Heterogeneous nuclear ribonucleoprotein A2

Overview
NameHeterogeneous nuclear ribonucleoprotein A2
Smed IDSMED30031138
Length (bp)1890
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heterogeneous nuclear ribonucleoprotein A2 (SMED30031138) t-SNE clustered cells

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein A2 (SMED30031138) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heterogeneous nuclear ribonucleoprotein A2 (SMED30031138) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein A2 (SMED30031138) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031138

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30031138h1SMcG0018179 dd_Smed_v4_3625_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031138h1SMcG0018179 dd_Smed_v4_3625_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031138h1SMcG0018179 dd_Smed_v4_3625_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30031138h1SMcG0018179 Contig2175GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30031138h1SMcG0018179 dd_Smed_v4_3625_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 167.933 bits (424), Expect = 4.155e-47
Identity = 78/179 (43.58%), Postives = 113/179 (63.13%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQ 562
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E+++
Sbjct:   17 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQE 195          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 168.318 bits (425), Expect = 2.673e-46
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:    5 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 184          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 168.318 bits (425), Expect = 2.673e-46
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:    5 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 184          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 168.703 bits (426), Expect = 2.873e-46
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:   17 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 196          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 168.703 bits (426), Expect = 2.873e-46
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:   17 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 196          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 154.066 bits (388), Expect = 1.912e-41
Identity = 70/174 (40.23%), Postives = 110/174 (63.22%), Query Frame = 2
Query:   35 FKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEEL 556
             +KIFVGGL   TT+  MR+++S++G++ D++ MRD T  +SRGFGFV F     VD    +RPH + GK VD KRA+P+++    + + ++KR+++ G+R   TE+ L +YF+ +G +    I  D  + + RGF F+TF D D VD+ +L K H +     DV+K LS +E+
Sbjct:   22 LRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEM 195          

HSP 2 Score: 69.3218 bits (168), Expect = 2.082e-12
Identity = 33/87 (37.93%), Postives = 55/87 (63.22%), Query Frame = 2
Query:  281 SLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKAL 541
            SL P+   N ++IF+GG+    T++ +++++S FGEI D  + RD  + +SRGF F+TF+ +  VD  +  +PH I    VD K+A+
Sbjct:   16 SLEPE---NLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAV 99          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 154.066 bits (388), Expect = 1.912e-41
Identity = 70/174 (40.23%), Postives = 110/174 (63.22%), Query Frame = 2
Query:   35 FKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEEL 556
             +KIFVGGL   TT+  MR+++S++G++ D++ MRD T  +SRGFGFV F     VD    +RPH + GK VD KRA+P+++    + + ++KR+++ G+R   TE+ L +YF+ +G +    I  D  + + RGF F+TF D D VD+ +L K H +     DV+K LS +E+
Sbjct:   22 LRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEM 195          

HSP 2 Score: 69.3218 bits (168), Expect = 2.082e-12
Identity = 33/87 (37.93%), Postives = 55/87 (63.22%), Query Frame = 2
Query:  281 SLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKAL 541
            SL P+   N ++IF+GG+    T++ +++++S FGEI D  + RD  + +SRGF F+TF+ +  VD  +  +PH I    VD K+A+
Sbjct:   16 SLEPE---NLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAV 99          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 154.066 bits (388), Expect = 1.957e-41
Identity = 70/174 (40.23%), Postives = 110/174 (63.22%), Query Frame = 2
Query:   35 FKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEEL 556
             +KIFVGGL   TT+  MR+++S++G++ D++ MRD T  +SRGFGFV F     VD    +RPH + GK VD KRA+P+++    + + ++KR+++ G+R   TE+ L +YF+ +G +    I  D  + + RGF F+TF D D VD+ +L K H +     DV+K LS +E+
Sbjct:   22 LRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEM 195          

HSP 2 Score: 69.3218 bits (168), Expect = 2.097e-12
Identity = 33/87 (37.93%), Postives = 55/87 (63.22%), Query Frame = 2
Query:  281 SLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKAL 541
            SL P+   N ++IF+GG+    T++ +++++S FGEI D  + RD  + +SRGF F+TF+ +  VD  +  +PH I    VD K+A+
Sbjct:   16 SLEPE---NLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAV 99          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 154.066 bits (388), Expect = 1.957e-41
Identity = 70/174 (40.23%), Postives = 110/174 (63.22%), Query Frame = 2
Query:   35 FKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEEL 556
             +KIFVGGL   TT+  MR+++S++G++ D++ MRD T  +SRGFGFV F     VD    +RPH + GK VD KRA+P+++    + + ++KR+++ G+R   TE+ L +YF+ +G +    I  D  + + RGF F+TF D D VD+ +L K H +     DV+K LS +E+
Sbjct:   22 LRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEM 195          

HSP 2 Score: 69.3218 bits (168), Expect = 2.097e-12
Identity = 33/87 (37.93%), Postives = 55/87 (63.22%), Query Frame = 2
Query:  281 SLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKAL 541
            SL P+   N ++IF+GG+    T++ +++++S FGEI D  + RD  + +SRGF F+TF+ +  VD  +  +PH I    VD K+A+
Sbjct:   16 SLEPE---NLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAV 99          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 136.346 bits (342), Expect = 1.727e-35
Identity = 61/157 (38.85%), Postives = 99/157 (63.06%), Query Frame = 2
Query:   86 MRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEEL 556
            MR+++S++G++ D++ MRD T  +SRGFGFV F     VD    +RPH + GK VD KRA+P+++    + + ++KR+++ G+R   TE+ L +YF+ +G +    I  D  + + RGF F+TF D D VD+ +L K H +     DV+K LS +E+
Sbjct:    1 MREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDEM 157          

HSP 2 Score: 65.855 bits (159), Expect = 2.025e-11
Identity = 31/81 (38.27%), Postives = 48/81 (59.26%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEE 280
            K+++V G+    TE  + +YF+KYG V     + DK   K RGFGFV F + DSVD+C  ++ H + G   D ++ + K+E
Sbjct:   76 KRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDE 156          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Rb97D (gene:FBgn0004903 transcript:FBtr0100336)

HSP 1 Score: 167.162 bits (422), Expect = 3.367e-45
Identity = 74/169 (43.79%), Postives = 113/169 (66.86%), Query Frame = 2
Query:   35 FKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKAL 541
             +K+F+GGL P TTE +++ ++ ++G V DVV MRD    +SRGFGF+ + ++  VDR Q  RPH + GK V+ KRA+P+ E  + + + + K++F+GG++    EE L++YF  FG +V   +  D  +G+ RGFAF+ F D D VDK IL K HAI++  VDVKK++
Sbjct:   31 LRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSI 199          

HSP 2 Score: 62.7734 bits (151), Expect = 4.694e-10
Identity = 35/94 (37.23%), Postives = 53/94 (56.38%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRA---MPKEESLNPDIHCNS 310
            KK+FVGGL     E  +R+YF ++G+V  V  + DKT  K RGF FV F + D+VD+   ++ H +    VD K++   + K+E   P    N+
Sbjct:  123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLANA 216          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Rb97D (gene:FBgn0004903 transcript:FBtr0100335)

HSP 1 Score: 167.162 bits (422), Expect = 3.367e-45
Identity = 74/169 (43.79%), Postives = 113/169 (66.86%), Query Frame = 2
Query:   35 FKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKAL 541
             +K+F+GGL P TTE +++ ++ ++G V DVV MRD    +SRGFGF+ + ++  VDR Q  RPH + GK V+ KRA+P+ E  + + + + K++F+GG++    EE L++YF  FG +V   +  D  +G+ RGFAF+ F D D VDK IL K HAI++  VDVKK++
Sbjct:   31 LRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSI 199          

HSP 2 Score: 62.7734 bits (151), Expect = 4.694e-10
Identity = 35/94 (37.23%), Postives = 53/94 (56.38%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRA---MPKEESLNPDIHCNS 310
            KK+FVGGL     E  +R+YF ++G+V  V  + DKT  K RGF FV F + D+VD+   ++ H +    VD K++   + K+E   P    N+
Sbjct:  123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLANA 216          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Rb97D (gene:FBgn0004903 transcript:FBtr0100338)

HSP 1 Score: 167.162 bits (422), Expect = 5.823e-45
Identity = 74/169 (43.79%), Postives = 113/169 (66.86%), Query Frame = 2
Query:   35 FKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKAL 541
             +K+F+GGL P TTE +++ ++ ++G V DVV MRD    +SRGFGF+ + ++  VDR Q  RPH + GK V+ KRA+P+ E  + + + + K++F+GG++    EE L++YF  FG +V   +  D  +G+ RGFAF+ F D D VDK IL K HAI++  VDVKK++
Sbjct:   31 LRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSI 199          

