slc13a-3

Overview
Nameslc13a-3 (AKN21482.1)
Smed IDSMED30031134
Length (bp)1887
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc13a-3 (SMED30031134) t-SNE clustered cells

Violin plots show distribution of expression levels for slc13a-3 (SMED30031134) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc13a-3 (SMED30031134) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc13a-3 (SMED30031134) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031134

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30031134SMESG000050959.1 PL030016B20D08ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30031134SMESG000050959.1 dd_Smed_v4_1171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031134SMESG000050959.1 dd_Smed_v4_1171_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031134SMESG000050959.1 Contig10904newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031134SMESG000050959.1 Contig10904uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031134SMESG000050959.1 Contig38651newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031134SMESG000050959.1 Contig38651uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30031134SMESG000050959.1 OX_Smed_1.0.17294ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
intestinal phagocyteSMED30031134SMESG000050959.1 dd_Smed_v6_1171_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc13a-3 vs. Ensembl Human
Match: SLC13A3 (solute carrier family 13 member 3 [Source:HGNC Symbol;Acc:HGNC:14430])

HSP 1 Score: 198.364 bits (503), Expect = 7.146e-55
Identity = 156/549 (28.42%), Postives = 262/549 (47.72%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNE-YGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKR-FSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFN--GILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSK-----EDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX---XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            CL+ ++++A +W  + LP  VT+LLPI+L P M I  S  +   +  D   L L  LI+A A ++  +HRR  L +L   G QP  ++L  M+    L+M++SNTA+  +ML     +L   +G+ E  ++ + E+E+N        +  + ++  +       T  +D+P  T V               +   S  E +++R       +   Y+AS G  ATL    PNL+  G +   F    ++N+G++     PL ++  L  W+W+  +  G   F   RKN S+     ED     I++  ++LG I FAE +   L     I+   R    I GW   F            ++SDA   V +V +L+ +P++    +   +  + ++  + LLTW      +PW II LLG G A+ + C +S  +  +  +L   L+N  P   +LL   +    TEF S+T  + I + +  +L I+ +  ++      P T   SFAF LP +T PN   F  G    K+M++TGLLM+++ +LL+S
Sbjct:   41 CLFVILLMAVYWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKILMLVGVQPARLILGMMVTTSFLSMWLSNTASTAMMLPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQF----LASTEAKDHPGETEV------------PLDLPADSRKEDEYRRNIWKGFLISIPYSASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLAGWLWISFL-YGGLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMFAILLFTRDPKFIPGWASLFNPG---------FLSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQL-HPLENVPPALAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLR--VHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLLVKDMVRTGLLMNLMGVLLLS 560          
BLAST of slc13a-3 vs. Ensembl Human
Match: SLC13A3 (solute carrier family 13 member 3 [Source:HGNC Symbol;Acc:HGNC:14430])

HSP 1 Score: 192.2 bits (487), Expect = 4.942e-53
Identity = 154/542 (28.41%), Postives = 256/542 (47.23%), Query Frame = 3
Query:  180 LAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNE-YGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKR-FSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFN--GILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSK-----EDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX---XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            +A +W  + LP  VT+LLPI+L P M I  S  +   +  D   L L  LI+A A ++  +HRR  L +L   G QP  ++L  M+    L+M++SNTA+  +ML     +L   +G+ E  ++ + E+E+N        +  + ++  +       T  +D+P  T V               +   S  E +++R       +   Y+AS G  ATL    PNL+  G +   F    ++N+G++     PL ++  L  W+W+  +  G   F   RKN S+     ED     I++  ++LG I FAE +   L     I+   R    I GW   F            ++SDA   V +V +L+ +P++    +   +  + ++  + LLTW      +PW II LLG G A+ + C +S  +  +  +L   L+N  P   +LL   +    TEF S+T  + I + +  +L I+ +  ++      P T   SFAF LP +T PN   F  G    K+M++TGLLM+++ +LL+S
Sbjct:    1 MAVYWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKILMLVGVQPARLILGMMVTTSFLSMWLSNTASTAMMLPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQF----LASTEAKDHPGETEV------------PLDLPADSRKEDEYRRNIWKGFLISIPYSASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLAGWLWISFL-YGGLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMFAILLFTRDPKFIPGWASLFNPG---------FLSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQL-HPLENVPPALAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLR--VHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLLVKDMVRTGLLMNLMGVLLLS 513          
BLAST of slc13a-3 vs. Ensembl Human
Match: SLC13A3 (solute carrier family 13 member 3 [Source:HGNC Symbol;Acc:HGNC:14430])

HSP 1 Score: 192.2 bits (487), Expect = 4.942e-53
Identity = 154/542 (28.41%), Postives = 256/542 (47.23%), Query Frame = 3
Query:  180 LAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNE-YGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKR-FSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFN--GILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSK-----EDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX---XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            +A +W  + LP  VT+LLPI+L P M I  S  +   +  D   L L  LI+A A ++  +HRR  L +L   G QP  ++L  M+    L+M++SNTA+  +ML     +L   +G+ E  ++ + E+E+N        +  + ++  +       T  +D+P  T V               +   S  E +++R       +   Y+AS G  ATL    PNL+  G +   F    ++N+G++     PL ++  L  W+W+  +  G   F   RKN S+     ED     I++  ++LG I FAE +   L     I+   R    I GW   F            ++SDA   V +V +L+ +P++    +   +  + ++  + LLTW      +PW II LLG G A+ + C +S  +  +  +L   L+N  P   +LL   +    TEF S+T  + I + +  +L I+ +  ++      P T   SFAF LP +T PN   F  G    K+M++TGLLM+++ +LL+S
Sbjct:    1 MAVYWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKILMLVGVQPARLILGMMVTTSFLSMWLSNTASTAMMLPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQF----LASTEAKDHPGETEV------------PLDLPADSRKEDEYRRNIWKGFLISIPYSASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLAGWLWISFL-YGGLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMFAILLFTRDPKFIPGWASLFNPG---------FLSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQL-HPLENVPPALAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLR--VHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLLVKDMVRTGLLMNLMGVLLLS 513          
BLAST of slc13a-3 vs. Ensembl Human
Match: SLC13A5 (solute carrier family 13 member 5 [Source:HGNC Symbol;Acc:HGNC:23089])

HSP 1 Score: 191.815 bits (486), Expect = 8.590e-53
Identity = 168/563 (29.84%), Postives = 263/563 (46.71%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEY----GKIEEGRELNDEAEQNFTHYGSTDI--SPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF---NGILNYGNFIAIGLPLSIITFLLTWVWVGTV--NIGPREFFACRKNSSK-EDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GW-GCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXX------LLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDI--VFLLLVSCYTYG 1781
            C Y ++++A +W  +V+P  VTSL+P+LL PL  I  S+ +   +  D  +L LG LI+A A ++  +H+R  L  L   G +P  +ML  M    +L+M+ISNTAT  +M+  V  +L +        E G EL D+ +      GS  I   P L Q+            ED               ERK                R   A++L   YAAS G  ATL   GPN+V  G +++ F     ++N+ ++ A   P  ++  L  W+W+  V      ++ + C   S K E   L+ +++  + LG ++FAEI+ +     ++I+W  R  G + GW   A+ +  T       YVSDAT  + V  LL+I P++   +   S  +           LL W  T   +PW I+ LLG G A+ +    S  +  +  ++ + L    P AI L+ + L  V TE  S+     + + IF  +      GLN      P T  +SFAF LP AT PN  +F  G     +M+KTG++M+I  VF + ++  T+G
Sbjct:   38 CAYVIILMAIYWCTEVIPLAVTSLMPVLLFPLFQILDSRQVCVQYMKDTNMLFLGGLIVAVAVERWNLHKRIALRTLLWVGAKPARLMLGFMGVTALLSMWISNTATTAMMVPIVEAILQQMEATSAATEAGLELVDKGKAK-ELPGSQVIFEGPTLGQQ------------ED--------------QERK----------------RLCKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWFAFAFPNMLVMLLFAWLWLQFVYMRFNFKKSWGCGLESKKNEKAALKVLQEEYRKLGPLSFAEINVLICFFLLVILWFSRDPGFMPGWLTVAWVEGETK------YVSDATVAIFVATLLFIVPSQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPWGIVLLLGGGFALAKGSEASGLSVWMGKQM-EPLHAVPPAAITLILSLLVAVFTECTSNVATTTLFLPIFASMS--RSIGLNPLYIMLPCTLSASFAFMLPVATPPNAIVFTYGHLKVADMVKTGVIMNIIGVFCVFLAVNTWG 548          
BLAST of slc13a-3 vs. Ensembl Human
Match: SLC13A4 (solute carrier family 13 member 4 [Source:HGNC Symbol;Acc:HGNC:15827])

HSP 1 Score: 192.2 bits (487), Expect = 1.590e-52
Identity = 153/589 (25.98%), Postives = 279/589 (47.37%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEE-----GRELNDEAEQNFTHYGSTDISPIL---SQKNYGDFNSQLTMNED---YPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSL--------------ALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNG--ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFAC----RKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGF----VIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXXL-----LTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSS----TTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFL--LLVSCYTYGV 1784
            C Y L+V A +W  + +P G  +L+P  L P   +  S  ++  +  +  +L +G + +A A +K  +H+R  L ++   G +P M++L  M    +L+M++SNT+T  +++  V  VL E    E+     G    +EAE       ++  S  L   ++++  D  + L  NE+    PS+TN I+ +     +K   S     +L    ++  L               LSL   Y+A+ G + T++    +L+     + Q+    ++N+G +     P+S+I  +++W W+  + +G      C    +K + +E +  +RI++  + LG I++ E+    +TGF    + ++W  R+ G + GW   F+K          Y +DAT  V +  LL++ P +   +   +  ++    L     +TW    + +PW I+ L+G G A+      S  +  +  ++   L +  P+A+ LLA  L  + TEF+S+    T  LPIL S+   L I      N      P+T C SFA  LP    PN  +F+ G    K+M+K GL ++++ L  ++V+  T+GV
Sbjct:   37 CAYVLIVTAVYWVSEAVPLGAAALVPAFLYPFFGVLRSNEVAAEYFKNTTLLLVGVICVAAAVEKWNLHKRIALRMVLMAGAKPGMLLLCFMCCTTLLSMWLSNTSTTAMVMPIVEAVLQELVSAEDEQLVAGNSNTEEAEPISLDVKNSQPSLELIFVNEESNADLTT-LMHNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLSLSISYSATIGGLTTIIGTSTSLIFLEHFNNQYPAAEVVNFGTWFLFSFPISLIMLVVSWFWMHWLFLGCNFKETCSLSKKKKTKREQLSEKRIQEEYEKLGDISYPEM----VTGFFFILMTVLWFTREPGFVPGWDSFFEKKG--------YRTDATVSVFLGFLLFLIPAKKPCFGKKNDGENQEHSLGTEPIITWKDFQKTMPWEIVILVGGGYALASGSKSSGLSTWIGNQMLS-LSSLPPWAVTLLACILVSIVTEFVSNPATITIFLPILCSLSETLHI------NPLYTLIPVTMCISFAVMLPVGNPPNAIVFSYGHCQIKDMVKAGLGVNVIGLVIVMVAINTWGV 605          
BLAST of slc13a-3 vs. Ensembl Celegans
Match: nac-1 (Sodium-dependent low-affinity dicarboxylate transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:Q93655])

HSP 1 Score: 173.326 bits (438), Expect = 2.055e-46
Identity = 137/533 (25.70%), Postives = 248/533 (46.53%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGI---LNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLER-IKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVS--YELTDRLK-NSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGL 1733
            CLY + V+ ++W  + LP  +T+ +P++L PL  I  S+ ++  +  D   L +G L++A A +K ++H R  LF+L   G +P  +M   M     L+M+ISNTAT  +M+  +  V+ E   +     + D       H+ S+        + +     +L++    P+  N I+        +  T++S R   E+K  +    L L   ++A+ G  AT+     NLV  G +++ F G    +N+ +++    P+     +  W  +         +    +++ K  I + R ++    +L   +FAE++ I     ++++WILR+   + GWG  F+           +VSDAT  + +VILL+  P +    R  S +  ++  LL W       PW+++FLLG G A+     +S  +  +       D    N      I+++ TL  V +  + ++  +PI+  +   LEI      +  N+  P+T  +SFAF LP AT PN  +F+ G     +M  +GL
Sbjct:   44 CLYCVAVMGSYWVFEALPLAITAFIPMILFPLFGIMRSEEVARAYLPDTCFLFMGGLMVALAVEKCELHARVALFVLKTVGSEPARVMAGFMGVTGFLSMWISNTATTALMVPILQSVITE---LVSNHRMEDLVALCEAHHNSS--------RKHSVGMRRLSL----PNENNEIK------REEMDTAMSPR---EQKMAK---GLMLSVCFSANIGGAATITGTASNLVLVGQLNELFPGADTGVNFLSWLIFAFPMVFCCLIYCWCVL---------YLLYLRDAPKGSIIVTRKLQQKYNELHAFSFAEMAVIFCFALLLVLWILREPQVVPGWGEMFKDE---------FVSDATSAMFIVILLFTLPEKLPSSRGSSEQRKASSGLLDWATVQDRFPWSVLFLLGGGFALAAGVKESGLSHDIGAIMRYLDVFNHNIIMLICIIISVTLTNVCSNTVIASIFIPIVAELARSLEI------DPLNFMLPVTISASFAFLLPVATPPNAIVFSSGYLKVFDMFVSGL 525          
BLAST of slc13a-3 vs. Ensembl Celegans
Match: nac-2 (Sodium-dependent high-affinity dicarboxylate transporter 2 [Source:UniProtKB/Swiss-Prot;Acc:P32739])

HSP 1 Score: 160.229 bits (404), Expect = 4.648e-42
Identity = 132/549 (24.04%), Postives = 239/549 (43.53%), Query Frame = 3
Query:  147 PGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF---NGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLER-----IKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVG-TIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            P + CL+ ++ L+ +W  +  P GVTSL P+ L P++ I  S+ IS  +  D+++L +  LI+A A +   +HRR  L LLTK G +  +++L  M     ++ F+S+TA   +M    + +L           ++D  +                            + ED+       + + +  + +          +  +   F  AL L   +A+  G  A + + GPNLV    + K++      + Y  ++   +P   +  L +++ +    +GP  F    +  SKE+  L++     I+ + +DLG +++ E S       +I  WI R  G T GWG               ++SD+   VL+  +L++WP       +  +       +L W        W+   L+G G AI+E  +KS  ++ +S  + +     S   + L   T+  + TEF S+ +   I + I   L +    G++      P T   SFAF LP +T PN  +++  + S  EMI  G L++I  +L+ S
Sbjct:   30 PEYRCLFSIIFLSTYWIGEAFPIGVTSLFPLALYPILQIVPSKQISPVYFKDSIVLFMCTLIMAMAVEATGLHRRIALKLLTKVGAKQPVMLLGFMCITSFISFFVSDTACTALMCPTAVALL---------MSMSDAVQH---------------------------LKEDHRKPKPPPDDATVAEKLRIDD-------MTPQDAGFCKALILACAHASLIGGTAIITSTGPNLVFRENIHKRYPEGQVTMTYLQWMVFAIPPMFVYLLASYIILVCYFMGPSTFARWFERPSKEEAHLKKLIEKNIQTMYEDLGDVSWGEKSVFVFFILLIGSWISRDPGFTPGWGDLLPHRN--------FISDSVSGVLISCILFVWPKDPFDPIDPMAP------ILKWTDMKSKFSWSCTLLIGAGYAISEGVDKSGLSRLISCGMKNIFVGMSSLPLQLTVTTIIVIMTEFASNVSTGSIFIPI--SLGVAESMGVHPLYLALPTTVACSFAFMLPISTPPNAVVYDTKVISMVEMIVCGFLLNIACILITS 519          
BLAST of slc13a-3 vs. Ensembl Celegans
Match: nac-2 (Sodium-dependent high-affinity dicarboxylate transporter 2 [Source:UniProtKB/Swiss-Prot;Acc:P32739])

