member 7 [Sou... [more]
ttll72.257e-9641.69tubulin tyrosine ligase-like family, member 7 [Sou... [more]
back to top
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000044160.10.000e+054.90tubulin tyrosine ligase like 13, pseudogene [Sourc... [more]
trub21.135e-10841.42TruB pseudouridine (psi) synthase family member 2 ... [more]
trub23.791e-10741.51TruB pseudouridine (psi) synthase family member 2 ... [more]
trub28.189e-10641.42TruB pseudouridine (psi) synthase family member 2 ... [more]
trub21.990e-10541.15TruB pseudouridine (psi) synthase family member 2 ... [more]
back to top
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttll130.000e+054.95tubulin tyrosine ligase-like family, member 13 [So... [more]
Ttll130.000e+054.95tubulin tyrosine ligase-like family, member 13 [So... [more]
Ttll61.278e-17556.06tubulin tyrosine ligase-like family, member 6 [Sou... [more]
Ttll62.448e-15460.48tubulin tyrosine ligase-like family, member 6 [Sou... [more]
Ttll71.018e-9838.17tubulin tyrosine ligase-like family, member 7 [Sou... [more]
back to top
BLAST of Tubulin polyglutamylase ttll6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8CVX7|TTLL6_DANRE0.000e+055.45Tubulin polyglutamylase ttll6 OS=Danio rerio OX=79... [more]
sp|A4Q9F6|TTL13_MOUSE0.000e+054.95Tubulin polyglutamylase TTLL13 OS=Mus musculus OX=... [more]
sp|A6NNM8|TTL13_HUMAN0.000e+055.02Tubulin polyglutamylase TTLL13P OS=Homo sapiens OX... [more]
sp|A4Q9E8|TTLL6_MOUSE8.942e-17556.06Tubulin polyglutamylase TTLL6 OS=Mus musculus OX=1... [more]
sp|Q8N841|TTLL6_HUMAN3.194e-17057.28Tubulin polyglutamylase TTLL6 OS=Homo sapiens OX=9... [more]
back to top
BLAST of Tubulin polyglutamylase ttll6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J6P20.000e+063.54tubulin polyglutamylase TTLL13P-like OS=Lingula un... [more]
A0A2C9JJH70.000e+063.44Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9JJI90.000e+061.85Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9JJJ60.000e+061.85Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9JJI20.000e+061.85Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll60.000e+055.08tubulin tyrosine ligase like 6 [Source:NCBI gene;A... [more]
ttll71.754e-10741.29tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll73.466e-10741.29tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll76.437e-10741.29tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll71.013e-10641.29tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
back to top
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008895.11.520e-5634.46pep scaffold:Pmarinus_7.0:GL476825:58484:82827:1 g... [more]
ENSPMAT00000004193.11.182e-1542.11pep scaffold:Pmarinus_7.0:GL495833:1191:3921:-1 ge... [more]
TTLL101.042e-1224.90tubulin tyrosine ligase like 10 [Source:HGNC Symbo... [more]
ttll31.256e-1227.86tubulin tyrosine ligase-like family, member 3 [Sou... [more]
ttll31.657e-1227.86tubulin tyrosine ligase-like family, member 3 [Sou... [more]
back to top
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO343890.000e+064.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454103.460e-11143.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401466.980e-6537.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381452.735e-6433.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365104.639e-6440.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin polyglutamylase ttll6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll61.649e-17458.90tubulin tyrosine ligase like 6 [Source:NCBI gene;A... [more]