HSP 2 Score: 62.003 bits (149), Expect = 8.689e-10
Identity = 35/94 (37.23%), Postives = 53/94 (56.38%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRA---MPKEESLNPDIHCNS 310
            KK+FVGGL     E  +R+YF ++G+V  V  + DKT  K RGF FV F + D+VD+   ++ H +    VD K++   + K+E   P    N+
Sbjct:  123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLANA 216          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Rb97D (gene:FBgn0004903 transcript:FBtr0100334)

HSP 1 Score: 167.162 bits (422), Expect = 5.823e-45
Identity = 74/169 (43.79%), Postives = 113/169 (66.86%), Query Frame = 2
Query:   35 FKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKAL 541
             +K+F+GGL P TTE +++ ++ ++G V DVV MRD    +SRGFGF+ + ++  VDR Q  RPH + GK V+ KRA+P+ E  + + + + K++F+GG++    EE L++YF  FG +V   +  D  +G+ RGFAF+ F D D VDK IL K HAI++  VDVKK++
Sbjct:   31 LRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSI 199          

HSP 2 Score: 62.003 bits (149), Expect = 8.689e-10
Identity = 35/94 (37.23%), Postives = 53/94 (56.38%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRA---MPKEESLNPDIHCNS 310
            KK+FVGGL     E  +R+YF ++G+V  V  + DKT  K RGF FV F + D+VD+   ++ H +    VD K++   + K+E   P    N+
Sbjct:  123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLANA 216          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Match: Rb97D (gene:FBgn0004903 transcript:FBtr0085092)

HSP 1 Score: 167.162 bits (422), Expect = 5.823e-45
Identity = 74/169 (43.79%), Postives = 113/169 (66.86%), Query Frame = 2
Query:   35 FKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKAL 541
             +K+F+GGL P TTE +++ ++ ++G V DVV MRD    +SRGFGF+ + ++  VDR Q  RPH + GK V+ KRA+P+ E  + + + + K++F+GG++    EE L++YF  FG +V   +  D  +G+ RGFAF+ F D D VDK IL K HAI++  VDVKK++
Sbjct:   31 LRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSI 199          

HSP 2 Score: 62.003 bits (149), Expect = 8.689e-10
Identity = 35/94 (37.23%), Postives = 53/94 (56.38%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRA---MPKEESLNPDIHCNS 310
            KK+FVGGL     E  +R+YF ++G+V  V  + DKT  K RGF FV F + D+VD+   ++ H +    VD K++   + K+E   P    N+
Sbjct:  123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLANA 216          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1a [Source:ZFIN;Acc:ZDB-GENE-040426-1546])

HSP 1 Score: 155.992 bits (393), Expect = 1.427e-41
Identity = 72/178 (40.45%), Postives = 112/178 (62.92%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +K+F+GGL  +TT+  +R +F ++G + D V MRD    +SRGFGFV +     VD     RPH++ G+ V+ KRA+ +E+S  P  H   K++F+GGI+    EE L++YF  FG+I +  I  +  S + RGFAFITF D D VD++++ K H +     +V+KALS EE+ ++
Sbjct:   13 QLRKLFIGGLSFETTDESLRAHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYSSVGEVDAAMDARPHKVDGRAVEPKRAVSREDSSKPGAHSTVKKMFVGGIKEDTDEEHLREYFGQFGKIDEVNIMTEKNSDKRRGFAFITFDDHDAVDRIVIQKYHTVNGHNCEVRKALSREEMNRV 190          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:ZFIN;Acc:ZDB-GENE-060224-1])

HSP 1 Score: 150.599 bits (379), Expect = 3.629e-41
Identity = 69/176 (39.20%), Postives = 108/176 (61.36%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELR 559
            + +K+F+GGL  +TTE  +R +F ++G + D V MRD    +SRGFGFV +     VD     RPH++ G++V+ KRA+ +E+S  P  H   K+IF+GGI+    E  +++YF  +G+I    I  +  +G+ RGF F+TF D D VDK++  K H I     +V+KAL  +E++
Sbjct:   11 QLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQ 186          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:ZFIN;Acc:ZDB-GENE-060224-1])

HSP 1 Score: 150.599 bits (379), Expect = 2.431e-40
Identity = 69/176 (39.20%), Postives = 108/176 (61.36%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELR 559
            + +K+F+GGL  +TTE  +R +F ++G + D V MRD    +SRGFGFV +     VD     RPH++ G++V+ KRA+ +E+S  P  H   K+IF+GGI+    E  +++YF  +G+I    I  +  +G+ RGF F+TF D D VDK++  K H I     +V+KAL  +E++
Sbjct:   11 QLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQ 186          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:ZFIN;Acc:ZDB-GENE-060224-1])

HSP 1 Score: 150.984 bits (380), Expect = 3.813e-40
Identity = 69/176 (39.20%), Postives = 108/176 (61.36%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELR 559
            + +K+F+GGL  +TTE  +R +F ++G + D V MRD    +SRGFGFV +     VD     RPH++ G++V+ KRA+ +E+S  P  H   K+IF+GGI+    E  +++YF  +G+I    I  +  +G+ RGF F+TF D D VDK++  K H I     +V+KAL  +E++
Sbjct:   10 QLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQ 185          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Match: hnrnpa1b (heterogeneous nuclear ribonucleoprotein A1b [Source:ZFIN;Acc:ZDB-GENE-030912-14])

HSP 1 Score: 152.525 bits (384), Expect = 3.953e-40
Identity = 71/175 (40.57%), Postives = 111/175 (63.43%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEEL 556
            + +K+F+GGL  +TT+  +R +F ++G + D V M+D    +SRGFGFV +   D V+     RPH++ G++V+ KRA+ +E+S  P  H   K+IF+GGI+    E  L+DYF  FG+I    I  D+ +G  RGFAF+TF D D VD++++ K H +     +V+KALS +E+
Sbjct:   12 QLRKLFIGGLSFETTDDSLRAHFEQWGTLTDCVVMKDPNTKRSRGFGFVTYSSVDEVNASMDARPHKVDGRLVEPKRAVSREDSSKPFAHTTVKKIFVGGIKDDTEENHLRDYFDQFGKIEVVEIMVDHKTGNKRGFAFVTFDDHDSVDRIVIQKYHTVNGHNCEVRKALSKQEM 186          

HSP 2 Score: 68.5514 bits (166), Expect = 8.069e-12
Identity = 38/85 (44.71%), Postives = 53/85 (62.35%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRD-KTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLN 289
            KKIFVGG+   T E+ +R YF ++G +  V  M D KTGNK RGF FV F + DSVDR   ++ H + G   + ++A+ K+E  N
Sbjct:  105 KKIFVGGIKDDTEENHLRDYFDQFGKIEVVEIMVDHKTGNK-RGFAFVTFDDHDSVDRIVIQKYHTVNGHNCEVRKALSKQEMAN 188          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 169.474 bits (428), Expect = 8.499e-47
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F   D VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L++YF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++ +
Sbjct:    5 KEQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDV 184          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 169.474 bits (428), Expect = 8.767e-47
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F   D VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L++YF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++ +
Sbjct:    5 KEQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDV 184          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 169.859 bits (429), Expect = 9.347e-47
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F   D VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L++YF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++ +
Sbjct:    5 KEQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDV 184          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 169.474 bits (428), Expect = 1.132e-46
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F   D VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L++YF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++ +
Sbjct:    5 KEQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDV 184          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Match: psd3 (pleckstrin and Sec7 domain containing 3 [Source:Xenbase;Acc:XB-GENE-6467528])