HSP 1 Score: 160.229 bits (404), Expect = 7.307e-42
Identity = 136/549 (24.77%), Postives = 238/549 (43.35%), Query Frame = 3
Query:  147 PGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF---NGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLER-----IKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVG-TIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            P + CL+ ++ L+ +W  +  P GVTSL P+ L P++ I  S+ IS  +  D+++L +  LI+A A +   +HRR  L LLTK G +  +++L  M     ++ F+S+TA   +M    + +L           ++D  +    H       P                 +  P    V E  +I               +  +   F  AL L   +A+  G  A + + GPNLV    + K++      + Y  ++   +P   +  L +++ +    +GP  F    +  SKE+  L++     I+ + +DLG +++ E S       +I  WI R  G T GWG               ++SD+   VL+  +L++WP       +  +       +L W        W+   L+G G AI+E  +KS  ++ +S  + +     S   + L   T+  + TEF S+ +   I + I   L +    G++      P T   SFAF LP +T PN  +++  + S  EMI  G L++I  +L+ S
Sbjct:   64 PEYRCLFSIIFLSTYWIGEAFPIGVTSLFPLALYPILQIVPSKQISPVYFKDSIVLFMCTLIMAMAVEATGLHRRIALKLLTKVGAKQPVMLLGFMCITSFISFFVSDTACTALMCPTAVALL---------MSMSDAVQ----HLKEDHRKP-----------------KPPPDDATVAEKLRI-------------DDMTPQDAGFCKALILACAHASLIGGTAIITSTGPNLVFRENIHKRYPEGQVTMTYLQWMVFAIPPMFVYLLASYIILVCYFMGPSTFARWFERPSKEEAHLKKLIEKNIQTMYEDLGDVSWGEKSVFVFFILLIGSWISRDPGFTPGWGDLLPHRN--------FISDSVSGVLISCILFVWPKDPFDPIDPMAP------ILKWTDMKSKFSWSCTLLIGAGYAISEGVDKSGLSRLISCGMKNIFVGMSSLPLQLTVTTIIVIMTEFASNVSTGSIFIPI--SLGVAESMGVHPLYLALPTTVACSFAFMLPISTPPNAVVYDTKVISMVEMIVCGFLLNIACILITS 553          
BLAST of slc13a-3 vs. Ensembl Celegans
Match: B0285.6 (Uncharacterized transporter B0285.6 [Source:UniProtKB/Swiss-Prot;Acc:P46556])

HSP 1 Score: 148.673 bits (374), Expect = 7.637e-38
Identity = 132/557 (23.70%), Postives = 240/557 (43.09%), Query Frame = 3
Query:  132 LVHRTPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTR---SILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF----NGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSK-----EDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXX----XXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFF--PLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDI 1745
            L HR+    C + ++ ++ +W  +V+P  VTS +P++  P + I + + ++  + +D  I+    L+L+ A ++ Q+H+R  L +LT  G +P  +M   MI    ++++IS+TA   +M      +L E   I + R    E E                                       IEV KIF +         +   S L  + +     + L   +A+  G   T+ + GPNL+    ++K F    +GI +Y +++A  +P  I     +W  V    +GPR      +  ++     E++    +      LG +T+AE S + +    ++ W+      I GW   F+K          YV+D+   ++ V LL+IWP +      F ++ S      + L+ WD   R  PW+II LLG G AI++    S  +  ++  L   +     F + ++ + +  V TEF +++       SIFI +  K  + +     +F  P     SF+F LP AT  N  ++        +M+  G+ ++I
Sbjct:   33 LWHRSLEGKCAFVILTMSCYWVAEVVPLAVTSFIPMIALPFLGIVSIKEVAPKYFADTNIVFFNSLMLSLAVEECQLHKRIALKMLTYVGTRPHWLMAGFMIITSFISLWISDTACCALMAPIAYALLEEI-MIPKMRPEEKENE---------------------------------------IEVMKIFDKEDPEEKEKKKLDTSRLSVRDRGICKCMMLLVAHASLIGGTGTINSTGPNLIFRDNIEKNFPNEDHGI-SYLSWMAFAIPPMIFYMFSSWFIVQLQFLGPRHLMGMFREPTETEKQEEEVAKRAVWKSYDQLGPMTWAEKSTLVIFVLAVLSWVSSDPKVIPGWSDLFRKG---------YVTDSCSGLVAVFLLFIWPKKKPDFRIFRKDKSRPSVRQEPLIDWDCVRRRFPWSIILLLGAGFAISDAVRVSGLSSLIACSLNSTISKMPFFVMQIILSIVVVVMTEFSTNSAT----ASIFIPISFKMAEAVGAHPLYFSIPTAIGPSFSFMLPMATPANAIVYETKTIRMIDMVSCGVFLNI 535          
BLAST of slc13a-3 vs. Ensembl Celegans
Match: nac-3 (Sodium-dependent high-affinity dicarboxylate transporter 3 [Source:UniProtKB/Swiss-Prot;Acc:Q21339])

HSP 1 Score: 100.138 bits (248), Expect = 5.010e-22
Identity = 88/343 (25.66%), Postives = 147/343 (42.86%), Query Frame = 3
Query:  762 KRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF---NGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXX--LLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVSCY 1772
            K+ +  L L   +AA+ G   T      NLV  G +   F   +G LNY  +I    PL ++   + W+ + +        F  R    K++   E +K    +L R+T+AE S       ++ +W+ R  G + G+G  F+K A          +DAT  ++V  LL++ P+          ++    R  L+ W       PW+++ LLG G A+     +S  +  +   L+  +++   + + LL   +  V T   S+T    I V I   L    + G + F    P T  SSFAF  P  T PN  +F  G+    +M   G ++ +  L+L   Y
Sbjct:  129 KKMATGLVLSICFAANIGGTGTATGTPSNLVMLGQLSALFPKVDGSLNYVTWIFFAYPLMLLCLFVAWMTLVS--------FFLRDAPEKDEAVTEMLKTRYNELPRMTYAEKSVFVCFCILLSLWVFRNPGVVPGFGVFFKKGA---------YTDATSAMIVAFLLFVLPSERPDLATYIKKEDLKKRGCLMDWKTMQETFPWSVVLLLGGGFALAAGVKESGLSLLIGNSLSS-IEHLPLWILQLLTMLIAMVITNICSNTVTASIFVPIVATL--AQRAGHHPFTLMLPTTLASSFAFIFPVGTPPNAIVFGSGMVKVSDMAFVGGIISLELLVLTVLY 451          

HSP 2 Score: 70.0922 bits (170), Expect = 2.237e-12
Identity = 39/120 (32.50%), Postives = 66/120 (55.00%), Query Frame = 3
Query:  201 DVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDE 560
            +V+P  VT++LP++L PL+ +  +   ++ + +D   L +G LI+A A +K  +H R  L +L   G +P+ IML  M    +L+ FISNTAT  +M+     V+ +     +    N E
Sbjct:    3 EVMPLAVTAMLPVVLFPLVGVLDANTTAKEYMNDTNFLFIGGLIMAAAVEKCDLHERVALSVLRCVGSEPKWIMLGFMTVTALLSSFISNTATTAMMVPIGQSVVQQLISSFQHHPTNGE 122          
BLAST of slc13a-3 vs. Ensembl Fly
Match: Indy (gene:FBgn0036816 transcript:FBtr0301857)

HSP 1 Score: 143.665 bits (361), Expect = 4.997e-36
Identity = 132/568 (23.24%), Postives = 234/568 (41.20%), Query Frame = 3
Query:  132 LVHRTPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNG---ILNYGNFIAIGLPLSIITFLLT-----WVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGT-IGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXX-----XXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGL--LMDIVFLLLVSCYTYGVV 1787
            L++    F C+Y L+V+A FW  + LP  VTS++PI+  P+M I +S      +  D L++ +G +++A A +   +H+R  L ++   G  PR +    ++    L+M+ISN A   +M   +  VL          EL  +      H           +  Y         NED P                + T I+             L   LG  YA+S G   T++    NL   G+ + +F      +++  F+   +P  ++  LLT     W ++G      +E    ++     D+  + I    KDLG ++  EI  + L  F+++M+  RK G  +GW                 + ++ P + VV++ ++ P  +        R           L+TW +    +PW ++FLLG G A+ E   +S   + +   L   LK      ++L+   +    T F S+  I  I++ +  ++ +  +  ++      P     S AF LP +T PN  +       TK+M   G+   +  +  L V C T+G+V
Sbjct:   40 LLNEGAEFRCMYLLLVMAIFWVTEALPLYVTSMIPIVAFPIMGIMSSDQTCRLYFKDTLVMFMGGIMVALAVEYCNLHKRLALRVIQIVGCSPRRLHFGLIMVTMFLSMWISNAACTAMMCPIIQAVL---------EELQAQGVCKINH-----------EPQYQIVGGNKKNNEDEPP---------------YPTKIT-------------LCYYLGIAYASSLGGCGTIIGTATNLTFKGIYEARFKNSTEQMDFPTFMFYSVPSMLVYTLLTFVFLQWHFMGLWRPKSKEAQEVQRGREGADVAKKVIDQRYKDLGPMSIHEIQVMILFIFMVVMYFTRKPGIFLGWADLLNSKD---------IRNSMPTIFVVVMCFMLPANYAFLRYCTRRGGPVPTGPTPSLITWKFIQTKVPWGLVFLLGGGFALAEGSKQSGMAKLIGNALIG-LKVLPNSVLLLVVILVAVFLTAFSSNVAIANIIIPVLAEMSLAIE--IHPLYLILPAGLACSMAFHLPVSTPPNALVAGYANIRTKDMAIAGIGPTIITIITLFVFCQTWGLV 547          
BLAST of slc13a-3 vs. Ensembl Fly
Match: Indy (gene:FBgn0036816 transcript:FBtr0075082)

HSP 1 Score: 143.665 bits (361), Expect = 4.997e-36
Identity = 132/568 (23.24%), Postives = 234/568 (41.20%), Query Frame = 3
Query:  132 LVHRTPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNG---ILNYGNFIAIGLPLSIITFLLT-----WVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGT-IGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXX-----XXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGL--LMDIVFLLLVSCYTYGVV 1787
            L++    F C+Y L+V+A FW  + LP  VTS++PI+  P+M I +S      +  D L++ +G +++A A +   +H+R  L ++   G  PR +    ++    L+M+ISN A   +M   +  VL          EL  +      H           +  Y         NED P                + T I+             L   LG  YA+S G   T++    NL   G+ + +F      +++  F+   +P  ++  LLT     W ++G      +E    ++     D+  + I    KDLG ++  EI  + L  F+++M+  RK G  +GW                 + ++ P + VV++ ++ P  +        R           L+TW +    +PW ++FLLG G A+ E   +S   + +   L   LK      ++L+   +    T F S+  I  I++ +  ++ +  +  ++      P     S AF LP +T PN  +       TK+M   G+   +  +  L V C T+G+V
Sbjct:   40 LLNEGAEFRCMYLLLVMAIFWVTEALPLYVTSMIPIVAFPIMGIMSSDQTCRLYFKDTLVMFMGGIMVALAVEYCNLHKRLALRVIQIVGCSPRRLHFGLIMVTMFLSMWISNAACTAMMCPIIQAVL---------EELQAQGVCKINH-----------EPQYQIVGGNKKNNEDEPP---------------YPTKIT-------------LCYYLGIAYASSLGGCGTIIGTATNLTFKGIYEARFKNSTEQMDFPTFMFYSVPSMLVYTLLTFVFLQWHFMGLWRPKSKEAQEVQRGREGADVAKKVIDQRYKDLGPMSIHEIQVMILFIFMVVMYFTRKPGIFLGWADLLNSKD---------IRNSMPTIFVVVMCFMLPANYAFLRYCTRRGGPVPTGPTPSLITWKFIQTKVPWGLVFLLGGGFALAEGSKQSGMAKLIGNALIG-LKVLPNSVLLLVVILVAVFLTAFSSNVAIANIIIPVLAEMSLAIE--IHPLYLILPAGLACSMAFHLPVSTPPNALVAGYANIRTKDMAIAGIGPTIITIITLFVFCQTWGLV 547          
BLAST of slc13a-3 vs. Ensembl Fly
Match: Indy (gene:FBgn0036816 transcript:FBtr0075083)

HSP 1 Score: 143.665 bits (361), Expect = 4.997e-36
Identity = 132/568 (23.24%), Postives = 234/568 (41.20%), Query Frame = 3
Query:  132 LVHRTPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNG---ILNYGNFIAIGLPLSIITFLLT-----WVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGT-IGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXX-----XXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGL--LMDIVFLLLVSCYTYGVV 1787
            L++    F C+Y L+V+A FW  + LP  VTS++PI+  P+M I +S      +  D L++ +G +++A A +   +H+R  L ++   G  PR +    ++    L+M+ISN A   +M   +  VL          EL  +      H           +  Y         NED P                + T I+             L   LG  YA+S G   T++    NL   G+ + +F      +++  F+   +P  ++  LLT     W ++G      +E    ++     D+  + I    KDLG ++  EI  + L  F+++M+  RK G  +GW                 + ++ P + VV++ ++ P  +        R           L+TW +    +PW ++FLLG G A+ E   +S   + +   L   LK      ++L+   +    T F S+  I  I++ +  ++ +  +  ++      P     S AF LP +T PN  +       TK+M   G+   +  +  L V C T+G+V
Sbjct:   40 LLNEGAEFRCMYLLLVMAIFWVTEALPLYVTSMIPIVAFPIMGIMSSDQTCRLYFKDTLVMFMGGIMVALAVEYCNLHKRLALRVIQIVGCSPRRLHFGLIMVTMFLSMWISNAACTAMMCPIIQAVL---------EELQAQGVCKINH-----------EPQYQIVGGNKKNNEDEPP---------------YPTKIT-------------LCYYLGIAYASSLGGCGTIIGTATNLTFKGIYEARFKNSTEQMDFPTFMFYSVPSMLVYTLLTFVFLQWHFMGLWRPKSKEAQEVQRGREGADVAKKVIDQRYKDLGPMSIHEIQVMILFIFMVVMYFTRKPGIFLGWADLLNSKD---------IRNSMPTIFVVVMCFMLPANYAFLRYCTRRGGPVPTGPTPSLITWKFIQTKVPWGLVFLLGGGFALAEGSKQSGMAKLIGNALIG-LKVLPNSVLLLVVILVAVFLTAFSSNVAIANIIIPVLAEMSLAIE--IHPLYLILPAGLACSMAFHLPVSTPPNALVAGYANIRTKDMAIAGIGPTIITIITLFVFCQTWGLV 547          
BLAST of slc13a-3 vs. Ensembl Fly
Match: Indy (gene:FBgn0036816 transcript:FBtr0075081)