ttll62.318e-16755.17tubulin tyrosine ligase like 6 [Source:NCBI gene;A... [more]
ttll74.826e-10441.76tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll72.855e-10341.76tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll76.085e-10341.76tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
back to top
BLAST of Tubulin polyglutamylase ttll6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075764.10.000e+099.77SMESG000075764.1[more]
SMESG000022747.12.778e-8240.89SMESG000022747.1[more]
SMESG000055128.11.882e-7336.66SMESG000055128.1[more]
SMESG000022747.12.319e-7338.42SMESG000022747.1[more]
SMESG000040121.16.548e-6036.76SMESG000040121.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031141 ID=SMED30031141|Name=Tubulin polyglutamylase ttll6|organism=Schmidtea mediterranea sexual|type=transcript|length=3362bp
ATCTATATAAATCTTATATGTTCATATGTCAGATGTTAATATTTCTCTAA
ACAATGAAAGCGATGAGTATTCAGACAGTAGCTCTGATGAATCAGTTGAA
AATAATAATGTAGACAATTTTAATGAAAATCAAATTTTGTCCTTAGAAGA
CGATGAAAATCTTCTAGTTTTACCTCCAGAAGATCTTGATGATGAAATAA
ATGGTGAGGATGATTGTGATTCCAAATCCAAAACAAATGAAGACAGTTTA
ATTTACGAAAAGGATTCAGGCAATAAAAATGAACATAGTTTAAATTCCTT
TAAGCTTCAAGATAATGTTTCTTCATTTCTGACAAATGAACCGTCCGGTG
ATACTAAAAAGAAGAAACGACGCAAAAAACTTTATACGATTTGTCTTTCA
AATTGTAAATATGAATCAGTAAGACGAGTGTCCAAGCGATTTGGTTTCCG
AGAGGTAAATGAAGAAGACGATTGGAACTTAATCTGGACAGATTTTTCAG
TAAACATGGAACGCGTGAATGGAATGAAGAAATATCAAAAAATCAATCAT
TACCCAGGAATGTTAGAAATTTGTAGAAAAGATTCTCTAGCTCGAAATAT
GAATCGAATGCTGAAGTTATTTGGCAAAGAATATAATATTGCTCCAAAGT
CCTGGTGTCTTCCGGCCGATTATGCTGAGTTGCAAGCGTATGCCCGTCAA
AAGAAACACAAAACATACATCCTTAAACCGGATGCTGGTTGTCAAGGAAG
GGGAATATGGATCACCAAAAACCCCAAAGAAATCAAACCATCGGAAAACA
TGGTTTGTCAAGTCTATCTCAGTAAACCGTTTTTAATCGACGGATTCAAA
TTCGACTTGCGAATTTACGTTCTCGTTACGTCGTGTGATCCACTGAGAGT
GTTTGCATACAAAGACGGCTTGGTCCGATTTACGACAACAAAATATTCCG
AGCCGAATTTCAACAACGTCGACAATATTTATATGCACTTGACAAATTAT
TCATTGCAAAAACACAGCGATAATTTTGTTCAAGACGACGAAGAAGGCGG
CACAAAAAGGCGAATAACGACTTTAAATCGCTGGTTTCACGATAAAGGAT
ACAATATCGAAAAGATTTGGACTGATGTAGATGACATTATCATAAAAACT
CTAATCTCCGCTCATACCTTATTAAAACATAACTACCGGACATGTTTTCC
CAACCATGTTCGGGGTTCTGCGTGCTTTGAAATTCTTGGTTTCGATGTGA
TATTTGATCGGAAGTTAAAGCCATCCCTAGTCGAAGTCAACCATTCGCCA
AGCTTTCACACAGATTCCAAATTGGATAAAGAAATCAAAGAAGCTCTTAT
TTGGGATACATTGCAGCTGGTGAACTTTGCTGCAGCAGACAAAAAGCGAA
TTATCGACGAAGAAAAACGAAAAATCCGAGAAAGGTTATTCCAAAAACAG
AACAGAAAAGACATAAAAGACGAAGTTGATAAAGAAATGGCTAAATTTAT
GGAAATACAGGAAAAGTATGAAGATGGCCATTTGGGAAATTTCAGACGAA
TCTATCCAGGTCCCGGATCATCAAAATATGACAAATTCTTTTCAACAAAT
GTGTCGCTTTATCAGGAAACCGCTGCTTTCAAAGCCAGATCAGAATGTGC
CAGGCAGCAAAGAGAAGAAATTAAACAAAAACAGGAGAAATTTGATTCAA
TTTTGAAACGTAAAGATCGTAAAGATGTAAGACCTGAAAGTCCTGAAGAA
CGTCCAAAAAGGAAAGTTTTAAATTCTGTGTCAAATAAAACTCTGAAACA
GCCCGGTTATTTGCGTTCTAGAGGATATTTGGAGAAAAGCGAAAAATTTC
TATTCGATATGTCAAAGCCACAGGAAATAAACGACGATGAAGAAATCGAA
AGATTGAGTGGTCTGTTGCAACGAGATAATTTAATAAGAGCCCTCGGTAT
AGTGGAAATGGTGTACAAGGCATTGCATAATACCGGCGGAACAATGGCCT
ATCAGCACACGAGCAATGCAACTCAGCCTATAATTCCACAAATAAACAAT
TTATCTCAATTCGGCAAAGGAAATGCAAGTAACGTAGAGCCACTGTCCCA
GTGGGATTCATCCAATTCCAAGTTCAATTTGAATGGCGAAAGAGGTCGTC
AACAAGTATCACAGAGTAATTATTCGACTCTCAAATCACGAAATGTAAAA
AGCTCACACAATAACAAAGTAAATAACGGGTTTCAGAATAAAGATCTGCC
AGAGACGTTGGTTCAGAACTCAGTAGAGAGATCTAAAAATATTAACAGCC
TCAATAGTCTGATTCAAAGATTTACTCCGCCAATGAATATTCAAAATCCT
CGAATGATGTACCGAATGCCCTCGAACCCACCGACAACGAATCCGAATAA
TGGATTCTTTTCATTTAATGGTCTTTCAAATTATTCCTCGAATTCCAATG
GCCTTTTCAACATCCTAAAATTCCAATCTTCGCACCATCCGTCACACATC