HSP 1 Score: 163.696 bits (413), Expect = 1.274e-44
Identity = 73/175 (41.71%), Postives = 114/175 (65.14%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEEL 556
            + +K+F+GGL  +TT+  +R++F ++G + D V MRD    +SRGFGFV +   D VD   + RPH++ G++V+ KRA+ +E+S  P  H   K+IF+GGI+    E  L++YF  +G+I    I  D  SG+ RGFAF+TF D D VDK+++ K H + +   +V+KALS +E+
Sbjct:    9 QLRKLFIGGLSFETTDESLREHFEQWGTLTDCVVMRDPNSKRSRGFGFVTYSSTDEVDAAMSARPHKVDGRVVEPKRAVSREDSSRPGAHLTVKKIFVGGIKEDTEEHHLREYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFEDHDSVDKIVIQKYHTVNNHNCEVRKALSKQEM 183          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 168.703 bits (426), Expect = 4.983e-47
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:    5 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 184          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 168.703 bits (426), Expect = 4.983e-47
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:    5 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 184          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 168.703 bits (426), Expect = 4.983e-47
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:    5 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 184          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 168.318 bits (425), Expect = 1.835e-46
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:    5 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 184          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 168.318 bits (425), Expect = 1.835e-46
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:    5 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 184          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|Q9TTV2|ROA2_SAGOE (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus OX=9490 GN=HNRNPA2B1 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.089e-46
Identity = 79/180 (43.89%), Postives = 115/180 (63.89%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  QTTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF+ +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:    5 KEQFRKLFIGGLSFQTTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFAEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 184          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|Q5RBU8|ROA2_PONAB (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii OX=9601 GN=HNRNPA2B1 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 9.681e-46
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:   17 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKHHTINGHNAEVRKALSRQEMQEV 196          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|Q2HJ60|ROA2_BOVIN (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Bos taurus OX=9913 GN=HNRNPA2B1 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 1.284e-45
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:    5 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 184          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|O88569|ROA2_MOUSE (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus OX=10090 GN=Hnrnpa2b1 PE=1 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 1.380e-45
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:   17 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 196          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Match: sp|P22626|ROA2_HUMAN (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 1.380e-45
Identity = 78/180 (43.33%), Postives = 114/180 (63.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +F+K+F+GGL  +TTE  +R Y+ ++G + D V MRD    +SRGFGFV F     VD   A RPH + G++V+ KRA+ +EES  P  H   K++F+GGI+    E  L+DYF  +G+I    I  D  SG+ RGF F+TF D D VDK++L K H I     +V+KALS +E++++
Sbjct:   17 KEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEV 196          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: A4V6N1 (HnRNP A2/B1 protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 334/377 (88.59%), Postives = 359/377 (95.23%), Query Frame = 2
Query:   20 MTQNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQLDXXXXXXXXXXXXXXXXXXX-XDCQRIYKHSQDQEEDPKLKDKN-KVTKRSQSYPPTEYPNYVGYYMVPPDLNGINPSATYPYDHQMPLIWMSVQQCANGYILTPVTPDIYSAANYQSYFYHSPPLSAPGYIYSPAIFNDVHSTQPVENGDKSDSSLNVSELKKVLPDETNNHSNSIDDYASEETAFGSPNSESL 1144
            MTQNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEA+SVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTE+DLKDYFS FGEIVDCTIKRDNVSG SRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQLDENHS TNN +NNNNN+  E +DCQRIYK +Q+Q+E+ KLK+KN KVTKRSQSYPPTE+PNY+GYYMVPP++NGI+PS TYPY+HQMPLIWMSVQQCANGYILTPVTPDIYS ANY SYFYHSPP+SAPG+IYSPA+F+DVH    VENGDK++ +L+VSELKKVLP+ETNNHSNSIDDYASEETAFGSPNSESL
Sbjct:   12 MTQNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEAESVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEDDLKDYFSTFGEIVDCTIKRDNVSGLSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQLDENHSTTNNNNNNNNNNISEFDDCQRIYKQNQEQDEETKLKEKNKKVTKRSQSYPPTEFPNYMGYYMVPPEMNGISPSPTYPYEHQMPLIWMSVQQCANGYILTPVTPDIYS-ANYPSYFYHSPPMSAPGFIYSPAVFSDVHHAT-VENGDKNNDNLSVSELKKVLPEETNNHSNSIDDYASEETAFGSPNSESL 386          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: A0A504ZBE2 (Heterogeneous nuclear ribonucleoprotein A2 OS=Fasciola gigantica OX=46835 GN=FGIG_07442 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 2.739e-59
Identity = 97/176 (55.11%), Postives = 131/176 (74.43%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            KK+FVGGL P+T E  +R Y+S++G++ DVV M+D   NKSRGFGFV FKEA SVD+ QA+RPH++ GK VD+KRAMP+EE+ +P++H   K+IF+GG+++  T EDL +YF  +G + D TI     +  SRGFAF+TF D D VDKVIL++PH I     DV+KALS EELR++
Sbjct:   13 KKLFVGGLNPKTNEDSLRAYYSQWGEITDVVVMKDPRSNKSRGFGFVTFKEASSVDKAQADRPHKVDGKDVDSKRAMPREET-SPEVHAAVKKIFVGGLKKDVTNEDLAEYFGKYGNVTDATIVVAKDTNTSRGFAFVTFDDTDSVDKVILARPHMIGGHKADVRKALSREELRKV 187          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: A0A2H1BZ67 (Heterogeneous nuclear ribonucleoprotein A2 OS=Fasciola hepatica OX=6192 GN=D915_009015 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 2.739e-59
Identity = 97/176 (55.11%), Postives = 131/176 (74.43%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            KK+FVGGL P+T E  +R Y+S++G++ DVV M+D   NKSRGFGFV FKEA SVD+ QA+RPH++ GK VD+KRAMP+EE+ +P++H   K+IF+GG+++  T EDL +YF  +G + D TI     +  SRGFAF+TF D D VDKVIL++PH I     DV+KALS EELR++
Sbjct:   13 KKLFVGGLNPKTNEDSLRAYYSQWGEITDVVVMKDPRSNKSRGFGFVTFKEASSVDKAQADRPHKVDGKDVDSKRAMPREET-SPEVHAAVKKIFVGGLKKDVTNEDLAEYFGKYGNVTDATIVVAKDTNTSRGFAFVTFDDTDSVDKVILARPHMIGGHKADVRKALSREELRKV 187          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: A0A183AL00 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS7634 PE=4 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 5.825e-59
Identity = 97/176 (55.11%), Postives = 131/176 (74.43%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            KK+FVGGL P+T E  +R Y+S++G++ DVV M+D   NKSRGFGFV FKEA SVD+ QA+RPH++ GK VD+KRAMP+EE+ +P++H   K+IF+GG+++  T EDL +YF  FG + D +I     +  SRGFAF+TF D D VDKVIL++PH I     DV+KALS EELR++
Sbjct:   13 KKLFVGGLNPKTNEDSLRAYYSQWGEITDVVVMKDPRSNKSRGFGFVTFKEASSVDKAQADRPHKVDGKDVDSKRAMPREET-SPEVHAAVKKIFVGGLKKDVTNEDLAEYFGKFGNVTDASIVIAKDTNTSRGFAFVTFDDTDSVDKVILARPHMIGGHKADVRKALSREELRKV 187          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Match: Q66IT0 (MGC84815 protein OS=Xenopus laevis OX=8355 GN=MGC84815 PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 6.604e-59
Identity = 97/176 (55.11%), Postives = 131/176 (74.43%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            KK+FVGGL P+T E  +R Y+S++G++ DVV M+D   NKSRGFGFV FKEA SVD+ QA+RPH++ GK VD+KRAMP+EE+ +P++H   K+IF+GG+++  T EDL +YF  FG + D +I     +  SRGFAF+TF D D VDKVIL++PH I     DV+KALS EELR++
Sbjct:   13 KKLFVGGLNPKTNEDSLRAYYSQWGEITDVVVMKDPRSNKSRGFGFVTFKEASSVDKAQADRPHKVDGKDVDSKRAMPREET-SPEVHAAVKKIFVGGLKKDVTNEDLAEYFGKFGNVTDASIVVAKDTNTSRGFAFVTFDDTDSVDKVILARPHMIGGHKADVRKALSREELRKV 187          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1-like [Source:NCBI gene;Acc:103021383])

HSP 1 Score: 160.229 bits (404), Expect = 2.657e-43
Identity = 74/176 (42.05%), Postives = 112/176 (63.64%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELR 559
            + +K+F+GGL  +TT+  +R YF ++G + D V M+D    +SRGFGFV +   + VD     RPH++ G++V+ KRA+ +E+S  P  H   K+IF+GGI+    E  L+DYF  FG I    I  D  SG+ RGFAF+TF+D D VD++++ K H I     +V+KALS +E++
Sbjct:   12 QLRKLFIGGLSFETTDDSLRAYFEQWGTLTDCVVMKDPNSKRSRGFGFVTYANVEEVDAAMNARPHKVDGRLVEPKRAVSREDSNKPFAHMTVKKIFVGGIKEDTEESHLRDYFDQFGRIEAIEIMVDRGSGKKRGFAFVTFSDHDSVDRIVIQKYHTINGHNSEVRKALSRQEMQ 187          