HSP 1 Score: 143.28 bits (360), Expect = 6.411e-36
Identity = 132/568 (23.24%), Postives = 234/568 (41.20%), Query Frame = 3
Query:  132 LVHRTPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNG---ILNYGNFIAIGLPLSIITFLLT-----WVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGT-IGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXX-----XXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGL--LMDIVFLLLVSCYTYGVV 1787
            L++    F C+Y L+V+A FW  + LP  VTS++PI+  P+M I +S      +  D L++ +G +++A A +   +H+R  L ++   G  PR +    ++    L+M+ISN A   +M   +  VL          EL  +      H           +  Y         NED P                + T I+             L   LG  YA+S G   T++    NL   G+ + +F      +++  F+   +P  ++  LLT     W ++G      +E    ++     D+  + I    KDLG ++  EI  + L  F+++M+  RK G  +GW                 + ++ P + VV++ ++ P  +        R           L+TW +    +PW ++FLLG G A+ E   +S   + +   L   LK      ++L+   +    T F S+  I  I++ +  ++ +  +  ++      P     S AF LP +T PN  +       TK+M   G+   +  +  L V C T+G+V
Sbjct:   58 LLNEGAEFRCMYLLLVMAIFWVTEALPLYVTSMIPIVAFPIMGIMSSDQTCRLYFKDTLVMFMGGIMVALAVEYCNLHKRLALRVIQIVGCSPRRLHFGLIMVTMFLSMWISNAACTAMMCPIIQAVL---------EELQAQGVCKINH-----------EPQYQIVGGNKKNNEDEPP---------------YPTKIT-------------LCYYLGIAYASSLGGCGTIIGTATNLTFKGIYEARFKNSTEQMDFPTFMFYSVPSMLVYTLLTFVFLQWHFMGLWRPKSKEAQEVQRGREGADVAKKVIDQRYKDLGPMSIHEIQVMILFIFMVVMYFTRKPGIFLGWADLLNSKD---------IRNSMPTIFVVVMCFMLPANYAFLRYCTRRGGPVPTGPTPSLITWKFIQTKVPWGLVFLLGGGFALAEGSKQSGMAKLIGNALIG-LKVLPNSVLLLVVILVAVFLTAFSSNVAIANIIIPVLAEMSLAIE--IHPLYLILPAGLACSMAFHLPVSTPPNALVAGYANIRTKDMAIAGIGPTIITIITLFVFCQTWGLV 565          
BLAST of slc13a-3 vs. Ensembl Fly
Match: CG33934 (gene:FBgn0064119 transcript:FBtr0301700)

HSP 1 Score: 125.946 bits (315), Expect = 3.214e-30
Identity = 134/546 (24.54%), Postives = 232/546 (42.49%), Query Frame = 3
Query:  150 GFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLS-CMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF---NGILNYGNFIAIGLPLSIITFL-LTWVWVGTVNIG---PREFFA--CRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWIL--RKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXX----XXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLL 1736
             F C+Y +  +A FW  + +P  +T+L P++  PL  I TS+ +   + SD +++ +G L++A A +   +H+R  L  +   G  PR +     M+ C+I +++ISN+A   +M   V  VLNE            E +  F  Y + +  P+                E  P   + I                            S+A   G  Y++S G   TL+  G NL   G+ D +F   +  +++  F+A  +P  ++  + LT+  +   ++G   P        +K +  +D+  + IK    +LG ++  EI  +GL  FV+++++L  RK G   GW       A         +    P+    ILL+  PT++ F++    +      + D  L+W Y  +  P+ + FLLG G A+ E    S   + +   L    +  S   +I +   +    T F S+  I  IL+ IF ++ +  +  ++     FP     S AF LP +T PN  I       TK M   G+L
Sbjct:   48 AFQCMYLVANMALFWITEAIPLYLTALFPVVFLPLFGILTSEKVCSFYFSDTVVMFIGGLLIALAIEYSNLHQRIALNTILIVGCSPRRLHFGLVMVTCFI-SLWISNSAATAMMCPIVKAVLNEM-----------ETQNIFAIYKTQEEEPV---------------EEGDPPHPSTI----------------------------SMAFYFGIAYSSSIGGCGTLIGTGTNLTYKGLYDTRFPNSDEKIDFPIFMAYSVPFVVLVLIFLTYFSLQVTHMGLFRPNSKIGQEVKKGAESQDVVKDVIKQRKAELGPMSCHEIQ-VGLL-FVLMIFLLFTRKPGFFPGWADFLNAKA---------IGSGPPVFFATILLFALPTQYTFFKYCCGKAPFPGQTLDACLSWVYCQKYTPFGLAFLLGGGFALAEGSRVSGMAKMLGESLAFAGEMHS-VLVISMCIIISLFCTAFASNVAICNILIPIFSEMALAIE--VHPMKLTFPAALACSLAFHLPVSTPPNAIISGFTGLKTKYMAIAGIL 524          
BLAST of slc13a-3 vs. Ensembl Zebrafish
Match: slc13a5a (solute carrier family 13 member 5a [Source:ZFIN;Acc:ZDB-GENE-030131-4628])

HSP 1 Score: 205.682 bits (522), Expect = 7.945e-58
Identity = 166/556 (29.86%), Postives = 266/556 (47.84%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF---NGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGP--REFFACRK-NSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPT---------XXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAII----LLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            C Y +V++A +W  +VLP  VT+LLP +L PL  I  S+++   +  D  +L LG L++A A +   +H+R  L +L   G +P ++ML  M     L+M+ISNTAT  +M+  V  VL          +LN+ A+Q  +    T+      Q        ++ +N D  SM +  E     +E +                + S  L+L   YAAS G  ATL   GPNLV  G + + F     I+N+ ++     P  II   L W+W+  V +G   ++ + C    + KE      IK+  + LG +TF E+S + L   ++++W  R  G + GW   F       +  + +V+DAT  V V  LL+++P+            F             LLTW  T + +PW+II LLG G A+ +    S  ++ +  +++  L++  P+AI     L+ AT    T+   ++T  LPIL S      +    G+N      P T  +SFAF LP AT PN  +F+ G     +M KTG++M+I+ +L ++
Sbjct:   40 CAYVVVLMAVYWCTEVLPLAVTALLPAVLFPLFRIMESKDVCMQYLKDTNMLFLGGLMVAVAVEHWNLHKRIALRVLLLVGVRPALLMLGFMGVTAFLSMWISNTATTAMMVPIVQAVL---------EQLNNTAQQEQSSIPETEEKSTEKQPESPG-EEKVVLNGDNFSMESDPEEHSREAEERL---------------KMSKGLTLCVCYAASIGGTATLTGTGPNLVLMGQMSQLFPDNPDIINFASWFGFAFPNMIIMLTLAWLWLQIVFLGINFKKTWGCGTVKTEKEIAAYNVIKEEHRSLGPMTFGELSVLALFILLVVLWFTRDPGFVDGWATRF------FNADKEFVTDATVAVFVAALLFVFPSKPPRLCFWRTESFDTVPQQESGPTPALLTWKVTQKKMPWSIILLLGGGFALAKGSEISGLSKWLGDQMSP-LQSIPPWAIAIVICLMIATFTECTSNVATATLFLPILAS------MSQSIGVNPLYVMVPCTLSASFAFMLPVATPPNAIVFSYGYLKVSDMAKTGIVMNIIGILSIT 557          
BLAST of slc13a-3 vs. Ensembl Zebrafish
Match: slc13a5a (solute carrier family 13 member 5a [Source:ZFIN;Acc:ZDB-GENE-030131-4628])

HSP 1 Score: 198.749 bits (504), Expect = 9.792e-56
Identity = 164/549 (29.87%), Postives = 261/549 (47.54%), Query Frame = 3
Query:  180 LAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF---NGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGP--REFFACRK-NSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPT---------XXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAII----LLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            +A +W  +VLP  VT+LLP +L PL  I  S+++   +  D  +L LG L++A A +   +H+R  L +L   G +P ++ML  M     L+M+ISNTAT  +M+  V  VL          +LN+ A+Q  +    T+      Q       S + +N D  SM +  E     +E +                + S  L+L   YAAS G  ATL   GPNLV  G + + F     I+N+ ++     P  II   L W+W+  V +G   ++ + C    + KE      IK+  + LG +TF E+S + L   ++++W  R  G + GW   F       +  + +V+DAT  V V  LL+++P+            F             LLTW  T + +PW+II LLG G A+ +    S  ++ +  +++  L++  P+AI     L+ AT    T+   ++T  LPIL S      +    G+N      P T  +SFAF LP AT PN  +F+ G     +M KTG++M+I+ +L ++
Sbjct:    1 MAVYWCTEVLPLAVTALLPAVLFPLFRIMESKDVCMQYLKDTNMLFLGGLMVAVAVEHWNLHKRIALRVLLLVGVRPALLMLGFMGVTAFLSMWISNTATTAMMVPIVQAVL---------EQLNNTAQQEQSSIPETEEKSTEKQP-----ESPVVLNGDNFSMESDPEEHSREAEERL---------------KMSKGLTLCVCYAASIGGTATLTGTGPNLVLMGQMSQLFPDNPDIINFASWFGFAFPNMIIMLTLAWLWLQIVFLGINFKKTWGCGTVKTEKEIAAYNVIKEEHRSLGPMTFGELSVLALFILLVVLWFTRDPGFVDGWATRF------FNADKEFVTDATVAVFVAALLFVFPSKPPRLCFWRTESFDTVPQQESGPTPALLTWKVTQKKMPWSIILLLGGGFALAKGSEISGLSKWLGDQMSP-LQSIPPWAIAIVICLMIATFTECTSNVATATLFLPILAS------MSQSIGVNPLYVMVPCTLSASFAFMLPVATPPNAIVFSYGYLKVSDMAKTGIVMNIIGILSIT 507          
BLAST of slc13a-3 vs. Ensembl Zebrafish
Match: slc13a3 (solute carrier family 13 member 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2486])

HSP 1 Score: 192.586 bits (488), Expect = 4.312e-53
Identity = 155/548 (28.28%), Postives = 258/548 (47.08%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNE-YGKIEEGRELNDEAEQNFTHYGSTDIS-PILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKK-FKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFN--GILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLER---IKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX---XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            CLY ++++A +W  + LP  VT++LP+ L P M I  S+ +   +  +   L L  L++A A ++  +HRR  L +L   G +P  ++L  MI    L+M++SNTAT  +ML     +L   +G +E    L +  +      G + +   +L +K       Q+   ED P  T+        SE++    +   +  + K +K F + +     YAAS G  ATL    PNL+  G +   F    ++N+G++     PL ++  +L W+W+  +  G        KN  +     +    I +  K LG I FAE S         I+   R    + GW   F K          YVSDA   V+++ +L+ +P++    R   +  + ++    LL+W      +PW II LLG G A+ + C +S     +   L    +   P A++L+ A + C  TEF S+T  + I + +  +L I+ +  +N   +  P T   S+AF LP +T PN   F  G    K+M+KTG +M+I+ +L VS
Sbjct:   40 CLYVVLLMAVYWCTEALPLAVTAMLPVCLFPTMGILPSKKVCPQYFLETNFLFLSGLVMASAIEEWGLHRRIALKVLKIVGVKPAWLILGMMITSSFLSMWLSNTATTAMMLPIANAILESLFGNLE---TLKENCKTRSDPEGDSQVKMHVLPEK-------QILTVEDRPDWTDR-------SEQRNQEEVRREAEYQMKVWKGFLICIP----YAASIGGTATLTGTAPNLILVGQLKSYFPECDLVNFGSWFVFAFPLMLLFLILGWIWIAFLYGGLNTRLCISKNDERAAAEAKANAVIDEDYKKLGPIKFAEGSIAFFFIIFAILLFTRDPKFVTGWSVFFPKG---------YVSDAVTGVIIISILFFFPSQRPSLRWWFDSRASNTPYVPLLSWRKAQECVPWNIILLLGGGFAMAKGCEESGLAVWIGNHLQPLAQVPPPVAVMLITAFIACF-TEFASNTATIIIFLPVIAELAIRVK--VNPLYFMIPATTGCSYAFMLPVSTPPNSIAFASGHLMVKDMVKTGFVMNILGILCVS 554          
BLAST of slc13a-3 vs. Ensembl Zebrafish
Match: slc13a3 (solute carrier family 13 member 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2486])

HSP 1 Score: 192.586 bits (488), Expect = 4.312e-53
Identity = 155/548 (28.28%), Postives = 258/548 (47.08%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNE-YGKIEEGRELNDEAEQNFTHYGSTDIS-PILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKK-FKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFN--GILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLER---IKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX---XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            CLY ++++A +W  + LP  VT++LP+ L P M I  S+ +   +  +   L L  L++A A ++  +HRR  L +L   G +P  ++L  MI    L+M++SNTAT  +ML     +L   +G +E    L +  +      G + +   +L +K       Q+   ED P  T+        SE++    +   +  + K +K F + +     YAAS G  ATL    PNL+  G +   F    ++N+G++     PL ++  +L W+W+  +  G        KN  +     +    I +  K LG I FAE S         I+   R    + GW   F K          YVSDA   V+++ +L+ +P++    R   +  + ++    LL+W      +PW II LLG G A+ + C +S     +   L    +   P A++L+ A + C  TEF S+T  + I + +  +L I+ +  +N   +  P T   S+AF LP +T PN   F  G    K+M+KTG +M+I+ +L VS
Sbjct:   40 CLYVVLLMAVYWCTEALPLAVTAMLPVCLFPTMGILPSKKVCPQYFLETNFLFLSGLVMASAIEEWGLHRRIALKVLKIVGVKPAWLILGMMITSSFLSMWLSNTATTAMMLPIANAILESLFGNLE---TLKENCKTRSDPEGDSQVKMHVLPEK-------QILTVEDRPDWTDR-------SEQRNQEEVRREAEYQMKVWKGFLICIP----YAASIGGTATLTGTAPNLILVGQLKSYFPECDLVNFGSWFVFAFPLMLLFLILGWIWIAFLYGGLNTRLCISKNDERAAAEAKANAVIDEDYKKLGPIKFAEGSIAFFFIIFAILLFTRDPKFVTGWSVFFPKG---------YVSDAVTGVIIISILFFFPSQRPSLRWWFDSRASNTPYVPLLSWRKAQECVPWNIILLLGGGFAMAKGCEESGLAVWIGNHLQPLAQVPPPVAVMLITAFIACF-TEFASNTATIIIFLPVIAELAIRVK--VNPLYFMIPATTGCSYAFMLPVSTPPNSIAFASGHLMVKDMVKTGFVMNILGILCVS 554          
BLAST of slc13a-3 vs. Ensembl Zebrafish
Match: slc13a1 (solute carrier family 13 member 1 [Source:ZFIN;Acc:ZDB-GENE-031222-3])