CAATCTATGAATCAAAACTTTCCCGACAACCTCAACACGCAAATGGAATT
GCAGGGACTTTCAGTGTTGACGGCAAACAATTCTATCAGTAAAAAAGGTG
AACATAATCCAATCTCGATTCAACAGTTGCCATTCAATCAGTTGGCAGCA
TCCGGTAGAAATTACTCGAAGAAACCGTCAAATGTGTCAAAAGCGTCTTC
ATATCAGTCAAATAACAATTCCTTGATCAAATTCAGCAACGATGAAAACA
TTCTTCGAACGAATTTAGCGCAATATAAAAAGCAACTGTCGGCAACCGAA
ATGAAATTGAAAGACGTCACATTGCCAACTGTAAGTTGACCTACTGACTC
TAAGTTGATCTCTGTCAGTAAAAGTGGAAAAGTCAATCTCTCCATTATTT
AGCCTAGTTTTGTTGTTGAAAGTTGATTTTTTCGATTACTAAGTTAACTC
TATAAAGCATATCTTTCTGATATTTTCATTCTAGAGAGCTTCGGATTAGG
ATCCCAATAAAAGTCATTATGCGATTTGTAAATAAAAGTAATGTATTGGA
GAATTATTTTTTGTTTACTTACAGATTGACTAATATATTTAATTATAATA
ATTACTAATCGAATTATAAATAGATTATTTTTATTGTTTATTATTATTCG
AGTCAATATTGCTTTATGCATACATAATATATATTTTCTCTCGACATTCA
AATGCTTGCAGAAAGTGTTGTTGACAATTTTCAGATTTATCCGAATCCTC
AATGTGATTTATTTTGTCAGTCAATGCGAATATTTCTATGATTGAATCTT
GAAACGTTTTTTTGCCACTCCTTGATGCTGTTAATGAAAATAAAATTTAT
CTCGAAAAAAAA
back to top

protein sequence of SMED30031141-orf-1

>SMED30031141-orf-1 ID=SMED30031141-orf-1|Name=SMED30031141-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=938bp
MSDVNISLNNESDEYSDSSSDESVENNNVDNFNENQILSLEDDENLLVLP
PEDLDDEINGEDDCDSKSKTNEDSLIYEKDSGNKNEHSLNSFKLQDNVSS
FLTNEPSGDTKKKKRRKKLYTICLSNCKYESVRRVSKRFGFREVNEEDDW
NLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMLKLFG
KEYNIAPKSWCLPADYAELQAYARQKKHKTYILKPDAGCQGRGIWITKNP
KEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLV
RFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQDDEEGGTKRRITTL
NRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRGSAC
FEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVN
FAAADKKRIIDEEKRKIRERLFQKQNRKDIKDEVDKEMAKFMEIQEKYED
GHLGNFRRIYPGPGSSKYDKFFSTNVSLYQETAAFKARSECARQQREEIK
QKQEKFDSILKRKDRKDVRPESPEERPKRKVLNSVSNKTLKQPGYLRSRG
YLEKSEKFLFDMSKPQEINDDEEIERLSGLLQRDNLIRALGIVEMVYKAL
HNTGGTMAYQHTSNATQPIIPQINNLSQFGKGNASNVEPLSQWDSSNSKF
NLNGERGRQQVSQSNYSTLKSRNVKSSHNNKVNNGFQNKDLPETLVQNSV
ERSKNINSLNSLIQRFTPPMNIQNPRMMYRMPSNPPTTNPNNGFFSFNGL
SNYSSNSNGLFNILKFQSSHHPSHIQSMNQNFPDNLNTQMELQGLSVLTA
NNSISKKGEHNPISIQQLPFNQLAASGRNYSKKPSNVSKASSYQSNNNSL
IKFSNDENILRTNLAQYKKQLSATEMKLKDVTLPTVS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013815ATP_grasp_subdomain_1
IPR004344TTL/TTLL_fam
Vocabulary: biological process
TermDefinition
GO:0006464cellular protein modification process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 544..564
NoneNo IPR availableCOILSCoilCoilcoord: 479..499
NoneNo IPR availableGENE3DG3DSA:3.30.470.20coord: 183..428
e-value: 5.1E-80
score: 270.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 562..589
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 562..584
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..16
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 48..63
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..73
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 23..42
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 707..728
NoneNo IPR availablePANTHERPTHR12241TUBULIN TYROSINE LIGASE-RELATEDcoord: 64..656
NoneNo IPR availablePANTHERPTHR12241:SF91TUBULIN POLYGLUTAMYLASE TTLL13Pcoord: 64..656
NoneNo IPR availableSUPERFAMILYSSF56059Glutathione synthetase ATP-binding domain-likecoord: 203..449
IPR013815ATP-grasp fold, subdomain 1GENE3DG3DSA:3.30.1490.20coord: 210..269
e-value: 5.1E-80
score: 270.5
IPR004344Tubulin-tyrosine ligase/Tubulin polyglutamylasePFAMPF03133TTLcoord: 169..456
e-value: 4.1E-83
score: 278.9
IPR004344Tubulin-tyrosine ligase/Tubulin polyglutamylasePROSITEPS51221TTLcoord: 119..463
score: 50.054