HSP 2 Score: 71.2478 bits (173), Expect = 7.330e-13
Identity = 33/87 (37.93%), Postives = 51/87 (58.62%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDI 298
            KKIFVGG+   T ES +R YF ++G +  +  M D+   K RGF FV F + DSVDR   ++ H + G   + ++A+ ++E  N  +
Sbjct:  105 KKIFVGGIKEDTEESHLRDYFDQFGRIEAIEIMVDRGSGKKRGFAFVTFSDHDSVDRIVIQKYHTINGHNSEVRKALSRQEMQNSSM 191          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1-like [Source:NCBI gene;Acc:103021383])

HSP 1 Score: 160.229 bits (404), Expect = 2.657e-43
Identity = 74/176 (42.05%), Postives = 112/176 (63.64%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELR 559
            + +K+F+GGL  +TT+  +R YF ++G + D V M+D    +SRGFGFV +   + VD     RPH++ G++V+ KRA+ +E+S  P  H   K+IF+GGI+    E  L+DYF  FG I    I  D  SG+ RGFAF+TF+D D VD++++ K H I     +V+KALS +E++
Sbjct:   12 QLRKLFIGGLSFETTDDSLRAYFEQWGTLTDCVVMKDPNSKRSRGFGFVTYANVEEVDAAMNARPHKVDGRLVEPKRAVSREDSNKPFAHMTVKKIFVGGIKEDTEESHLRDYFDQFGRIEAIEIMVDRGSGKKRGFAFVTFSDHDSVDRIVIQKYHTINGHNSEVRKALSRQEMQ 187          

HSP 2 Score: 71.2478 bits (173), Expect = 7.330e-13
Identity = 33/87 (37.93%), Postives = 51/87 (58.62%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDI 298
            KKIFVGG+   T ES +R YF ++G +  +  M D+   K RGF FV F + DSVDR   ++ H + G   + ++A+ ++E  N  +
Sbjct:  105 KKIFVGGIKEDTEESHLRDYFDQFGRIEAIEIMVDRGSGKKRGFAFVTFSDHDSVDRIVIQKYHTINGHNSEVRKALSRQEMQNSSM 191          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:NCBI gene;Acc:103035058])

HSP 1 Score: 150.599 bits (379), Expect = 5.124e-40
Identity = 70/176 (39.77%), Postives = 109/176 (61.93%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELR 559
            + +K+F+GGL  +TTE  +R +F ++G + D V MRD    +SRGFGFV +     VD     RPH++ G+IV+ KRA+ +E+S  P  H   K+IF+GGI+    E  +++YF ++G+I    I  +  +G+ RGF F+TF D D VDK++  K H I     +V+KAL  +E++
Sbjct:   11 QLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPGNKRSRGFGFVTYSCVSEVDAAMGARPHKVDGRIVEPKRAVSREDSNRPGAHLTVKKIFVGGIKEDTEEYHIREYFEHYGKIESIDIMEERPTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQ 186          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: msi2a (RNA-binding protein Musashi homolog 2-like [Source:NCBI gene;Acc:103045937])

HSP 1 Score: 139.043 bits (349), Expect = 4.201e-36
Identity = 72/178 (40.45%), Postives = 109/178 (61.24%), Query Frame = 2
Query:   23 TQNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEEL 556
            TQ+   K+F+GGL  QT+   +R YFSK+G++ + + MRD T  +SRGFGFV F +A SVD+  A+  H+L  K +D K A P+     P +   +K+IF+GG+      ED+K YF  FG++ D  +  D  + + RGF F+TF + D+V+KV     H I + +V+ KKA  P+E+
Sbjct:   16 TQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRRA--QPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKA-QPKEV 190          

HSP 2 Score: 78.5666 bits (192), Expect = 2.197e-15
Identity = 39/94 (41.49%), Postives = 56/94 (59.57%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRI 319
            KKIFVGGL   T   D++QYF ++G V D + M DKT N+ RGFGFV F+  D V++      H++  K+V+ K+A PKE    P     ++ +
Sbjct:  110 KKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Match: msi2a (RNA-binding protein Musashi homolog 2-like [Source:NCBI gene;Acc:103045937])

HSP 1 Score: 139.428 bits (350), Expect = 1.008e-35
Identity = 72/178 (40.45%), Postives = 109/178 (61.24%), Query Frame = 2
Query:   23 TQNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEEL 556
            TQ+   K+F+GGL  QT+   +R YFSK+G++ + + MRD T  +SRGFGFV F +A SVD+  A+  H+L  K +D K A P+     P +   +K+IF+GG+      ED+K YF  FG++ D  +  D  + + RGF F+TF + D+V+KV     H I + +V+ KKA  P+E+
Sbjct:   16 TQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRRA--QPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKA-QPKEV 190          

HSP 2 Score: 78.1814 bits (191), Expect = 4.310e-15
Identity = 39/94 (41.49%), Postives = 56/94 (59.57%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRI 319
            KKIFVGGL   T   D++QYF ++G V D + M DKT N+ RGFGFV F+  D V++      H++  K+V+ K+A PKE    P     ++ +
Sbjct:  110 KKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004893.1 (pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:ENSPMAG00000004449.1 transcript:ENSPMAT00000004893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.392 bits (420), Expect = 9.299e-48
Identity = 77/176 (43.75%), Postives = 115/176 (65.34%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELR 559
            +F+K+FVGGL  +TTE  +RQYF ++G + D V M+D    +SRGFGFV F     VD   + RPH++ G++V+ KRA+ +E+S+ P  H + K+IF+GGI+    EE L+DYF  +G I    +  +  SG+ RGFAF+TF D D VDK+++ K H I     +++KAL  +EL+
Sbjct:    9 QFRKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAVSREDSMRPGAHLSVKKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPKQELQ 184          

HSP 2 Score: 69.707 bits (169), Expect = 1.121e-13
Identity = 34/84 (40.48%), Postives = 49/84 (58.33%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLN 289
            KKIFVGG+   T E  +R YF KYG +  V  M ++   K RGF FV F + D VD+   ++ H + G   + ++A+PK+E  N
Sbjct:  102 KKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPKQELQN 185          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 169.859 bits (429), Expect = 1.514e-47
Identity = 78/176 (44.32%), Postives = 114/176 (64.77%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            +K+F+GGL  +TTE  M+++F ++G + D V MRD    +SRGFGFV +  A+ VD     RPH L G++V+ KRA+ +E+SL P  H   K+IF+GGI+    E+ L+DYFS +G +    +  D  SG+ RGF F+TF+D D VDKV++ K H I     +V+KALS +E+  L
Sbjct:   33 RKLFIGGLSFETTEESMQKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYMSAEEVDAAMEVRPHHLDGRVVEAKRAISREDSLKPGAHLKVKKIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTINGHKAEVRKALSKQEMNSL 208          

HSP 2 Score: 76.6406 bits (187), Expect = 2.607e-15
Identity = 41/102 (40.20%), Postives = 57/102 (55.88%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEE--SLNPDIHCNSKRIFIGG 331
            K KKIFVGG+   T E  +R YFS+YG V  V  M D+   K RGFGFV F + D+VD+   ++ H + G   + ++A+ K+E  SL  D       +F  G
Sbjct:  122 KVKKIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTINGHKAEVRKALSKQEMNSLGGDPRQGENSVFSKG 223          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 161.77 bits (408), Expect = 2.506e-46
Identity = 75/173 (43.35%), Postives = 111/173 (64.16%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEEL 556
            +K+F+GGL  +TTE  MR++F ++G + D V MRD    +SRGFGFV +   + VD     RPH L  ++V+ KRA+ +E+SL P  H   K+IF+GGIR    E+ L++YF  +G++    +  D  +G+ RGF F+TF+D D VDKVI+ K H I     +V+KALS +E+
Sbjct:    9 RKLFIGGLSFETTEDSMRKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYTCPEEVDAAMDARPHHLDNRVVEAKRAISREDSLKPGAHLKVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTINGHKAEVRKALSKQEM 181          

HSP 2 Score: 75.8702 bits (185), Expect = 6.721e-16
Identity = 35/83 (42.17%), Postives = 51/83 (61.45%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEE 280
            K KKIFVGG+   T E  +R+YF  YGDV     M D++  K RGFGFV F + D+VD+   ++ H + G   + ++A+ K+E
Sbjct:   98 KVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTINGHKAEVRKALSKQE 180          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 152.14 bits (383), Expect = 2.492e-42
Identity = 69/178 (38.76%), Postives = 113/178 (63.48%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +K+F+GGL  +TTE  +R+Y+ ++G + D V M+D +  +SRGFGF+ +   + V+     RPH + G++V+ KRA+P+++S  P I    K++F+GGI+    E  L+DYFS FG +    +  D  +G+ RGFAF+TF D D VD+++  K H I    ++V+KALS  E+  +
Sbjct:   12 QMRKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRDDS-RPGIQVTVKKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQIVFQKFHTINCHKLEVRKALSRHEMETM 188          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Match: TARDBP (TAR DNA binding protein [Source:HGNC Symbol;Acc:HGNC:11571])