HSP 1 Score: 191.045 bits (484), Expect = 1.342e-52
Identity = 158/563 (28.06%), Postives = 262/563 (46.54%), Query Frame = 3
Query:  132 LVHRTPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTD--ISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKR----FSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFN--GILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGP--REFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLL--LVSCYTYG 1781
            LV +T    C Y L+++A +W  +VLP  VT+L+P LL PL  I  S  ++  +  D  +L LG + LA + +K  +HRR  L L+T  G  P M+ML  M+ C  L+M++SNT+T  +++  V  V+ +         L+   E N  H G+ +   +P L  +   D  +Q   +E   S+   I   +  SE   +    T     K   R        LSL   Y++S G + TL     NL+    + + +    I+N+GN+  + LP+ II  +L+W+++  + +G   R     R+ + KE I    ++D    LG I++ EI  + +   + I+W  R  G + GW   F  N         Y +DAT  +L+  L ++ P+               + L+TW      +PW I  L+G G A+ E    S  +  V+ EL   L +  P A + +A  +    TE  S+   + I + I   L      G+N      P     SF+F LP +  PN  +F  G  ++ +M+K GL ++++ +L  L++  T+G
Sbjct:   28 LVIKTKEAECAYVLILMAVYWMTEVLPLSVTALIPALLFPLFGIMKSSQVASQYFKDFHLLLLGVICLATSIEKWGLHRRIALRLVTGLGVNPGMLMLGFMVGCAFLSMWLSNTSTVAMVMPIVEAVIQQV--------LSASEEANKDHKGALNGISNPALQLE---DIEAQHDQSEKIKSIEAGITEPEPTSEEHETAKAPTPPYSGKYRTREDHMMCKGLSLCIAYSSSIGGLTTLSGTSTNLIFAEYIYQYYPECTIVNFGNWFVLCLPICIIMLILSWLFLHWMYLGSNFRASLCSRQRTEKEKITARVLRDHYNSLGPISWQEIVTLIIFILMAILWFTRNPGFMPGWSSLFSDNPG-------YATDATVALLLGFLFFLLPS-------HKLNADHYEALITWKDFQACMPWEISLLVGGGFALAEGTKISGLSSWVA-ELLTPLGSLPPLATVTIACLIVTSITEVASNAATMTIFLPILAPL--AEAIGVNPLYMLIPTALAVSFSFLLPVSNPPNAIVFTYGHLTSMDMVKAGLGVNVIGILTVLLALTTWG 562          
BLAST of slc13a-3 vs. Ensembl Xenopus
Match: slc13a2 (solute carrier family 13 member 2 [Source:NCBI gene;Acc:493460])

HSP 1 Score: 201.445 bits (511), Expect = 6.926e-56
Identity = 163/574 (28.40%), Postives = 272/574 (47.39%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEG-RELNDEAEQNFTHYGSTDISPILS--------QKNYGDFNSQLTMNED----YPSMTNVIEVSKIFSERKFSTSISTRSILE-KKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF---NGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIG--PREFFACRKNS---SKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGC-AFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXX----------XXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAII----LLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            C + ++V+A FW  + LP  VT+L P+LL P+M I  S  +   +  D  +L +G L++A + +K  +H+R  L +L   G +P +++L  M+    L+M+ISNTAT  +M+     VL +    EE   + ++E ++N     ++    +L         +  Y   N    M +      PS      +  I  E +       +  L  +K  +    ++L   Y+AS G IATL    PNLV  G +D+ F   N ++N+ ++     P   +   L+W+W+  + +G   ++ F C  NS    KE    + I    K LG +TFAEIS + L   ++++W  R+ G + GW   +F K+      G+  V+DAT  + V ++++ +P+    ++     D+              LL W   N  +PW I+ LLG G A+ +   +S  +  +  +LT  L++  P AI     LL AT    T+   ++T  LPIL S+   +       LN      P T  +S AF LP AT PN   F+ G     +M K GLL++I+ +L ++
Sbjct:   38 CGFVIIVMALFWCTEALPLAVTALFPVLLFPMMGIMDSTAVCSQYLKDTNMLFIGGLLVAISVEKWNLHKRIALRVLLIVGVKPALLLLGFMVVTAFLSMWISNTATTAMMIPIAQAVLQQLHTSEERVDKPSEETKKNVNGMDNSMYESVLPNGKMILAVENTYATVNEGFEMQDSTKDPEPSKLEKESIGPIVIELEDEKQKEEKQKLRLEKHLKICKGMTLSVCYSASIGGIATLTGTTPNLVMKGQMDELFPENNNVINFASWFGFAFPTMFVLLALSWLWLQFMFLGFNFKKNFGCGGNSEQKEKEKRAFKIISGEHKKLGAMTFAEISVLVLFILLVLLWFTREPGFMPGWATISFNKD------GKEMVTDATVAIFVSLMMFFFPSELPSFKYREDTDTEKPGMKPKFRVPPALLDWKTVNEKMPWNIVILLGGGFALAKGSEESGLSLWLGEKLTP-LQSIPPAAIALILCLLVATFTECTSNVATTTLFLPILASMAKAIH------LNPLYIMLPCTLSASLAFMLPVATPPNAIAFSYGQLKVIDMAKAGLLLNILGVLTIT 598          
BLAST of slc13a-3 vs. Ensembl Xenopus
Match: slc13a3 (solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 [Source:NCBI gene;Acc:548493])

HSP 1 Score: 191.815 bits (486), Expect = 1.347e-52
Identity = 163/555 (29.37%), Postives = 268/555 (48.29%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLN----EYGKIEEGRELNDEAEQNFT--HYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNG--ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLE---RIKDLLKD----LGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX---XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            CL+ ++++A +W  + LP  VT+LLPI+L PL+ I  S  +   +  D   L L  L++A A ++  +HRR  L +LT  G QP  ++L  M+    L+M++SNTA+  +ML     +L     E    E+G   N ++  N T    G T++  + + +   D   ++    D P+ T+      +  E+++   I         +K F +++     Y+AS G  ATL    PNL+  G +   F G  ++N+G++ A   PL I+   + W+W+  ++ G       RK   K DI  E   + KD++++    LG   FAE S         I+   R    I GW  AF    T G     + SDA   + + I+L+ +P+     +   +  + ++ N  LL+W      +PW II LLG G A+ + C  S  +  +   L   L+  SP   +LL   L    TEF S+T  + + + I  +L I+ +  +N      P T   S+AF LP +T PN   F+ G    K+M KTGL+M+++ +LL+S
Sbjct:   41 CLFVVLLMAFYWCTEALPLAVTALLPIVLFPLLGILPSSKVCPQYFLDTNFLFLSGLLMAAAIEEWNLHRRIALKVLTLVGVQPARLILGMMMTTAFLSMWLSNTASTAMMLPIANAILKSLYGERSSKEKGLNNNCDSTGNTTCLQPGPTEMQLLAANEENKDLPEKI----DIPTDTH----PDLQKEKEYQNRI---------WKAFLISIP----YSASIGGTATLTGTAPNLILLGQLKSFFPGCDVVNFGSWFAFAFPLMILFLFVGWLWISVLH-GAISLRCKRKK--KSDIRSEAESKAKDIIQEDYRKLGPTNFAEKSVFVFFCLFAILLFTRDPKFIPGWASAF----TPG-----FTSDAVTGISICIVLFFFPSEKPSLKWWFDLKAPNTENKALLSWKKAQSTVPWNIILLLGGGFAMAKGCEVSGLSTWIGSRL-QPLEGISPALAVLLVTVLIASFTEFASNTATIIVFLPILSELAIRLK--VNPLYLMVPGTVGCSYAFMLPVSTPPNSIAFSTGHLMVKDMAKTGLVMNLMGVLLLS 559          
BLAST of slc13a-3 vs. Ensembl Xenopus
Match: nppb (natriuretic peptide B [Source:Xenbase;Acc:XB-GENE-487178])

HSP 1 Score: 186.037 bits (471), Expect = 1.915e-50
Identity = 165/558 (29.57%), Postives = 261/558 (46.77%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNS-QLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF--NG-ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIG--PREFFACRKNSS-KEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVG-TIGWGCA-FQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX---------------XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLS----STTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIV 1748
            C Y ++++A +W  +V+P  VT+LLP+LL P+  I  S+ +   +  D  +L +G LI+A A +   +H+R  L +L   G +P ++ML  M     L+M+ISNTAT  +M+  V  VL++     E   + +  E      G T+ +  L  KN       Q+  N       +V E+ +   E+              + KR S  + L   YAAS G  ATL   GPNLV  G   + F  NG ILN+ ++     P   +   ++W W+    IG   ++ + C   +S KE      I++  + LG I++AE S + L   ++++W  R  G  IGW    F K+         YV+DAT  V V  LL+I P                       +      +  LLTW   ++ +PW+I+ LLG G A+ +  + S  +  +  ++   L    P+AI ++ + +  V TE  S    +T  LPIL S      +    G+N      P T  +SFAF LP AT PN  +F+ G     +M+KTG++M+I+
Sbjct:   54 CAYCIILMAVYWCTEVIPLAVTALLPVLLFPMFGILESKKVCMQYLKDTNMLFVGGLIVAVAVEHWNLHKRIALKVLLIVGVRPALLMLGFMGVTAFLSMWISNTATTAMMVPIVQAVLSQLNTAGEDPSMLESLE------GQTNPALELETKNAIPLEPVQIVSN------GHVAEIPEEAPEK-------------DERKRISKGMMLCVCYAASIGGTATLTGTGPNLVLKGQFTQIFPNNGDILNFASWFGFAFPNMAVMLCMSWFWLQFSFIGFNFKKTWGCGATTSEKERAAYNVIREEYRKLGPISYAESSVLFLFILLVLLWFTRDPGFVIGWATILFNKDNIE------YVTDATVAVFVAFLLFILPASRPKISCCKARKSFDLEEFEQAEEKDTFFSAPLLTWKVVHKQMPWSIVLLLGGGFALAKGSDASGLSHWLGQQMAP-LHTIPPWAIAIILSLMIAVFTECASNVATATLFLPILAS------MTRSIGVNPLYIMIPCTLSTSFAFMLPVATPPNAIVFSYGHLRVSDMVKTGIVMNII 573          
BLAST of slc13a-3 vs. Ensembl Xenopus
Match: pias3 (protein inhibitor of activated STAT 3 [Source:Xenbase;Acc:XB-GENE-486632])

HSP 1 Score: 182.57 bits (462), Expect = 2.601e-49
Identity = 160/569 (28.12%), Postives = 272/569 (47.80%), Query Frame = 3
Query:  138 HRTPGFL---CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTD-------------ISPILSQKNYGDFNSQL---TMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILE-KKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGI--LNYGNFIAIGLPLSIITFLLTWVWVGTVNIG--PREFFAC-RKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXX-XXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLV 1763
             R+P  L   C Y L V+A FW  + LP  VT+ LP L+ PL  I  S+ ++ T+  D  +L  G + LA + +K  +H+R  L ++   G  P  +ML  M     L+M++SNT+TA +++  V  V  +         +N EAE +    GST              +     +KN   F S +    MN   PS+T +I + K  S +      S +     KK      A+ L   Y+++ G + T+     NL+ F    +++ G   +N+G +  + +P+++I  +L+W+W+  +  G   +E F C ++ + +E    + IKD  + LG +++ EI  + L   + ++W  R  G I GW   F K     + G  Y +D+T  +L+ +L +I P         D S   S   L+TW      +PW I  L+G G A+ E C  S  +Q ++ ++T  L +   +++IL+++ +    TE  S+   + I + I   L       +N      P T C+SFAF LP +  PN  +F+ G     +M+K GL ++I+ +L+V
Sbjct:    8 QRSPILLMSECAYVLFVVAIFWLSEALPLSVTAFLPALMFPLFGILPSKAVAATYFKDFHLLLTGVICLATSIEKWNLHKRIALRMVMLVGVNPGWLMLGFMFSAGFLSMWLSNTSTAAMVMPIVEAVAQQI--------INAEAEVDAMQTGSTGGIDNEALELDGKYMFIFFKKKNRYVFQSVILTSKMNAK-PSITVIIGLIKENSGKNEQPVSSDKKRYRCKKDHMMCKAMGLCIAYSSTIGGLTTITGTSTNLI-FAEQFQRYPGSTDINFGTWFILCIPIAVILMILSWIWLQWLFFGFDFKEMFKCGKERTDREKASAKVIKDEYEKLGPLSYQEIITLILFILMALLWFTRDPGFIPGWATLFPK-----YMG--YATDSTAALLLGLLFFIIPAYPWIRGTKDKSNSFSYVPLITWKEFQACMPWDICILVGGGFALAEGCEVSGLSQWIANKMTP-LGSLPIWSVILISSLIVTTVTEVASNPATITIFLPILAPLA--EAINVNPLYILIPTTLCTSFAFLLPVSNPPNAIVFSYGHLQVMDMVKAGLGINIMGVLVV 556          
BLAST of slc13a-3 vs. Ensembl Xenopus
Match: slc13a3 (solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 [Source:NCBI gene;Acc:548493])

HSP 1 Score: 181.8 bits (460), Expect = 3.489e-49
Identity = 160/551 (29.04%), Postives = 258/551 (46.82%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIF--SERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNG--ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLE---RIKDLLKD----LGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX---XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            CL+ ++++A +W  + LP  VT+LLPI+L PL+ I  S  +   +  D   L L  L++A A ++  +HRR  L +LT  G QP  ++L  M+    L+M++SNTA+  +ML     +L                      YG        S K  G       +N +  S  N  E S +   S++ F TS+  +    + +K F +++     Y+AS G  ATL    PNL+  G +   F G  ++N+G++ A   PL I+   + W+W+  ++       + RK   K DI  E   + KD++++    LG   FAE S         I+   R    I GW  AF            + SDA   + + I+L+ +P+     +   +  + ++ N  LL+W      +PW II LLG G A+ + C  S  +  +   L   L+  SP   +LL   L    TEF S+T  + + + I  +L I+ +  +N      P T   S+AF LP +T PN   F+ G    K+M KTGL+M+++ +LL+S
Sbjct:   41 CLFVVLLMAFYWCTEALPLAVTALLPIVLFPLLGILPSSKVCPQYFLDTNFLFLSGLLMAAAIEEWNLHRRIALKVLTLVGVQPARLILGMMMTTAFLSMWLSNTASTAMMLPIANAILKSL-------------------YGER------SSKEKG-------LNNNCDSTGNTKEHSLLGGGSDQSF-TSLKEKEYQNRIWKAFLISIP----YSASIGGTATLTGTAPNLILLGQLKSFFPGCDVVNFGSWFAFAFPLMILFLFVGWLWISVLHGA----ISLRKK--KSDIRSEAESKAKDIIQEDYRKLGPTNFAEKSVFVFFCLFAILLFTRDPKFIPGWASAFTPG---------FTSDAVTGISICIVLFFFPSEKPSLKWWFDLKAPNTENKALLSWKKAQSTVPWNIILLLGGGFAMAKGCEVSGLSTWIGSRL-QPLEGISPALAVLLVTVLIASFTEFASNTATIIVFLPILSELAIRLK--VNPLYLMVPGTVGCSYAFMLPVSTPPNSIAFSTGHLMVKDMAKTGLVMNLMGVLLLS 536          
BLAST of slc13a-3 vs. Ensembl Mouse
Match: Slc13a3 (solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 [Source:MGI Symbol;Acc:MGI:2149635])

HSP 1 Score: 194.126 bits (492), Expect = 1.720e-53
Identity = 155/548 (28.28%), Postives = 268/548 (48.91%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNE-YGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFN--GILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSK-----EDIFLERIKDLLKDLGRITFAEISC-IGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX---XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            CLY ++++A +W  + LP  VT+LLPI+L P M I  S  +   +  D   L L  LI+A A ++  +HRR  L +L   G QP  ++L  M+    L+M++SNTA+  +ML     +L   +G+ E  ++L  E +++        +  + ++  +   +S+    ED  +   + + SK    R        R+I    +K F +++     Y+AS G  ATL    PNL+  G +   F    ++N+G++     PL ++  L+ W+W+  +  G   + + RK  SK     ED     I++  ++LG I FAE +  I    F I+++        GW   F            +VSDA   V +V +L+ +P++    +   +  + +S  + LL+W      +PW II LLG G A+ + C +S  +  +  +L   L++  P   +LL   +    TEF S+T  + I + +  +L I+    ++      P T   S+AF LP +T PN   F+ G    K+M++TGLLM+++ +LL+S
Sbjct:   41 CLYVILLMAVYWCTEALPLSVTALLPIILFPFMGILPSSKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKVLMLVGVQPARLILGMMVTTSFLSMWLSNTASTAMMLPIASAILKSLFGQREARKDLPREGDESTAAVQGNGLRTVPTEMQFLA-SSEGGHTEDAEAPMELPDDSKEEEHR--------RNI----WKGFLISIP----YSASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLVGWLWISFL-YGGMSWRSWRKKKSKIRADAEDQAKAVIQEEFQNLGPIKFAEQAVFILFCTFAILLFSRDPKFIPGWASLFAPG---------FVSDAVTGVAIVTILFFFPSQKPSLKWWFDFKAPNSETEPLLSWKKAQETVPWNIILLLGGGFAMAKGCEESGLSAWIGGQL-HPLEHVPPLLAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLH--VHPLYLMIPGTVGCSYAFMLPVSTPPNSIAFSTGHLLVKDMVRTGLLMNLMGVLLLS 558          
BLAST of slc13a-3 vs. Ensembl Mouse
Match: Slc13a2 (solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2 [Source:MGI Symbol;Acc:MGI:1276558])

HSP 1 Score: 190.274 bits (482), Expect = 3.635e-52
Identity = 155/550 (28.18%), Postives = 260/550 (47.27%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF---NGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIG---PREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTX---XXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLS----STTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            C Y ++++A  W  + LP  VT+L PI+L PLM I  +  +   +  D  IL +G L++A A +   +H+R  L +L   G +P +++L  M+    L+M+ISNTAT  +ML         Y  +E+ +    + E+                   G+ N    + E  P      E +K+ + +  S S   R+   K+  RFS  LSL   Y+AS G IATL    PNLV  G V+  F   + ++N+ ++     P  +I  LL W+W+  + +G    + F        ++    + IK   + LG ++FAE +   L   ++++W  R+ G   GWG      A A   G+  VSD T  + + ++++I P++            +  +   +LTW   N  +PW I+ LLG G A+ +   +S  ++ +  +LT  L++  P A +L+ + L  + TE  S    +T  LPIL S      +     L+      P T  +S AF LP AT PN  +F+ G     +M + G L++I+ +L ++
Sbjct:   38 CAYSIILMALLWCTEALPLAVTALFPIILFPLMGIMEASKVCLEYFKDTNILFVGGLMVAIAVEHWNLHKRIALGVLLIIGVRPALLLLGFMLVTAFLSMWISNTATTAMMLPI------GYAVLEQLQGSQKDVEE-------------------GNSNPSFELQEASPQK----EETKLDNGQAVSVSSEPRAQKTKEHHRFSQGLSLCICYSASIGGIATLTGTTPNLVLQGQVNSIFPENSNVVNFASWFGFAFPTMVILLLLAWLWLQVLFLGVNFRKNFGFGEGEEERKQAAFQVIKTQHRLLGPMSFAEKAVTFLFVLLVVLWFTREPGFFPGWG----DTAFANKKGQSMVSDGTVAIFISLIMFIIPSKIPGLTEDPKKPGKLKAPPAILTWKTVNDKMPWNILILLGGGFALAKGSEESGLSKWLGDKLTP-LQHVPPSATVLILSLLVAIFTECTSNVATTTLFLPILAS------MAQAICLHPLYVMLPCTLAASLAFMLPVATPPNAIVFSFGGLKVSDMARAGFLLNIIGVLTIT 547          
BLAST of slc13a-3 vs. Ensembl Mouse
Match: Slc13a4 (solute carrier family 13 (sodium/sulfate symporters), member 4 [Source:MGI Symbol;Acc:MGI:2442367])

HSP 1 Score: 183.341 bits (464), Expect = 2.004e-49
Identity = 146/591 (24.70%), Postives = 270/591 (45.69%), Query Frame = 3
Query:  135 VHRTPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNF------THYGSTDISPILSQKNYGDFNSQLTMN--EDYPSMTNVIEVSKIF-------SERK---FSTSISTRSILEKKFKRFS-----LALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNG--ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFAC----RKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTX-----XXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSS----TTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFL--LLVSCYTYGV 1784
            ++ T    C Y L+V A +W  + +P G  +L+P  L P   +  S  ++  +  +  +L +G + +A A +K  +H+R  L ++   G +P M++L  M    +L+M++SNT+T  +++  V  VL E    EE +      E             S ++  +    +  DF S +        P +T  I  +          S+ K    + S  T+ + +KK++          LSL   YAA+ G + T++    +L+     + Q+    ++N+G +     P+S+I  +++W W+  + +G      C    +K + +E++  +RI++  + LG I++ E+        + ++W  R+ G + GW   F+K          Y +DAT  V +  LL++ P +                   + ++TW    + +PW I+ L+G G A+      S  +  + +++   L +  P+AI LLA  L  + TEF+S+    T  LPIL ++   L I      N      P+T   SFA  LP    PN  +F+ G    K+M+K GL ++++ L  ++V+  T+GV
Sbjct:   29 IYPTSEAACAYVLLVTAVYWVSEAVPLGAAALVPAFLYPFFGVLRSSEVAAEYFKNTTLLLVGVICVAAAVEKWNLHKRIALRMVLMAGAKPGMLLLCFMCCTTMLSMWLSNTSTTAMVMPIVEAVLQELINAEEEQLAAGTEEAELMGLDVNNRQTSMELIFVNEDTSAADFTSLMQSKNLNGVPMVTKSINTANQQQQKKQQPSQEKPGVPTPSSKTQELNKKKYRSHHDQMICKCLSLSISYAATIGGLTTIIGTSTSLIFLEHFNNQYPAAEVVNFGTWFLFSFPISLIMLVVSWFWIHWLFLGCNFKETCSLSKKKKTRREELSEKRIREEYEKLGDISYPEMVTAFFFILMTVLWFTREPGFVPGWDSFFEKKG--------YRTDATVSVFLGFLLFLIPAKKPCFGKKSDGTGQEASKGIEPIITWKDFQKTMPWEIVILVGGGYALASGSKSSGLSTWIGHQMLS-LSSLPPWAITLLACVLVSIVTEFVSNPATITIFLPILCTLSETLHI------NPLYTLVPVTMSISFAVMLPVGNPPNAIVFSYGHCQIKDMVKAGLGVNVIGLVIVMVAINTWGV 604          
BLAST of slc13a-3 vs. Ensembl Mouse
Match: Slc13a5 (solute carrier family 13 (sodium-dependent citrate transporter), member 5 [Source:MGI Symbol;Acc:MGI:3037150])

HSP 1 Score: 162.925 bits (411), Expect = 1.460e-42
Identity = 151/558 (27.06%), Postives = 257/558 (46.06%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF---NGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFAC----RKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GW-GCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXX------XLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLV--SCYTYG 1781
            C Y +V++A +W  DV+P  VTSLLP+LL PL+ +  S+ +   +  D  +L LG LI+A A ++ ++H+R  L +L   G +P  +ML  M     L+M+ISNTA   +M+  V  +L +        E +    +      ++++    SQ  + D N Q   +E+  +M                                  A+ L   Y+AS G  ATL   GPN+V  G + + F     +LNY ++     P  ++  +L W+W+  + +       C     K    E I  + + +  + LG +++ E + +     ++I+W  R  G + GW   A+ +  T      ++++DAT  + V ILL+I P++   +   S  +           LL W      +PW I+ LLG G A+ + C  S  ++ ++ ++ + L+   P  I L+ + L  +TTE  S+     + + IF  +      G++      P T  +S AF LP AT PN  +F  G     +M+KTGL+M+ V +L V  S  T+G
Sbjct:   38 CAYVIVIMAVYWCTDVIPVAVTSLLPVLLFPLLKVLDSKQVCIQYMKDTNMLFLGSLIVAVAVERWKLHKRVALRMLLFVGTKPSRLMLGFMFVTAFLSMWISNTAATAMMIPIVEAMLQQMIAANTAVEASLGTLELLDKNKTSELPG--SQVVFEDPNVQEQEDEETKNMYK--------------------------------AMHLCVCYSASIGGTATLTGTGPNVVLLGQMQELFPDSKDVLNYASWFGFAFPNMVMMLVLAWLWLQCLYMRHNLKKTCICCGEKKRDTEKIAYKVLNEEYQKLGSLSYPECNVLFCFTLLVILWFSRDPGFMPGWLSFAWVEGNT------VHITDATVAIFVAILLFIIPSQKPKFNFSSQTEEERKTPFYPPALLDWKVAQEKVPWDIVLLLGGGFAMAKGCETSGLSKWMAAQM-EPLRLVKPAVITLILSCLVAMTTECTSNVATTTLFLPIFASM--ARSIGIHPLYVMIPCTMSASLAFMLPVATPPNAIVFAYGHLRVVDMMKTGLIMNFVGILSVFLSVNTWG 552          
BLAST of slc13a-3 vs. Ensembl Mouse
Match: Slc13a3 (solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 [Source:MGI Symbol;Acc:MGI:2149635])