HSP 1 Score: 85.8853 bits (211), Expect = 2.174e-19
Identity = 55/145 (37.93%), Postives = 82/145 (56.55%), Query Frame = 2
Query:   44 IFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRD-KTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIV 475
            + V GLP + +E D+R YFS +G+V      RD KTGN S+GFGFV F++ ++  +  A+R H + G+  D K    KE+ +       S++IF+G      T +DL+ +FS FGE+ D  I +       R FAF+TF+D  I 
Sbjct:   27 LIVLGLPWKASEQDIRDYFSTFGEVLMAQVKRDIKTGN-SKGFGFVRFRDYETQLKVLAQR-HMIDGRWCDCKLPNSKEQQVGDAFR--SRKIFVGRCTEDITADDLRQFFSQFGEVTDVFIPK-----PFRAFAFVTFSDDQIA 162          

HSP 2 Score: 51.9878 bits (123), Expect = 7.619e-8
Identity = 28/69 (40.58%), Postives = 42/69 (60.87%), Query Frame = 2
Query:  347 TEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEE 553
            +E+D++DYFS FGE++   +KRD  +G S+GF F+ F D +   KV L++ H I     D K   S E+
Sbjct:   37 SEQDIRDYFSTFGEVLMAQVKRDIKTGNSKGFGFVRFRDYETQLKV-LAQRHMIDGRWCDCKLPNSKEQ 104          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 129.413 bits (324), Expect = 2.873e-32
Identity = 66/174 (37.93%), Postives = 106/174 (60.92%), Query Frame = 2
Query:   41 KIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQ 562
            K+F+GGL   TTE ++R+YF KYG V D+  M+D    +SRGFGF+ F++  SVD    +  H L GK++D KRA+P++E         + +IF+GGI      ++ +++FS +G I+D  +  D  +GQSRGF F+T+   D VD+V  +K    +   +++K+A  P  ++Q
Sbjct:  160 KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEV-VKTQHILDGKVIDPKRAIPRDE------QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRA-EPRHMQQ 325          

HSP 2 Score: 70.8626 bits (172), Expect = 2.441e-13
Identity = 33/94 (35.11%), Postives = 58/94 (61.70%), Query Frame = 2
Query:  272 KEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEE 553
            KEE    D+   S ++FIGG+    TE++L++YF  +G + D  I +D  +G+SRGF F++F     VD+V+ ++ H +   ++D K+A+  +E
Sbjct:  146 KEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ-HILDGKVIDPKRAIPRDE 238          

HSP 3 Score: 67.0106 bits (162), Expect = 4.186e-12
Identity = 32/83 (38.55%), Postives = 48/83 (57.83%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPK 274
            Q+K  KIFVGG+ P     +  ++FS++G + D   M DK   +SRGFGFV +  AD+VDR    +      + ++ KRA P+
Sbjct:  239 QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPR 321          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 61.2326 bits (147), Expect = 2.329e-10
Identity = 39/145 (26.90%), Postives = 71/145 (48.97%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEA-DSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRD 469
            + ++VG L    TE  ++QYF   G + ++  M DK  NK+  + FV + ++ D+    Q     Q+   IV    A   ++S + D       +F+G +     +E L++ F +F   +   +  D  +G SRG+ F++FT +D
Sbjct:   75 RVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKN-NKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTF----NLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQD 214          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 58.5362 bits (140), Expect = 2.036e-9
Identity = 44/179 (24.58%), Postives = 81/179 (45.25%), Query Frame = 2
Query:   23 TQNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVF-KEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKR----------------IFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAI 508
            T+  +  ++V  +  +TT+   ++ F+K+G +      +D  G K +GFGFV + K  D+V   +A    +L G+ +   RA  K E +    H   K+                +F+  +     +E L++ F+ +G I    + R   +G+S+GF F+ F+  +   K I  K   I
Sbjct:  214 TKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADG-KLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERM----HVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTE-NGKSKGFGFVCFSTPEEATKAITEKNQQI 386          

HSP 2 Score: 54.6842 bits (130), Expect = 2.630e-8
Identity = 38/151 (25.17%), Postives = 70/151 (46.36%), Query Frame = 2
Query:   44 IFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLL-GKIVDTKRAMPKEE--SLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVI 487
            IF+  L P      +   FS +GD+       D+ G KS+GFGFV F+E  +           LL G+ +     + ++E  S   +   +   +++  I    T+E  ++ F+ FG IV  ++++D   G+ +GF F+ +   +   K +
Sbjct:  128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENG-KSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKD-ADGKLKGFGFVNYEKHEDAVKAV 276          

HSP 3 Score: 51.6026 bits (122), Expect = 2.923e-7
Identity = 40/160 (25.00%), Postives = 71/160 (44.38%), Query Frame = 2
Query:   23 TQNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADS----VDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHC-NSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVI 487
             +N    ++VG L P  +E+ +   FS  G V  +   RD     S G+ +V F + ++    +++         L +I+ ++R        +P +    S  IFI  +      + L D FS FG+I+   I  D  +G+S+GF F+ F +     + I
Sbjct:   33 VENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQR--------DPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAI 183          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: SNP1 (Component of U1 snRNP required for mRNA splicing via spliceosome; substrate of the arginine methyltransferase Hmt1p; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001323])

HSP 1 Score: 50.8322 bits (120), Expect = 2.529e-7
Identity = 19/52 (36.54%), Postives = 36/52 (69.23%), Query Frame = 2
Query:   35 FKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKE 190
            ++ IF+G LP    E ++++YF K+G++  +  ++DK   KS+G+ F+VFK+
Sbjct:  106 YRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKD 157          

HSP 2 Score: 47.7506 bits (112), Expect = 2.672e-6
Identity = 34/114 (29.82%), Postives = 56/114 (49.12%), Query Frame = 2
Query:  236 LGKIVDTKRAMPKEESLNPDIHCNSK------RIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRH-------CIVDVKKA 538
            L KI + +    + ++ NP++  + K       IFIG +     E +L+ YF  FGEI    I +D ++ +S+G+AFI F D  I  K+   +    R        CIVD+++ 
Sbjct:   76 LSKIKNAQLLDRRLQNWNPNVDPHIKDTDPYRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKD-PISSKMAFKEIGVHRGIQIKDRICIVDIERG 188          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Match: IST3 (Component of the U2 snRNP; required for the first catalytic step of splicing and for spliceosomal assembly; interacts with Rds3p and is required for Mer1p-activated splicing; diploid mutants have a specific defect in MATa1 pre-mRNA splicing which leads to haploid gene expression in diploids [Source:SGD;Acc:S000001444])

HSP 1 Score: 47.3654 bits (111), Expect = 7.967e-7
Identity = 20/50 (40.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  317 IFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDR 466
            I+IG + R  TE D+   FS +G  VD  + RD  +G+S+GFA++ + D+
Sbjct:   33 IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQ 82          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO49349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG33])

HSP 1 Score: 130.568 bits (327), Expect = 3.685e-35
Identity = 70/173 (40.46%), Postives = 110/173 (63.58%), Query Frame = 2
Query:   41 KIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNF------GEIVDCTIKRDNVS-GQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKA 538
            KIF+GGL   TTE  ++ YFS++G + D V M  K   +SRGFGFV ++ +DSV+    ++ H L  + ++ KR++P++ES  P+    +++IF+GG+     EED+K+YF++       GE++D  +KRD  +  + RGFAF+TF + +IV+KV   K H IR    +VKKA
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIM--KRDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKA 171          

HSP 2 Score: 67.781 bits (164), Expect = 3.639e-13
Identity = 37/81 (45.68%), Postives = 53/81 (65.43%), Query Frame = 2
Query:  314 RIFIGGIRRFFTEEDLKDYFSNFGEIVDCTI-KRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEE 553
            +IFIGG+    TEE LKDYFS +G IVDC I KRD   G+SRGF F+T+   D V++V+  K H +    ++ K+++  +E
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMKRD---GRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDE 78          