HSP 1 Score: 160.614 bits (405), Expect = 7.734e-42
Identity = 140/541 (25.88%), Postives = 243/541 (44.92%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNE-YGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISC-IGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX---XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            CLY ++++A +W  + LP  VT+LLPI+L P M I  S  +   +  D   L L  LI+A A ++  +HRR  L +L   G QP  ++L  M+    L+M++SNTA+  +ML     +L   +G+ E  ++L  E +++        +  + ++  +   +S+    ED  +   + + SK    R+              +K F +++     Y+AS G  ATL    PNL+  G + +                                           +  +  ED     I++  ++LG I FAE +  I    F I+++        GW   F            +VSDA   V +V +L+ +P++    +   +  + +S  + LL+W      +PW II LLG G A+ + C +S  +  +  +L   L++  P   +LL   +    TEF S+T  + I + +  +L I+    ++      P T   S+AF LP +T PN   F+ G    K+M++TGLLM+++ +LL+S
Sbjct:   41 CLYVILLMAVYWCTEALPLSVTALLPIILFPFMGILPSSKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKVLMLVGVQPARLILGMMVTTSFLSMWLSNTASTAMMLPIASAILKSLFGQREARKDLPREGDESTAAVQGNGLRTVPTEMQFLA-SSEGGHTEDAEAPMELPDDSKEEEHRR------------NIWKGFLISIP----YSASIGGTATLTGTAPNLILLGQLKRS------------------------------------WRKKKSKIRADAEDQAKAVIQEEFQNLGPIKFAEQAVFILFCTFAILLFSRDPKFIPGWASLFAPG---------FVSDAVTGVAIVTILFFFPSQKPSLKWWFDFKAPNSETEPLLSWKKAQETVPWNIILLLGGGFAMAKGCEESGLSAWIGGQL-HPLEHVPPLLAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLH--VHPLYLMIPGTVGCSYAFMLPVSTPPNSIAFSTGHLLVKDMVRTGLLMNLMGVLLLS 516          
BLAST of slc13a-3 vs. UniProt/SwissProt
Match: sp|Q8WWT9|S13A3_HUMAN (Solute carrier family 13 member 3 OS=Homo sapiens OX=9606 GN=SLC13A3 PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 3.432e-54
Identity = 156/549 (28.42%), Postives = 262/549 (47.72%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNE-YGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKR-FSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFN--GILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSK-----EDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX---XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            CL+ ++++A +W  + LP  VT+LLPI+L P M I  S  +   +  D   L L  LI+A A ++  +HRR  L +L   G QP  ++L  M+    L+M++SNTA+  +ML     +L   +G+ E  ++ + E+E+N        +  + ++  +       T  +D+P  T V               +   S  E +++R       +   Y+AS G  ATL    PNL+  G +   F    ++N+G++     PL ++  L  W+W+  +  G   F   RKN S+     ED     I++  ++LG I FAE +   L     I+   R    I GW   F            ++SDA   V +V +L+ +P++    +   +  + ++  + LLTW      +PW II LLG G A+ + C +S  +  +  +L   L+N  P   +LL   +    TEF S+T  + I + +  +L I+ +  ++      P T   SFAF LP +T PN   F  G    K+M++TGLLM+++ +LL+S
Sbjct:   41 CLFVILLMAVYWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKILMLVGVQPARLILGMMVTTSFLSMWLSNTASTAMMLPIANAILKSLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQF----LASTEAKDHPGETEV------------PLDLPADSRKEDEYRRNIWKGFLISIPYSASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLAGWLWISFL-YGGLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMFAILLFTRDPKFIPGWASLFNPG---------FLSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQL-HPLENVPPALAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLR--VHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLLVKDMVRTGLLMNLMGVLLLS 560          
BLAST of slc13a-3 vs. UniProt/SwissProt
Match: sp|Q9Z0Z5|S13A3_RAT (Solute carrier family 13 member 3 OS=Rattus norvegicus OX=10116 GN=Slc13a3 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 4.332e-53
Identity = 152/547 (27.79%), Postives = 265/547 (48.45%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNE-YGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFN--GILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLER----IKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX---XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            CLY ++++A +W  + LP  VT+LLPI+L P M I  S  +   +  D   L L  LI+A A ++  +HRR  L +L   G QP  ++L  M+    L+M++SNTA+  +ML     +L   +G+ +  ++L  E E +        +  + ++  +   +S+    ED  +   + + SK    R+              +K F +++     Y+AS G  ATL    PNL+  G +   F    ++N+G++     PL ++  L+ W+W+  +  G       +KNS  +D+  ++    I++  ++LG I FAE +   L     I+   R    I GW   F            +VSDA   V +V +L+ +P++    +   +  + +S  + LL+W      +PW II LLG G A+ + C +S  +  +  +L   L++  P   +LL   +    TEF S+T  + I + +  +L I+    ++      P T   S+AF LP +T PN   F+ G    K+M++TGLLM+++ +LL+S
Sbjct:   41 CLYVILLMAVYWCTEALPLSVTALLPIILFPFMGILPSSKVCPQYFLDTNFLFLSGLIMASAIEERNLHRRIALKVLMLVGVQPARLILGMMVTTSFLSMWLSNTASTAMMLPIASAILKSLFGQRDTRKDLPREGEDSTAAVRGNGLRTVPTEMQFLA-SSEGGHAEDVEAPLELPDDSKEEEHRR------------NIWKGFLISIP----YSASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLVGWLWISFLYGGMSWRGWRKKNSKLQDVAEDKAKAVIQEEFQNLGPIKFAEQAVFILFCLFAILLFSRDPKFIPGWASLFAPG---------FVSDAVTGVAIVTILFFFPSQKPSLKWWFDFKAPNSETEPLLSWKKAQETVPWNIILLLGGGFAMAKGCEESGLSAWIGGQL-HPLEHVPPLLAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLH--VHPLYLMIPGTVSCSYAFMLPVSTPPNSIAFSTGHLLVKDMVRTGLLMNLMGVLLLS 558          
BLAST of slc13a-3 vs. UniProt/SwissProt
Match: sp|Q91Y63|S13A3_MOUSE (Solute carrier family 13 member 3 OS=Mus musculus OX=10090 GN=Slc13a3 PE=1 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.203e-52
Identity = 155/548 (28.28%), Postives = 268/548 (48.91%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNE-YGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFN--GILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSK-----EDIFLERIKDLLKDLGRITFAEISC-IGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX---XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            CLY ++++A +W  + LP  VT+LLPI+L P M I  S  +   +  D   L L  LI+A A ++  +HRR  L +L   G QP  ++L  M+    L+M++SNTA+  +ML     +L   +G+ E  ++L  E +++        +  + ++  +   +S+    ED  +   + + SK    R        R+I    +K F +++     Y+AS G  ATL    PNL+  G +   F    ++N+G++     PL ++  L+ W+W+  +  G   + + RK  SK     ED     I++  ++LG I FAE +  I    F I+++        GW   F            +VSDA   V +V +L+ +P++    +   +  + +S  + LL+W      +PW II LLG G A+ + C +S  +  +  +L   L++  P   +LL   +    TEF S+T  + I + +  +L I+    ++      P T   S+AF LP +T PN   F+ G    K+M++TGLLM+++ +LL+S
Sbjct:   41 CLYVILLMAVYWCTEALPLSVTALLPIILFPFMGILPSSKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKVLMLVGVQPARLILGMMVTTSFLSMWLSNTASTAMMLPIASAILKSLFGQREARKDLPREGDESTAAVQGNGLRTVPTEMQFLA-SSEGGHTEDAEAPMELPDDSKEEEHR--------RNI----WKGFLISIP----YSASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLVGWLWISFL-YGGMSWRSWRKKKSKIRADAEDQAKAVIQEEFQNLGPIKFAEQAVFILFCTFAILLFSRDPKFIPGWASLFAPG---------FVSDAVTGVAIVTILFFFPSQKPSLKWWFDFKAPNSETEPLLSWKKAQETVPWNIILLLGGGFAMAKGCEESGLSAWIGGQL-HPLEHVPPLLAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLH--VHPLYLMIPGTVGCSYAFMLPVSTPPNSIAFSTGHLLVKDMVRTGLLMNLMGVLLLS 558          
BLAST of slc13a-3 vs. UniProt/SwissProt
Match: sp|Q86YT5|S13A5_HUMAN (Solute carrier family 13 member 5 OS=Homo sapiens OX=9606 GN=SLC13A5 PE=1 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 4.125e-52
Identity = 168/563 (29.84%), Postives = 263/563 (46.71%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEY----GKIEEGRELNDEAEQNFTHYGSTDI--SPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF---NGILNYGNFIAIGLPLSIITFLLTWVWVGTV--NIGPREFFACRKNSSK-EDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GW-GCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXX------LLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDI--VFLLLVSCYTYG 1781
            C Y ++++A +W  +V+P  VTSL+P+LL PL  I  S+ +   +  D  +L LG LI+A A ++  +H+R  L  L   G +P  +ML  M    +L+M+ISNTAT  +M+  V  +L +        E G EL D+ +      GS  I   P L Q+            ED               ERK                R   A++L   YAAS G  ATL   GPN+V  G +++ F     ++N+ ++ A   P  ++  L  W+W+  V      ++ + C   S K E   L+ +++  + LG ++FAEI+ +     ++I+W  R  G + GW   A+ +  T       YVSDAT  + V  LL+I P++   +   S  +           LL W  T   +PW I+ LLG G A+ +    S  +  +  ++ + L    P AI L+ + L  V TE  S+     + + IF  +      GLN      P T  +SFAF LP AT PN  +F  G     +M+KTG++M+I  VF + ++  T+G
Sbjct:   38 CAYVIILMAIYWCTEVIPLAVTSLMPVLLFPLFQILDSRQVCVQYMKDTNMLFLGGLIVAVAVERWNLHKRIALRTLLWVGAKPARLMLGFMGVTALLSMWISNTATTAMMVPIVEAILQQMEATSAATEAGLELVDKGKAK-ELPGSQVIFEGPTLGQQ------------ED--------------QERK----------------RLCKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWFAFAFPNMLVMLLFAWLWLQFVYMRFNFKKSWGCGLESKKNEKAALKVLQEEYRKLGPLSFAEINVLICFFLLVILWFSRDPGFMPGWLTVAWVEGETK------YVSDATVAIFVATLLFIVPSQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPWGIVLLLGGGFALAKGSEASGLSVWMGKQM-EPLHAVPPAAITLILSLLVAVFTECTSNVATTTLFLPIFASMS--RSIGLNPLYIMLPCTLSASFAFMLPVATPPNAIVFTYGHLKVADMVKTGVIMNIIGVFCVFLAVNTWG 548          
BLAST of slc13a-3 vs. UniProt/SwissProt
Match: sp|Q9UKG4|S13A4_HUMAN (Solute carrier family 13 member 4 OS=Homo sapiens OX=9606 GN=SLC13A4 PE=1 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 7.637e-52
Identity = 153/589 (25.98%), Postives = 279/589 (47.37%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEE-----GRELNDEAEQNFTHYGSTDISPIL---SQKNYGDFNSQLTMNED---YPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSL--------------ALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNG--ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFAC----RKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGF----VIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXXL-----LTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSS----TTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFL--LLVSCYTYGV 1784
            C Y L+V A +W  + +P G  +L+P  L P   +  S  ++  +  +  +L +G + +A A +K  +H+R  L ++   G +P M++L  M    +L+M++SNT+T  +++  V  VL E    E+     G    +EAE       ++  S  L   ++++  D  + L  NE+    PS+TN I+ +     +K   S     +L    ++  L               LSL   Y+A+ G + T++    +L+     + Q+    ++N+G +     P+S+I  +++W W+  + +G      C    +K + +E +  +RI++  + LG I++ E+    +TGF    + ++W  R+ G + GW   F+K          Y +DAT  V +  LL++ P +   +   +  ++    L     +TW    + +PW I+ L+G G A+      S  +  +  ++   L +  P+A+ LLA  L  + TEF+S+    T  LPIL S+   L I      N      P+T C SFA  LP    PN  +F+ G    K+M+K GL ++++ L  ++V+  T+GV
Sbjct:   37 CAYVLIVTAVYWVSEAVPLGAAALVPAFLYPFFGVLRSNEVAAEYFKNTTLLLVGVICVAAAVEKWNLHKRIALRMVLMAGAKPGMLLLCFMCCTTLLSMWLSNTSTTAMVMPIVEAVLQELVSAEDEQLVAGNSNTEEAEPISLDVKNSQPSLELIFVNEESNADLTT-LMHNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLSLSISYSATIGGLTTIIGTSTSLIFLEHFNNQYPAAEVVNFGTWFLFSFPISLIMLVVSWFWMHWLFLGCNFKETCSLSKKKKTKREQLSEKRIQEEYEKLGDISYPEM----VTGFFFILMTVLWFTREPGFVPGWDSFFEKKG--------YRTDATVSVFLGFLLFLIPAKKPCFGKKNDGENQEHSLGTEPIITWKDFQKTMPWEIVILVGGGYALASGSKSSGLSTWIGNQMLS-LSSLPPWAVTLLACILVSIVTEFVSNPATITIFLPILCSLSETLHI------NPLYTLIPVTMCISFAVMLPVGNPPNAIVFSYGHCQIKDMVKAGLGVNVIGLVIVMVAINTWGV 605          
BLAST of slc13a-3 vs. TrEMBL
Match: A0A0H3YF83 (Slc13a-3 OS=Schmidtea mediterranea OX=79327 GN=slc13a-3 PE=2 SV=1)

HSP 1 Score: 1101.27 bits (2847), Expect = 0.000e+0
Identity = 580/580 (100.00%), Postives = 580/580 (100.00%), Query Frame = 3
Query:   69 MKTSXXXXXXXXXXXXXXXXALVHRTPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVSCYTYGVVGHIIKTD 1808
            MKTSIKIVCFILIPIICLPIALVHRTPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTRWDFWRNDSSRDSSNDRLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVSCYTYGVVGHIIKTD
Sbjct:    1 MKTSIKIVCFILIPIICLPIALVHRTPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTRWDFWRNDSSRDSSNDRLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVSCYTYGVVGHIIKTD 580          
BLAST of slc13a-3 vs. TrEMBL
Match: A0A4S2L1X0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010199 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 4.213e-79
Identity = 171/571 (29.95%), Postives = 285/571 (49.91%), Query Frame = 3
Query:  165 YQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEG-RELN-----DEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGI--LNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAF--QKNATAGHCGEMYVSDATPMVLVVILLYIWPTXX-------------------XXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIV--FLLLVSCYTYGV 1784
            Y L+++A +W  +V+P  VT+L P+ LAP++ +  S  I   +  D ++L +G L +AC  +   +HRR  L +L   G  P+M+ML  M+P + L+M++SNTAT  +M+  V  V+     IE   RELN     +   +       ++++    +       +Q    E  PS  +    SK+  E     S+   S+     + F+  LSL   YA++ G +AT+   GPN + FG V+ ++  +  LN+G+++A  LP+SI+ FL+TW+ +  + IGP+ F  C+ +  +  +  E +    K LG  T+AE SC  L   +  +W+ R +G  GW   F  +KN T     ++YVSD+ P +L+ +L    P                      +   +  +    N+ LL W    + +PW +IF+LG G A++++C  S  +  +   LT+ +       ++   + LG   TE  S+   + IL+ I   L    +  ++ F    P T  +SFAFCLPAAT PN  +F RG    K+MIK+GL ++I    + LV+  +Y V
Sbjct:   47 YILLLMAGYWLTEVIPIYVTALFPVFLAPVLGLIPSSKICPAYMKDTVMLFVGGLFVACTIEHRNLHRRIALSVLKVVGSDPKMLMLGVMLPTWFLSMWMSNTATTAMMITIVEAVIISMDAIEVAIRELNETKFVESVSECLDSQRDSEVTEPRDKLPVASVGNQALTVEHVPSPID----SKVDPE-----SLDQESMRYVNLRGFNTGLSLAVCYASTCGGLATVTGTGPNAIFFGQVNSRYGEMTGLNFGSWMAFALPISILMFLVTWIVLTIIYIGPKAFCLCKLDRDQALLVREVMHREYKKLGGFTYAEGSCCVLFALITSLWVTRNIGDFGWSKFFRSEKNPT-----QIYVSDSQPAMLIALLAMTLPAVSPIELWRLQYKRLSNSAAHKEERESQKTAKLKNEFLLPWHVVQKQVPWGVIFVLGGGFALSDVCQHSGLSAVIGRYLTEHVNGLPVVGLVAAFSILGAFFTELTSNAATISILLPILFSLSENMR--IHPFLLTLPTTVATSFAFCLPAATPPNSIVFGRGRVRVKDMIKSGLFLNIAGCLITLVASISYAV 601          
BLAST of slc13a-3 vs. TrEMBL
Match: A0A4S2L6A4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010199 PE=4 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 1.130e-78
Identity = 171/571 (29.95%), Postives = 285/571 (49.91%), Query Frame = 3
Query:  165 YQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEG-RELN-----DEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGI--LNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAF--QKNATAGHCGEMYVSDATPMVLVVILLYIWPTXX-------------------XXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIV--FLLLVSCYTYGV 1784
            Y L+++A +W  +V+P  VT+L P+ LAP++ +  S  I   +  D ++L +G L +AC  +   +HRR  L +L   G  P+M+ML  M+P + L+M++SNTAT  +M+  V  V+     IE   RELN     +   +       ++++    +       +Q    E  PS  +    SK+  E     S+   S+     + F+  LSL   YA++ G +AT+   GPN + FG V+ ++  +  LN+G+++A  LP+SI+ FL+TW+ +  + IGP+ F  C+ +  +  +  E +    K LG  T+AE SC  L   +  +W+ R +G  GW   F  +KN T     ++YVSD+ P +L+ +L    P                      +   +  +    N+ LL W    + +PW +IF+LG G A++++C  S  +  +   LT+ +       ++   + LG   TE  S+   + IL+ I   L    +  ++ F    P T  +SFAFCLPAAT PN  +F RG    K+MIK+GL ++I    + LV+  +Y V
Sbjct:   86 YILLLMAGYWLTEVIPIYVTALFPVFLAPVLGLIPSSKICPAYMKDTVMLFVGGLFVACTIEHRNLHRRIALSVLKVVGSDPKMLMLGVMLPTWFLSMWMSNTATTAMMITIVEAVIISMDAIEVAIRELNETKFVESVSECLDSQRDSEVTEPRDKLPVASVGNQALTVEHVPSPID----SKVDPE-----SLDQESMRYVNLRGFNTGLSLAVCYASTCGGLATVTGTGPNAIFFGQVNSRYGEMTGLNFGSWMAFALPISILMFLVTWIVLTIIYIGPKAFCLCKLDRDQALLVREVMHREYKKLGGFTYAEGSCCVLFALITSLWVTRNIGDFGWSKFFRSEKNPT-----QIYVSDSQPAMLIALLAMTLPAVSPIELWRLQYKRLSNSAAHKEERESQKTAKLKNEFLLPWHVVQKQVPWGVIFVLGGGFALSDVCQHSGLSAVIGRYLTEHVNGLPVVGLVAAFSILGAFFTELTSNAATISILLPILFSLSENMR--IHPFLLTLPTTVATSFAFCLPAATPPNSIVFGRGRVRVKDMIKSGLFLNIAGCLITLVASISYAV 640          
BLAST of slc13a-3 vs. TrEMBL
Match: A0A4S2L693 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010199 PE=4 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 2.179e-78
Identity = 169/566 (29.86%), Postives = 281/566 (49.65%), Query Frame = 3
Query:  180 LAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEG-RELN-----DEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGI--LNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAF--QKNATAGHCGEMYVSDATPMVLVVILLYIWPTXX-------------------XXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIV--FLLLVSCYTYGV 1784
            +A +W  +V+P  VT+L P+ LAP++ +  S  I   +  D ++L +G L +AC  +   +HRR  L +L   G  P+M+ML  M+P + L+M++SNTAT  +M+  V  V+     IE   RELN     +   +       ++++    +       +Q    E  PS  +    SK+  E     S+   S+     + F+  LSL   YA++ G +AT+   GPN + FG V+ ++  +  LN+G+++A  LP+SI+ FL+TW+ +  + IGP+ F  C+ +  +  +  E +    K LG  T+AE SC  L   +  +W+ R +G  GW   F  +KN T     ++YVSD+ P +L+ +L    P                      +   +  +    N+ LL W    + +PW +IF+LG G A++++C  S  +  +   LT+ +       ++   + LG   TE  S+   + IL+ I   L    +  ++ F    P T  +SFAFCLPAAT PN  +F RG    K+MIK+GL ++I    + LV+  +Y V
Sbjct:    1 MAGYWLTEVIPIYVTALFPVFLAPVLGLIPSSKICPAYMKDTVMLFVGGLFVACTIEHRNLHRRIALSVLKVVGSDPKMLMLGVMLPTWFLSMWMSNTATTAMMITIVEAVIISMDAIEVAIRELNETKFVESVSECLDSQRDSEVTEPRDKLPVASVGNQALTVEHVPSPID----SKVDPE-----SLDQESMRYVNLRGFNTGLSLAVCYASTCGGLATVTGTGPNAIFFGQVNSRYGEMTGLNFGSWMAFALPISILMFLVTWIVLTIIYIGPKAFCLCKLDRDQALLVREVMHREYKKLGGFTYAEGSCCVLFALITSLWVTRNIGDFGWSKFFRSEKNPT-----QIYVSDSQPAMLIALLAMTLPAVSPIELWRLQYKRLSNSAAHKEERESQKTAKLKNEFLLPWHVVQKQVPWGVIFVLGGGFALSDVCQHSGLSAVIGRYLTEHVNGLPVVGLVAAFSILGAFFTELTSNAATISILLPILFSLSENMR--IHPFLLTLPTTVATSFAFCLPAATPPNSIVFGRGRVRVKDMIKSGLFLNIAGCLITLVASISYAV 550          
BLAST of slc13a-3 vs. TrEMBL
Match: A0A3R7F505 (Solute carrier family 13 member 3 OS=Clonorchis sinensis OX=79923 GN=SLC13A3 PE=4 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 7.323e-77
Identity = 174/577 (30.16%), Postives = 286/577 (49.57%), Query Frame = 3
Query:  165 YQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEG-RELND-----------EAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGI--LNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAF--QKNATAGHCGEMYVSDATPMVLVVILLYIWPTXX-------------------XXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIV--FLLLVSCYTYGV 1784
            Y L+++A +W  +V+P  VT+L P+ LAP++ +  S  I   +  D ++L +G L +AC  +   +HRR  L +L   G  P+M+ML  M+P + L+M++SNTAT  +M+  V  V+     IE   RELN+           +++++       D  P+ S  N      Q    E  PS  +    SKI  E     S+    I     + F+  LSL   YA++ G +AT+   GPN + FG V+ ++  +  LN+G+++A  LP+SI+T L+TW+ +  + IGP+ F  C+ +  +  +  + +    K LG  T+AE SC  L   +  +W+ R +G  GW   F  +KN T     ++YVSD+ P +L+ +L    P                      +   +  + +  N+ LL W    + +PW IIF+LG G A++++C  S  +  +   L + +       ++ + + LG   TE  S+   + IL+ I   L    +  ++ F    P T  +SFAFCLPAAT PN  +F RG    K+MIK+GL ++     + L +  TY V
Sbjct:   90 YILLLMAGYWLTEVIPIYVTALFPVFLAPVLGLIPSSKICPAYMKDTVMLFVGGLFVACTIEHRNLHRRIALSVLKVVGSDPKMLMLGVMLPTWFLSMWMSNTATTAMMITIVEAVIISMDAIEVAIRELNETRFVRSLSECLDSQRDSEVTEPRDKLPVASVGN------QALAVEHAPSPID----SKIDPE-----SLDQEPIRYVNLRGFNTGLSLAVCYASTCGGLATVTGTGPNAIFFGQVNSRYGEMTGLNFGSWMAFALPISILTLLVTWIVLTMIYIGPKAFCLCKLDKDQALLVRKVMHREYKKLGGFTYAEGSCCVLFALITSLWVTRNIGDFGWSKFFKSEKNPT-----QIYVSDSQPAMLIALLAMTLPAVSPIELWRLQYKRLSNSAAHKEERESQKTAELKNESLLPWHVVQKQVPWGIIFVLGGGFALSDVCQHSGLSDVIGRYLMEHVNGLPVVGLVAVFSILGAFFTELTSNAATISILLPILFSLSESMR--IHPFLLTLPTTIATSFAFCLPAATPPNSIVFGRGRVRVKDMIKSGLFLNFAGCLITLTATITYAV 644          
BLAST of slc13a-3 vs. Ensembl Cavefish
Match: slc13a5b (solute carrier family 13 member 5-like [Source:NCBI gene;Acc:103022547])

HSP 1 Score: 208.764 bits (530), Expect = 3.402e-59
Identity = 166/559 (29.70%), Postives = 271/559 (48.48%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF--NG-ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIG--PREFFACRK-NSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCA-FQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXX----XXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAII----LLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDI--VFLLLVSCYTYG 1781
            C Y ++++A +W  + LP  +T+LLP +L PL  I  S+ +   +  D  +L +G L++A A +   +H+R  L +L   G +P ++ML  M     L+M+ISNTAT  +M+  V  VL +  + E    L D +E+            + +   Y +          Y S   V+    + SE       S R       +R    ++L   YAAS G  ATL   GPNLV  G +++ F  NG I+N+ ++     P  I+  +L+W+W+  V +G   ++ + C    S KE      I+D L+ LG + + E S + L   ++++W  R  G + GW    F  +A        YV+DAT +V + +LL++ P++           S+  +    LLTW    + +PW I+ LLG G A+ +    S  ++ +  +LT  L N  P+AI+    LL AT    T+   ++T  LP+L S      +    G+N      P T  +SFAF LP AT PN  +F+ G     +M KTG++M+I  +F + ++  T+G
Sbjct:   38 CAYVIMLMAVYWCTEALPLAITALLPAVLFPLFGIMQSKQVCMQYLKDTNMLFVGGLMVAVAVEHWNLHKRIALRVLLLVGVRPALLMLGFMGVTAFLSMWISNTATTAMMVPIVQAVLEQLNRQESEPALIDNSEEQ----------SLAADAQYSE--------TKYKSAQVVVSGLDVASEAAKHKEASAR-------RRICKGMTLCVCYAASIGGTATLTGTGPNLVLKGQMNQLFPENGDIVNFASWFGFAFPNMILMLVLSWLWLQFVFMGFNFKKTWGCGAVKSEKELAAYNVIRDELRRLGPMAYGEFSLLALFCLLVVLWFTRDPGFVSGWATHIFNSDAE-------YVTDATVVVFIAVLLFVLPSKPPQFWCGTSTGSNPGAPMPPLLTWKVAQKRMPWNIVLLLGGGFAVAKGSEVSGLSRWLGDQLTP-LHNFPPWAIVIILTLLIATFTECTSNVATATLFLPVLAS------MSQSIGMNPLYVMVPCTLSTSFAFMLPVATPPNAIVFSYGYLKVSDMAKTGIIMNIIGIFCVTLAINTWG 557          
BLAST of slc13a-3 vs. Ensembl Cavefish
Match: ENSAMXT00000016775.2 (solute carrier family 13 member 2-like [Source:NCBI gene;Acc:103047287])

HSP 1 Score: 197.593 bits (501), Expect = 5.287e-55
Identity = 152/561 (27.09%), Postives = 271/561 (48.31%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF--NG-ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIG--PREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVG-TIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXX--------XXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLS----STTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLV--SCYTYG 1781
            C Y ++V+A +W  + +P   T+LLP++  P+M I  S+ +   +  DA I+  G L++A A +   +H+R  L +L   G +P ++ML  MI    ++M+++N A   +ML  V  ++ E+ K  E ++ N +  +      STD     S  N  + +++  +N+++                        + + E+K+ + S  +SL   YA S G  +TL ++ PNLV  G +DK F  NG ++NY ++     P  ++  + +W+W+  + +G   +  F CRK S  +      ++   + LGR++FAE + + L   ++++W  R+ G + GWG               +V+DAT  +L+ +L YI P+  +F          N   +  +   LL WD   + +PW I+ L+G   A+   C  S  +   +  L + LKN  P A+      +  + TE  +    ST +LP+L S+   +E      L+      P T  SSFAF LP AT  N   F+       +M+K GL+++++ +L V  + +T+G
Sbjct:   40 CGYAVLVMAVYWCTECIPLAATALLPVIFFPMMGIMKSEQVCLQYLGDANIMGAGGLMVAIAVEHWNLHKRLALGMLMIVGARPALLMLGFMIVTAFMSMWVTNVAATAMMLPIVRSMM-EHLKEAEAQDHNLQRSRARDTIHSTD-----STVNKLNTSAEDLLNDEH-----------------------MKQMHEEKYVKLSKGMSLCVCYAGSIGGTSTLTSSIPNLVLKGQIDKLFPQNGDVINYTSWFLFSFPNMVLMLVTSWIWLQFMYLGFNVKNTFGCRKTSRSDRQVCRVMQSEYRKLGRMSFAEWNVLVLFLLLVLLWFTREPGFSTGWGSLIFNQE------RKFVTDATVSILICLLFYIIPSELEFSCCHSGSFNVNGRRKWKAPPSLLQWDVVQKKMPWNIMLLMGGSFALARGCEVSGLSLLFAQTL-EPLKNIPPVALCFFLCFIMAMLTEICNNAVVSTVLLPVLASMAGAVE------LHPLYIMIPPTIASSFAFMLPVATATNAIAFSYANLKIMDMVKPGLMLNLLGILCVNLAIHTWG 558          
BLAST of slc13a-3 vs. Ensembl Cavefish
Match: ENSAMXT00000033979.1 (solute carrier family 13 member 2-like [Source:NCBI gene;Acc:103047287])

HSP 1 Score: 197.593 bits (501), Expect = 5.287e-55
Identity = 152/561 (27.09%), Postives = 271/561 (48.31%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF--NG-ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIG--PREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVG-TIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXX--------XXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLS----STTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLV--SCYTYG 1781
            C Y ++V+A +W  + +P   T+LLP++  P+M I  S+ +   +  DA I+  G L++A A +   +H+R  L +L   G +P ++ML  MI    ++M+++N A   +ML  V  ++ E+ K  E ++ N +  +      STD     S  N  + +++  +N+++                        + + E+K+ + S  +SL   YA S G  +TL ++ PNLV  G +DK F  NG ++NY ++     P  ++  + +W+W+  + +G   +  F CRK S  +      ++   + LGR++FAE + + L   ++++W  R+ G + GWG               +V+DAT  +L+ +L YI P+  +F          N   +  +   LL WD   + +PW I+ L+G   A+   C  S  +   +  L + LKN  P A+      +  + TE  +    ST +LP+L S+   +E      L+      P T  SSFAF LP AT  N   F+       +M+K GL+++++ +L V  + +T+G
Sbjct:   40 CGYAVLVMAVYWCTECIPLAATALLPVIFFPMMGIMKSEQVCLQYLGDANIMGAGGLMVAIAVEHWNLHKRLALGMLMIVGARPALLMLGFMIVTAFMSMWVTNVAATAMMLPIVRSMM-EHLKEAEAQDHNLQRSRARDTIHSTD-----STVNKLNTSAEDLLNDEH-----------------------MKQMHEEKYVKLSKGMSLCVCYAGSIGGTSTLTSSIPNLVLKGQIDKLFPQNGDVINYTSWFLFSFPNMVLMLVTSWIWLQFMYLGFNVKNTFGCRKTSRSDRQVCRVMQSEYRKLGRMSFAEWNVLVLFLLLVLLWFTREPGFSTGWGSLIFNQE------RKFVTDATVSILICLLFYIIPSELEFSCCHSGSFNVNGRRKWKAPPSLLQWDVVQKKMPWNIMLLMGGSFALARGCEVSGLSLLFAQTL-EPLKNIPPVALCFFLCFIMAMLTEICNNAVVSTVLLPVLASMAGAVE------LHPLYIMIPPTIASSFAFMLPVATATNAIAFSYANLKIMDMVKPGLMLNLLGILCVNLAIHTWG 558          
BLAST of slc13a-3 vs. Ensembl Cavefish
Match: slc13a5a (solute carrier family 13 member 5 [Source:NCBI gene;Acc:103038195])

HSP 1 Score: 191.815 bits (486), Expect = 6.706e-53
Identity = 158/557 (28.37%), Postives = 264/557 (47.40%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSM-TNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNG---ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGP--REFFACRK-NSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPT---------XXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAI----ILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            C Y + ++A +W  +V+P  VT+LLP +L PL  +  S+++   + +D  +L LG L++A A +   +H+R  L +L   G +P ++ML  M     L+M+ISNTAT  +M+  V  VL +           DE  +  T   S +      +++    ++Q+ +N    S+ T  IE  +   ER                 R    ++L   YAAS G  ATL   GPNLV  G + + F     ++N+ ++ A   P  +I   L W+W+  V +G   R+ + C    + KE      I++  + LG ++F EI+ + L   ++++W  R+ G + GW      +       + YV+DAT  V V  LL++ P+            F     S       LLTW      +PW+I+ LLG G A+ +    S  +  +  +++  L++  P+AI     L+ AT    T+   ++T  LPIL S+          G+N      P T  +SFAF LP AT PN  +F+ G     +M +TG++M+I+ +L ++
Sbjct:   38 CAYVIGLMAVYWCTEVIPLAVTALLPAILFPLFGVMQSKDVCRQYLNDTNMLFLGGLMVAVAVEHWNLHKRIALRVLLIVGVRPALLMLGFMGVTAFLSMWISNTATTAMMVPIVQAVLMQLDTTAR-----DEDPRPITSVESEE------KQSEKQADAQVILNSHRFSLDTERIERCREAEERL----------------RMCKGMTLCVCYAASIGGTATLTGTGPNLVLTGQMSQLFKDNPDVINFASWFAFAFPNMVIMLTLAWIWLQFVFLGFNFRKTWGCGTVKTEKEIAAYNVIREEHQRLGPMSFGEINVLALFILLVVLWFTREPGFVDGWATHLFNS------DKEYVTDATVAVFVAALLFVLPSKPPCVCFWRSQSFNTVPQSDTEPRSALLTWKVAQSKMPWSIVLLLGGGFALAKGSEDSGLSTWLGNQMSP-LQSIPPWAIAIIVCLMIATFTECTSNVATATLFLPILASM------SQSIGVNPLYVMIPCTLSASFAFMLPVATPPNAIVFSYGYLKVSDMARTGIVMNIIGILCIT 554          
BLAST of slc13a-3 vs. Ensembl Cavefish
Match: slc13a4 (solute carrier family 13 member 4 [Source:NCBI gene;Acc:103021794])