HSP 3 Score: 54.6842 bits (130), Expect = 9.339e-9
Identity = 33/91 (36.26%), Postives = 50/91 (54.95%), Query Frame = 2
Query:   23 TQNKFKKIFVGGLPPQTTESDMRQYFSKY------GDVCDVVAMRDKTGNKS-RGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPK 274
              +K +KIFVGGL   T E D+++YF+        G+V DV   RD+   K  RGF FV F   + V++  A + H++  K  + K+A P+
Sbjct:   84 AMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 174          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO39879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S5])

HSP 1 Score: 129.413 bits (324), Expect = 1.044e-34
Identity = 69/172 (40.12%), Postives = 103/172 (59.88%), Query Frame = 2
Query:   41 KIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEEL 556
            K+F+GGL  QTT   +RQ+F K+G++ + V MRD    +SRGFGF+ FK+  +VD        +L GK +D K A+PK       +   +K+IFIGG+    +EED+K YFS FG+I +  +  D  + + RGF F+TF   +  DK   ++ H I +  V+VKKA  P+E+
Sbjct:    1 KMFIGGLSWQTTAEGLRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKIDPKLAVPKRAP--AKMVTTTKKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKA-QPKEV 169          

HSP 2 Score: 77.0258 bits (188), Expect = 2.709e-16
Identity = 35/80 (43.75%), Postives = 52/80 (65.00%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKE 277
            KKIF+GGL   T+E DM++YFS++G + + + M DK   + RGFGFV F+  +S D+    + H +  K V+ K+A PKE
Sbjct:   89 KKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKE 168          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO33389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE1])

HSP 1 Score: 116.701 bits (291), Expect = 1.856e-30
Identity = 60/159 (37.74%), Postives = 91/159 (57.23%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNP--DIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAI 508
            +KIFVGGL   T  + ++ YF KYG+V D V M D    +SR FGF+ F++   V     ++PHQL GK++D K A+P+     P      N  +IF+GG+    +++DL+DYF+ +G++V   +  D  + + RGF F+TF  +D V K      H I
Sbjct:    1 RKIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPRGPGQGPPQGNQNNEFKIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADEHYHQI 159          

HSP 2 Score: 67.781 bits (164), Expect = 2.524e-13
Identity = 36/75 (48.00%), Postives = 43/75 (57.33%), Query Frame = 2
Query:   26 QNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIV 250
            QN   KIFVGGL   T++ D+  YF+ YG V  V  M D    K RGFGFV F+  DSV +   E  HQ+ GK V
Sbjct:   90 QNNEFKIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADEHYHQINGKTV 164          

HSP 3 Score: 62.3882 bits (150), Expect = 1.708e-11
Identity = 29/77 (37.66%), Postives = 45/77 (58.44%), Query Frame = 2
Query:  311 KRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKAL 541
            ++IF+GG+        L+ YF  +GE+ DC +  D V+ +SR F FITF D  +V  V+  KPH +   ++D K A+
Sbjct:    1 RKIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAV 77          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO42151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2H6])

HSP 1 Score: 111.694 bits (278), Expect = 1.701e-28
Identity = 61/173 (35.26%), Postives = 107/173 (61.85%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAE-RPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIV-----DCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKA 538
            KK++VGGL  +TTE ++R++F +YG++ ++  +R   G KS+GF FV F ++DSVD        H L GK ++ KRA+P+ ++ NP  H  +K++F+GG++   TEED+K   +   E+V        + +D ++ + +G+AF+ F +  IVDK+ + +   +    V++KKA
Sbjct:   10 KKLYVGGLKEETTEENIREHFQQYGEITELNLVRTPEG-KSKGFCFVSFSDSDSVDNILFNFESHSLDGKKIEVKRAIPRGDT-NPLAHVRTKKLFVGGLKNEQTEEDIK---TALAEMVPFPPESIKLMKDKMTNKFKGYAFVNFNNEHIVDKLYIIRKAEVAGLPVELKKA 177          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Match: EDO33402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE0])

HSP 1 Score: 105.531 bits (262), Expect = 5.303e-27
Identity = 52/119 (43.70%), Postives = 72/119 (60.50%), Query Frame = 2
Query:   35 FKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEI 391
            F+KIFVGGL   TT+  + QYF  +G+V D V M D T  +SRGFGFV F++  +++   A++PH L GK +D K A             N  ++FIGG+    TEEDLK+YFS +G +
Sbjct:   13 FRKIFVGGLATSTTKEGLHQYFENFGEVTDCVLMTDPTTKRSRGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPARGS---------ANDGKVFIGGLAFGTTEEDLKEYFSTYGMV 122          

HSP 2 Score: 72.0182 bits (175), Expect = 2.886e-15
Identity = 31/76 (40.79%), Postives = 46/76 (60.53%), Query Frame = 2
Query:  311 KRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKA 538
            ++IF+GG+    T+E L  YF NFGE+ DC +  D  + +SRGF F+TF D   ++ V+  KPH +    +D K A
Sbjct:   14 RKIFVGGLATSTTKEGLHQYFENFGEVTDCVLMTDPTTKRSRGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPA 89          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: ENSORLT00000010040.2 (heterogeneous nuclear ribonucleoprotein A1 [Source:NCBI gene;Acc:101174914])

HSP 1 Score: 157.532 bits (397), Expect = 8.820e-43
Identity = 72/176 (40.91%), Postives = 112/176 (63.64%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELR 559
            + +K+F+GGL  +TT+  +R +F ++G + D V MRD    +SRGFGFV +     VD   + RPH++ G++V+ KRA+ +E+S  P  H   K+IF+GGI+    E  L+DYF  FG+I    I  D  +G+ RGFAF+TF D D VD++++ K H I     +V+KAL+ +E++
Sbjct:   11 QLRKLFIGGLSFETTDESLRAHFEQWGTLTDCVVMRDPNSKRSRGFGFVTYSSVQEVDAAMSARPHKVDGRVVEPKRAVSREDSNRPGAHITVKKIFVGGIKEDTEESHLRDYFQQFGKIEVIDIMTDRNTGKKRGFAFVTFDDHDSVDRIVIQKYHTINSHNCEVRKALTKQEMQ 186          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:NCBI gene;Acc:101164602])

HSP 1 Score: 150.599 bits (379), Expect = 4.564e-40
Identity = 70/178 (39.33%), Postives = 109/178 (61.24%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +K+F+GGL  +TTE  +R +F ++G + D V MRD    +SRGFGFV +     VD     RPH++ G++V+ KRA+ +E+S  P  H   K+IF+GGI+    E  +++YF  +G+I    I  +  +G+ RGF F+TF D D VDK++  K H I     +V+KALS +E+  +
Sbjct:   11 QLRKLFIGGLSFETTEESLRAHFEQWGSLTDCVVMRDPNSKRSRGFGFVTYSNVTEVDDAMKARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFEKYGKIECIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHIINFHNCEVRKALSKQEMNTI 188          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:NCBI gene;Acc:101164602])

HSP 1 Score: 150.599 bits (379), Expect = 4.968e-40
Identity = 70/178 (39.33%), Postives = 109/178 (61.24%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            + +K+F+GGL  +TTE  +R +F ++G + D V MRD    +SRGFGFV +     VD     RPH++ G++V+ KRA+ +E+S  P  H   K+IF+GGI+    E  +++YF  +G+I    I  +  +G+ RGF F+TF D D VDK++  K H I     +V+KALS +E+  +
Sbjct:   20 QLRKLFIGGLSFETTEESLRAHFEQWGSLTDCVVMRDPNSKRSRGFGFVTYSNVTEVDDAMKARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFEKYGKIECIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHIINFHNCEVRKALSKQEMNTI 197          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: msi2a (musashi RNA binding protein 2 [Source:NCBI gene;Acc:101163923])

HSP 1 Score: 138.658 bits (348), Expect = 3.353e-36
Identity = 73/178 (41.01%), Postives = 109/178 (61.24%), Query Frame = 2
Query:   23 TQNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEEL 556
            +Q+   K+F+GGL  QT+   +R YFSK+G++ + + MRD T  +SRGFGFV F +A SVD+  A++ H+L  K +D K A P+     P +   +K+IF+GG+      ED+K YF  FG++ D  +  D  + + RGF FITF   DIV+KV     H I + +V+ KKA  P+E+
Sbjct:   16 SQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQQHHELDSKTIDPKVAFPRRA--QPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKVCEIHFHEINNKMVECKKA-QPKEV 190          

HSP 2 Score: 77.7962 bits (190), Expect = 3.179e-15
Identity = 38/94 (40.43%), Postives = 56/94 (59.57%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRI 319
            KKIFVGGL   T   D++QYF ++G V D + M DKT N+ RGFGF+ F+  D V++      H++  K+V+ K+A PKE    P     ++ +
Sbjct:  110 KKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Match: msi2a (musashi RNA binding protein 2 [Source:NCBI gene;Acc:101163923])

HSP 1 Score: 138.658 bits (348), Expect = 5.498e-36
Identity = 73/178 (41.01%), Postives = 109/178 (61.24%), Query Frame = 2
Query:   23 TQNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEEL 556
            +Q+   K+F+GGL  QT+   +R YFSK+G++ + + MRD T  +SRGFGFV F +A SVD+  A++ H+L  K +D K A P+     P +   +K+IF+GG+      ED+K YF  FG++ D  +  D  + + RGF FITF   DIV+KV     H I + +V+ KKA  P+E+
Sbjct:   16 SQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQQHHELDSKTIDPKVAFPRRA--QPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKVCEIHFHEINNKMVECKKA-QPKEV 190          

HSP 2 Score: 77.411 bits (189), Expect = 4.552e-15
Identity = 38/94 (40.43%), Postives = 56/94 (59.57%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRI 319
            KKIFVGGL   T   D++QYF ++G V D + M DKT N+ RGFGF+ F+  D V++      H++  K+V+ K+A PKE    P     ++ +
Sbjct:  110 KKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGL 203          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000038668.1 (SMESG000038668.1)

HSP 1 Score: 685.641 bits (1768), Expect = 0.000e+0
Identity = 352/353 (99.72%), Postives = 353/353 (100.00%), Query Frame = 2
Query:   86 MRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQLDXXXXXXXXXXXXXXXXXXXXDCQRIYKHSQDQEEDPKLKDKNKVTKRSQSYPPTEYPNYVGYYMVPPDLNGINPSATYPYDHQMPLIWMSVQQCANGYILTPVTPDIYSAANYQSYFYHSPPLSAPGYIYSPAIFNDVHSTQPVENGDKSDSSLNVSELKKVLPDETNNHSNSIDDYASEETAFGSPNSESL 1144
            MRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTE+DLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQLDENHSNTNNVSNNNNNSEYENDCQRIYKHSQDQEEDPKLKDKNKVTKRSQSYPPTEYPNYVGYYMVPPDLNGINPSATYPYDHQMPLIWMSVQQCANGYILTPVTPDIYSAANYQSYFYHSPPLSAPGYIYSPAIFNDVHSTQPVENGDKSDSSLNVSELKKVLPDETNNHSNSIDDYASEETAFGSPNSESL
Sbjct:    1 MRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEDDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQLDENHSNTNNVSNNNNNSEYENDCQRIYKHSQDQEEDPKLKDKNKVTKRSQSYPPTEYPNYVGYYMVPPDLNGINPSATYPYDHQMPLIWMSVQQCANGYILTPVTPDIYSAANYQSYFYHSPPLSAPGYIYSPAIFNDVHSTQPVENGDKSDSSLNVSELKKVLPDETNNHSNSIDDYASEETAFGSPNSESL 353          

HSP 2 Score: 75.0998 bits (183), Expect = 2.420e-14
Identity = 33/81 (40.74%), Postives = 49/81 (60.49%), Query Frame = 2
Query:   38 KKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEE 280
            K+IF+GG+    TE D++ YFS +G++ D    RD    +SRGF F+ F + D VD+    +PH +   IVD K+A+  EE
Sbjct:   76 KRIFIGGIRRFFTEDDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEE 156          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000025890.1 (SMESG000025890.1)

HSP 1 Score: 189.889 bits (481), Expect = 9.128e-55
Identity = 85/178 (47.75%), Postives = 124/178 (69.66%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            +F+K+F+GGL PQT E  +R+Y+ ++G++ D V M+D    +SRGFGFV +++ + VD  Q  RPH++ GKIV+ KRAMP+E+S  P+ H    ++F+GG+++  T E L+ YF+++G I DC I     SG+SRGF F+TF D D VDK IL KPH I    VDVKKALS +E+ ++
Sbjct:   15 QFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDEMEEI 192          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000080165.1 (SMESG000080165.1)

HSP 1 Score: 187.963 bits (476), Expect = 1.126e-53
Identity = 81/178 (45.51%), Postives = 126/178 (70.79%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            +F+K+F+GGL P T+E  +R+Y+ ++G++ D V M+D    +SRGFGFV +KE   VD  Q  RPH++ GKIV+ KRAMP+E+S++P+ H    ++F+GG+++    ++L DYF+++G +++C I     +G+SRGF F+ F D D VDK IL KPH I+   +DVKKALS EE+ ++
Sbjct:   16 QFRKLFIGGLTPNTSEEKLRKYYQQWGELVDAVVMKDCNSGRSRGFGFVTYKEVFMVDEAQNNRPHEIDGKIVEAKRAMPREDSIHPEAHMTVTKLFVGGLKKEIVNQELVDYFTDYGIVIECEIVSWKDTGKSRGFGFVLFDDYDPVDKAILYKPHFIQSSKIDVKKALSKEEIFEI 193          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000050993.1 (SMESG000050993.1)

HSP 1 Score: 172.94 bits (437), Expect = 3.966e-49
Identity = 83/182 (45.60%), Postives = 122/182 (67.03%), Query Frame = 2
Query:   23 TQNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGN-KSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEELRQL 565
            +  +F+K+F+GGL   TTE  ++ +F ++G++ DVV MR    N KSRGFGFV +K+ D VD  QA RPH +  + V+TKRAMP++E+ + + H   K++F+G +++    +DL+DYF  FG I +C I     +G+SRGF F+T+ D D VDK++L KPH I +   +VKKALS EE R L
Sbjct:   10 SSEQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDDRTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSL 191          
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Match: SMESG000081075.1 (SMESG000081075.1)

HSP 1 Score: 172.555 bits (436), Expect = 2.398e-48
Identity = 78/170 (45.88%), Postives = 119/170 (70.00%), Query Frame = 2
Query:   32 KFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKAL 541
            + KK+F+GGL  +TTE  ++ ++S++G++ DVV MRD    KSRGFGFV + ++ SVD  Q+ RPH++ G  VD+KRAMPKE++ +P+ H    R+F+G ++R    +DL+ YF  +G I D  I  +N +G+SRGF F+TF D D VDK+I+++PH +    ++VKKAL
Sbjct:    8 RGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVII-NNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKAL 175          

HSP 2 Score: 79.7221 bits (195), Expect = 7.370e-16
Identity = 39/92 (42.39%), Postives = 56/92 (60.87%), Query Frame = 2
Query:   41 KIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKR 316
            ++FVG L       D+RQYF +YG + D V + +  G +SRGFGFV F + DSVD+    RPHQL G  ++ K+A+P++     D   NSK+
Sbjct:  101 RLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNG-ESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRD-----DNKSNSKQ 186          
The following BLAST results are available for this feature:
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPA2B14.155e-4743.58heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B12.673e-4643.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B12.673e-4643.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B12.873e-4643.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B12.873e-4643.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrp-11.912e-4140.23Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-11.912e-4140.23Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-11.957e-4140.23Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-11.957e-4140.23Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-11.727e-3538.85Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rb97D3.367e-4543.79gene:FBgn0004903 transcript:FBtr0100336[more]
Rb97D3.367e-4543.79gene:FBgn0004903 transcript:FBtr0100335[more]
Rb97D5.823e-4543.79gene:FBgn0004903 transcript:FBtr0100338[more]
Rb97D5.823e-4543.79gene:FBgn0004903 transcript:FBtr0100334[more]
Rb97D5.823e-4543.79gene:FBgn0004903 transcript:FBtr0085092[more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa1a1.427e-4140.45heterogeneous nuclear ribonucleoprotein A1a [Sourc... [more]
hnrnpa33.629e-4139.20heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa32.431e-4039.20heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa33.813e-4039.20heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa1b3.953e-4040.57heterogeneous nuclear ribonucleoprotein A1b [Sourc... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa2b18.499e-4743.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b18.767e-4743.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b19.347e-4743.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b11.132e-4643.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
psd31.274e-4441.71pleckstrin and Sec7 domain containing 3 [Source:Xe... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnrnpa2b14.983e-4743.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b14.983e-4743.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b14.983e-4743.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b11.835e-4643.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b11.835e-4643.33heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9TTV2|ROA2_SAGOE2.089e-4643.89Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
sp|Q5RBU8|ROA2_PONAB9.681e-4643.33Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
sp|Q2HJ60|ROA2_BOVIN1.284e-4543.33Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
sp|O88569|ROA2_MOUSE1.380e-4543.33Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
sp|P22626|ROA2_HUMAN1.380e-4543.33Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4V6N10.000e+088.59HnRNP A2/B1 protein (Fragment) OS=Dugesia japonica... [more]
A0A504ZBE22.739e-5955.11Heterogeneous nuclear ribonucleoprotein A2 OS=Fasc... [more]
A0A2H1BZ672.739e-5955.11Heterogeneous nuclear ribonucleoprotein A2 OS=Fasc... [more]
A0A183AL005.825e-5955.11Uncharacterized protein OS=Echinostoma caproni OX=... [more]
Q66IT06.604e-5955.11MGC84815 protein OS=Xenopus laevis OX=8355 GN=MGC8... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa1a2.657e-4342.05heterogeneous nuclear ribonucleoprotein A1-like [S... [more]
hnrnpa1a2.657e-4342.05heterogeneous nuclear ribonucleoprotein A1-like [S... [more]
hnrnpa35.124e-4039.77heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
msi2a4.201e-3640.45RNA-binding protein Musashi homolog 2-like [Source... [more]
msi2a1.008e-3540.45RNA-binding protein Musashi homolog 2-like [Source... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004893.19.299e-4843.75pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:... [more]
HNRNPA01.514e-4744.32heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA02.506e-4643.35heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA2B12.492e-4238.76heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
TARDBP2.174e-1937.93TAR DNA binding protein [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRP12.873e-3237.93Subunit of cleavage factor I; cleavage factor I is... [more]
PUB12.329e-1026.90Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
PAB12.036e-924.58Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
SNP12.529e-736.54Component of U1 snRNP required for mRNA splicing v... [more]
IST37.967e-740.00Component of the U2 snRNP; required for the first ... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493493.685e-3540.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398791.044e-3440.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333891.856e-3037.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421511.701e-2835.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334025.303e-2743.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000010040.28.820e-4340.91heterogeneous nuclear ribonucleoprotein A1 [Source... [more]
hnrnpa34.564e-4039.33heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa34.968e-4039.33heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
msi2a3.353e-3641.01musashi RNA binding protein 2 [Source:NCBI gene;Ac... [more]
msi2a5.498e-3641.01musashi RNA binding protein 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein A2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038668.12.420e-1499.72SMESG000038668.1[more]
SMESG000025890.19.128e-5547.75SMESG000025890.1[more]
SMESG000080165.11.126e-5345.51SMESG000080165.1[more]
SMESG000050993.13.966e-4945.60SMESG000050993.1[more]
SMESG000081075.12.398e-4845.88SMESG000081075.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031138 ID=SMED30031138|Name=Heterogeneous nuclear ribonucleoprotein A2|organism=Schmidtea mediterranea sexual|type=transcript|length=1890bp
ACGTTTTATATAAAATTGAATGACGCAAAACAAGTTCAAGAAAATTTTTG
TCGGTGGATTACCACCCCAGACTACAGAAAGTGATATGAGGCAGTATTTT
TCAAAATATGGAGATGTATGCGACGTTGTAGCAATGCGGGACAAAACTGG
AAACAAATCTCGAGGTTTTGGATTTGTCGTATTTAAAGAAGCAGATTCAG
TTGACCGATGTCAAGCCGAGCGTCCTCATCAACTGCTGGGTAAAATAGTC
GACACTAAACGAGCTATGCCGAAAGAAGAAAGTCTAAATCCAGATATCCA
TTGCAATTCTAAACGAATATTTATTGGTGGAATTAGACGATTTTTCACTG
AAGAGGACCTTAAGGATTATTTCAGTAATTTCGGTGAAATTGTCGATTGC
ACAATCAAACGAGACAATGTGTCTGGTCAGTCTAGAGGATTTGCTTTCAT
CACGTTTACGGATCGTGACATTGTCGATAAAGTCATTCTTTCAAAACCAC
ATGCCATTCGGCATTGTATAGTCGACGTTAAAAAAGCTTTATCACCTGAA
GAATTACGACAACTCGATGAGAATCACAGCAATACAAACAATGTTAGTAA
TAACAACAATAATTCGGAATATGAAAATGATTGTCAAAGAATTTACAAGC
ACAGTCAAGATCAAGAAGAAGATCCAAAATTGAAAGATAAAAACAAAGTC
ACTAAAAGAAGCCAATCGTACCCTCCGACAGAATATCCCAATTATGTGGG
CTACTATATGGTTCCACCAGACCTAAACGGTATCAACCCTTCCGCAACTT
ATCCATACGATCACCAAATGCCGTTAATTTGGATGTCGGTCCAACAATGC
GCAAACGGCTACATACTGACCCCAGTAACTCCAGACATTTACAGCGCTGC
TAATTATCAATCATATTTCTATCATTCACCGCCATTGTCGGCTCCGGGTT
ACATTTATTCACCAGCAATTTTCAACGATGTTCACAGTACTCAACCGGTT
GAAAACGGTGATAAAAGTGATAGCAGTCTAAATGTCAGTGAATTGAAAAA
AGTGTTGCCGGATGAAACCAACAACCATTCTAATTCAATTGATGATTATG
CATCGGAAGAAACTGCATTCGGATCACCAAACAGTGAAAGCCTTTGATGA
ATGTTTTATTATTTTTTACACTGCTTATTTGTGTGGAAATCAGTAATTGT
ATTGTTGTTTGTCTGCTAACTACTCCTTGCTCTATCAACAAAAAAAATTA
CCCACAAAAAACATTAACAAAAATACATTTGAAACTTCAGCATGTGTAAC
AAAGAAATTATTTAACAATTACAACATCAACAACAATATCCCAATGATTG
CTTTTTGCTGTGCTGTATTTTTTAATAAAGTAGTTATTGAAAATTGTATT
TTAATTTTTTTGTTTGGCTTATTTTTATTGGTTGATGTGCTCCAGTACTA
ATTTTGTGTGTGAGTGTGCGTGTAAATGATGTGCGAGCCAATATTTATTG
ATGTGTTGTATATTTTTGTTCAAAGCTGAAACCGATTTTCTGTGGATTCT
TTTTTGTGTTGTGTTGTTGTCGACAATGGGACATATTTTAATTATATATA
TATATTTTTTAAAAATATAAAGAAACTCCTGCTCTCTTTTCTTTCTTTCT
TTTCGATTGTGATTTTTCTATGTGTTGGTACATTATTATTAATATTATTA
ACAAATATTTTTTATCAAACTGTTTCAAAAAACGACTTGTATATTTAATG
TTTGTTATTCAAGATGTTTTTTTCTGTTTGTAGTTTAAAGGAAATCAATA
AAAACGCTCATTTTATATTTTATAATTCGAATATCCTATTTAAATACATG
CACCCTTTAAACGTATTTAGAAATAAATTTTTTATGATCA
back to top

protein sequence of SMED30031138-orf-1

>SMED30031138-orf-1 ID=SMED30031138-orf-1|Name=SMED30031138-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=376bp
MTQNKFKKIFVGGLPPQTTESDMRQYFSKYGDVCDVVAMRDKTGNKSRGF
GFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRI
FIGGIRRFFTEEDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRD
IVDKVILSKPHAIRHCIVDVKKALSPEELRQLDENHSNTNNVSNNNNNSE
YENDCQRIYKHSQDQEEDPKLKDKNKVTKRSQSYPPTEYPNYVGYYMVPP
DLNGINPSATYPYDHQMPLIWMSVQQCANGYILTPVTPDIYSAANYQSYF
YHSPPLSAPGYIYSPAIFNDVHSTQPVENGDKSDSSLNVSELKKVLPDET
NNHSNSIDDYASEETAFGSPNSESL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR037366BOULE/DAZ
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 97..169
e-value: 2.0E-19
score: 80.5
coord: 6..78
e-value: 1.1E-22
score: 91.4
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 7..69
e-value: 2.0E-16
score: 59.6
coord: 98..154
e-value: 4.9E-15
score: 55.1
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 5..82
score: 16.006
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 96..187
score: 15.681
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 1..80
e-value: 6.4E-24
score: 86.0
coord: 90..171
e-value: 1.5E-20
score: 75.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 209..232
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 324..373
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 209..227
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 324..338
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 347..373
NoneNo IPR availablePANTHERPTHR11176:SF13GENE 17190-RELATEDcoord: 92..244
coord: 5..86
IPR037366BOULE/DAZ familyPANTHERPTHR11176BOULE-RELATEDcoord: 92..244
coord: 5..86
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 5..103
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 90..195