HSP 1 Score: 184.111 bits (466), Expect = 7.572e-50
Identity = 156/595 (26.22%), Postives = 267/595 (44.87%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNE--YGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSIL-----------EKKFKRFSL-----------ALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNG------ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFAC---RKNSSKEDIFLE-RIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYI------WPTX------XXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSS----TTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLV--SCYTYGV 1784
            C Y L+V A +W  + +P G  +L+P  L PL  +  S  ++  +  D  +L +G + LA + +K  +H+R  L ++   G +P M++L  M     L+M++SNT+T  +++     VL +  Y  I +  + +D  E   T    +D    L +     F  + +  +    MT       + S    +  I T   L           + K +R SL            LSL   YAA+ G + T+     NL    +  +QFN       ++N+G +    LP+++I  +LTW+W+  + +G      C   +K  +K +I  E RI +  + LG I++ E+        + ++W  R+ G + GW   F+K          Y +DAT  VL+  LL++      WP+        D   ++   +     ++TW    R +PW I+ L+G G A+   C  S  +  +  +L + +    P+A+ LLA  L    TEF S+    T  LPIL ++   L+I      N  +   P T C SF   LP    PN  +F+ G     +M+K G  ++++ +L+V  +  T+GV
Sbjct:   44 CAYVLIVTAVYWVSEAVPLGAAALVPAFLYPLFGVLKSSEVASEYFKDTTLLLMGVICLAASIEKWNLHKRIALRMVMIAGAKPGMLVLGFMCCTVFLSMWLSNTSTTAMVMPIAEAVLQQLIYTGIADSHDDSDTVE---TQEDESDKEETLQKNQLELFYHKYSCEKPELCMTEEANGLALKSGLGANLPIQTNGYLPETPIDMPVPKKPKIRRDSLYPTKRDHMICKCLSLSITYAATIGGLITITGTSTNL----IFAEQFNNRYPEAKVINFGTWFIFSLPIALIMLVLTWIWLHCLFLGCNFRETCSWSKKRKTKREILSEKRIHEEYQKLGPISYPEVVTGVFFILMTLLWFTREPGFVPGWTSLFEKKG--------YRTDATVSVLLGFLLFLIPARKPWPSAFFNKCKVDDDDDEEDEEDPLAPMITWKDFLRLMPWEIVILVGGGYALAAGCKVSGLSMWIGRQL-EPMSGLPPWAVTLLACLLVSAVTEFASNPATLTVFLPILSALSETLQI------NPLHTLIPATMCVSFGVMLPVGNPPNAIVFSYGHVQISDMVKAGFGVNLIGVLVVMLAITTWGV 616          
BLAST of slc13a-3 vs. Ensembl Sea Lamprey
Match: slc13a4 (solute carrier family 13 member 4 [Source:ZFIN;Acc:ZDB-GENE-070424-71])

HSP 1 Score: 142.895 bits (359), Expect = 3.139e-36
Identity = 141/601 (23.46%), Postives = 262/601 (43.59%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDF---NSQLTMNEDYPSMTNVIEVSKIF-SERKFSTSISTRS-----------------------------ILEKKFKR------FSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGI--LNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFA--CRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPT----------XXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSS----TTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLV--SCYTYG 1781
            C Y +++ A  W  + +P G  +LLP +L PL+ +  S  ++  +  D  +L LG + L  A +K  +HRR  L ++T  G +P +++L  M+    L+M++SNT+T+ +++     VL +         LN++   N          P+L       F   NS   M  D+     V+ VS+ +  +R+ S  + TRS                             I  K+  R          L+L   YA++ G + T+     NL+       ++     +++G+++    P++++  + TW+W+  + +G R+ +    R+    E +   R++   + LG I++ E+    +   ++++W LR  G + GW   F +          Y +DAT  +L+  LL++ P+                +      S+  L+ W      +PW I+ L+G G A+   C  S  +  V  +L   L     + ++LL++ L    TE  S+    T  LPIL ++   + +      N      P T  +S A  LP A  PN   F+ G    ++M+K GL ++I+ + +V  + +T+G
Sbjct:   35 CAYTVLLTATLWVSEAVPLGAAALLPAMLYPLLGVMRSSQVAAEYFKDTTLLLLGVICLTAAIEKWCLHRRIALRMVTAAGARPSLLVLGFMVCTAFLSMWLSNTSTSALVMPIAEAVLTQ---------LNNKKNPNINL-------PVLHAPGVASFDVDNSDDEMTVDFKEEPTVVTVSQRYRGQRRNSIWMVTRSVPFISPSQQCCRLPPTHPPHPPRPPRPPRICSKRSSRGHHGATLGKCLTLAVAYASTIGGLCTIPGTSTNLIFAEQFSNRYPACECIHFGSWLLFSFPVALLLLIFTWLWLTWLFLGFRQAWDIFTRRYLRHERMSERRMRQEYEKLGPISYQEVVTASVFLLMVLLWFLRDPGFVPGWASFFLRKG--------YQTDATVSLLLGFLLFVVPSERPPLPWLSKTQSRGAHTVDSWGSSPALINWKDFQGCMPWEIVILVGGGFALAAGCQVSGLSLWVGSQLQP-LGLLPSWLVVLLSSLLVTSVTEVASNPATITLFLPILCTLSENMHV------NPLYVAVPATLNTSLAMMLPVANPPNAIAFSYGYLRVRDMVKAGLGVNIIGMAVVMLAIHTWG 604          
BLAST of slc13a-3 vs. Ensembl Sea Lamprey
Match: slc13a1 (solute carrier family 13 member 1 [Source:ZFIN;Acc:ZDB-GENE-031222-3])

HSP 1 Score: 78.9518 bits (193), Expect = 2.737e-16
Identity = 79/309 (25.57%), Postives = 138/309 (44.66%), Query Frame = 3
Query:  276 NISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATA----PIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFN------GILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPR--EFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWG 1163
             ++  +  D  +L  G + LA A +K  +H+R  L ++   G  P  +ML  M+    L+M++SNT+TA    PI+   +++++N    I+     + EAE  FT       +   S +NY   +++                +     R  S S   + +L K       +LSL   YA++ G I T+     NL+      +QFN        +N+ ++I+  LP+S I  +L+WVW+  + +G      F C K + KE      IK   + LG  ++ E+    +   + I+W  R+ G + GW 
Sbjct:   35 QVAAEYFKDFHLLLTGVICLAAAIEKANLHKRIALRMVMVVGSNPAWLMLGFMVTAAFLSMWLSNTSTAAMLMPIVEAMLVQIMNAEASIDNLE--HGEAEPMFTGMDPVSETRPSSTQNYTARDAE----------------APAVPSRYHSQS---QQMLCK-------SLSLCVAYASTIGGITTITGTSTNLI----FAEQFNTRYPECDCINFTSWISFSLPISFIILILSWVWMHIIFLGFNFAHMFKCAK-TEKELAAEAVIKKEYQQLGPFSYQELVAAIIFLLMAILWFTREPGFMPGWA 310          
BLAST of slc13a-3 vs. Ensembl Yeast
Match: PHO91 (Low-affinity vacuolar phosphate transporter; exports phosphate from the vacuolar lumen to the cytosol; regulates phosphate and polyphosphate metabolism; acts upstream of Pho81p in regulation of the PHO pathway; localizes to sites of contact between the vacuole and mitochondria (vCLAMPs); deletion of pho84, pho87, pho89, pho90, and pho91 causes synthetic lethality; transcription independent of Pi and Pho4p activity; overexpression results in vigorous growth [Source:SGD;Acc:S000005296])

HSP 1 Score: 58.5362 bits (140), Expect = 2.472e-9
Identity = 39/132 (29.55%), Postives = 62/132 (46.97%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLL-------------PILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVL 515
            C   L+  +  WA + +P  VTSL+             PI   P+   D+SQ I  T  S  ++L LG   LA A  K+ I +     +L   G  P  I+L+ M     ++M++SN A AP++   +++ L
Sbjct:  459 CFAILIYASLLWATETIPLFVTSLMIPLLIVVFPVIKDPITSQPMSPRDSSQFILSTMWSSVIMLLLGGFTLAAALSKYNIAKVLSTHILASAGTNPHFILLTNMFVALFVSMWVSNVA-APVLCYSIVQPL 589          
BLAST of slc13a-3 vs. Ensembl Nematostella
Match: EDO42123 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2D4])

HSP 1 Score: 194.512 bits (493), Expect = 2.008e-54
Identity = 165/574 (28.75%), Postives = 274/574 (47.74%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHY--GSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF--NGILNYGNFIAIGLPLSIITFLLTWVWVGTVN---IGPREFF-ACRKNSSKEDIFLERIKDLL-----KDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCA-FQKNATAGH----CGEMYVSDATPMVLVVILLYIWPTXXXXXX---XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELT--DRLKNSSPFAII-LLAATLGCVTTEFLSSTTILPILVSIFIKLEI---KHQDGLNHFNYFF--PLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDI--VFLLLVSCYTYGV 1784
            C Y ++++A +W  +V+   VT+LLP++L P++ +  S+ IS  +  D  +L +G LI+A A +   +H+R  L +L   G QPR +ML  M+    L+M+ISNTAT  +M+     VL+E  K E  ++L  E+  +  +   G +D  P+    N G+ +++   N+D                      I T   ++++F R S  L L   YAA+ G  ATL    PNLV  G V K +  +  + + ++     P  +I   + W     V    +  R F   C K S + D   ++   ++     K LG ++FAEI+ +     + ++W+ R    + GW    F ++    H        YV D T  ++V   L+++P++         +       + LLTW      LPW II LLG+G A+ E C  S  ++ +  +L   + + +    AI+ +L  T   VT+   ++T  LPIL S+ +   +   KH + +N   ++   P T   SFAF LP AT PN  +F  G     +M K G+ M+I  V +LL+  +TYG+
Sbjct:   24 CAYCILIMAVYWVTEVVSLAVTALLPLVLFPMLGVVGSKQISPPYFQDTNVLFMGGLIVAVAIEHWMLHKRIALRVLLLVGSQPRRLMLGFMLVTAFLSMWISNTATTAMMVPIAEAVLSELKKEEIKQKLESESNSDTVNQNEGFSD-GPV----NNGEEDTK---NDD----------------------IGTE--IDRRFMRMSKMLLLSIAYAANIGGTATLTGTAPNLVLSGQVIKLYPKSPGIGFADWFFFAFPEMLILLFVAWYCSAPVEGNFLKLRSFRCGCCKKSHRSDKEQDKAVRVVLLNQYKALGPMSFAEIAVLVHFIMLALLWLFRNPKFMKGWSAILFIQSVFNMHRFGVSHARYVKDGTVAMVVAFSLFVFPSKKPEILCWNPEGKVTKPPEALLTWKTVAHKLPWNIIILLGSGFALAEACKVSGLSEWLGLQLVGLNTIPSYGIVAIVCILITTFTEVTSNTATATIFLPILASLLMLYSLVYKKHGENINVHPWYLMIPATVSCSFAFMLPVATPPNAIVFAGGELRVSDMAKAGIGMNILGVAILLLCVHTYGM 565          
BLAST of slc13a-3 vs. Ensembl Nematostella
Match: EDO44544 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVB9])

HSP 1 Score: 179.104 bits (453), Expect = 6.930e-49
Identity = 160/569 (28.12%), Postives = 260/569 (45.69%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF--NGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLK----DLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGC-AFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXX---XXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSS----TTILPIL-----VSIFIKLEIK------HQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFL--LLVSCYTYG 1781
            C Y ++++A FW  +V+P  VT+LLP++L P++ + ++Q  S  +  D   L +G LI+A A +   +H+R  L +L   G QPR +ML  M     L+M+ISNTAT  +M+     VL E       R+  D  E                    G+ +S+  M+E   + T   +      E  F             F R S AL L   YAA+ G  ATL   G NLV  G     F  +  + +G + +   P  I+  L+ W W+    +G     +C+K + K+ +  + I  +L+    D+G +TFAE + +G    + ++W+ R    + GW   +F    T      +YV DAT  +L+   L+++P++         D         LLTW+     +PW ++FLLG G ++ +   +S  ++ +  +L+  LK    + I+++   +    TE  S+    T  LPIL      SIF   +           G + +    P T   SFAF LP AT PN  +F+ G    K+M K G  M+++ +  LL+  + YG
Sbjct:   38 CAYAILIMAIFWVTEVIPLAVTALLPLVLFPMLGVLSAQEASLPYLKDTTALFIGGLIVAVAIEHWNLHKRIALRVLLLVGSQPRRLMLGFMAITAFLSMWISNTATTAMMVPIAEAVLQELK-----RDKIDAVEGG------------------GEKDSKALMDEGKRNETEAEQGVTPSQEDVF-------------FGRMSKALVLCVAYAANIGGTATLTGTGSNLVFNGQAQSIFPDSPAVGFGQWFSYAFPQMILLELVAWAWLQVYFLG---CCSCKKTTDKDRMQHQAINRVLRKQYADMGSMTFAEHAVLGHFVVLALLWLSRDPKFMPGWAVHSFGTKITL-----VYVKDATAAMLIAFSLFVFPSQKPKIFCWNPDGGVHKPPPNLLTWNTVAHKMPWNVVFLLGGGFSLAQGAKESGLSEWLGEQLSG-LKVVPDYGIVIIVCVMLTGFTEITSNVATVTIFLPILGTVVSTSIFNSFKPSPLMLPGRSIGTHPWYLMIPATISCSFAFMLPVATPPNAIVFSYGHLKVKDMAKAGFGMNVICITVLLICLHVYG 561          
BLAST of slc13a-3 vs. Ensembl Medaka
Match: slc13a5b (solute carrier family 13 member 5 [Source:NCBI gene;Acc:101165907])

HSP 1 Score: 204.912 bits (520), Expect = 4.184e-57
Identity = 169/564 (29.96%), Postives = 274/564 (48.58%), Query Frame = 3
Query:  144 TPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIE-EGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF--NG-ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIG--PREFFACRKNSSKEDIFLERIKDLLKD----LGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPT---------XXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLS----STTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            TP   C Y ++++A +W  +VLP  VT+LLP +L PL  I  SQ++   +  D  +L +G L++A A +   +H+R  L +L   G +P ++ML  M     L+M+ISNTAT  +M+  V  VL +    E E  ++    EQ          S    ++N G     +T  +    +T + E     +ER                ++    ++L   YAAS G  ATL   GPNLV  G +++ F  NG ++N+ ++     P  I+   L W+W+  V +G   ++ + C    +++DI    I +LL+D    LG ++F EIS + L   ++++W  R  G +     +  N+ A      YV+DAT  + V +LL+++P+            F        +S  RLLTW    + LPW II LLG G A+ +    S  ++ +  ++T  L+N  P+ I ++   L  V TE  S    +T  LP+L S      +    G+N      P T  +SFAF LP AT PN  +F+ G     +M KTG++M+I+ +L ++
Sbjct:   99 TPEAECAYIIILMAVYWCTEVLPLAVTALLPAILFPLFGIMESQDVGMQYLKDTNLLFVGGLMVAVAVEHWNLHKRIALRVLLFVGVRPALLMLGFMGVTAFLSMWISNTATTAMMVPIVQAVLEQLNSSETEVPQILCSEEQVQISDTDNKSSTQTEKQNEGQGPVVVTFLDASAELTKLKEA----AER----------------RKMCKGMTLCICYAASIGGTATLTGTGPNLVLKGQMNQLFPENGDVINFASWFGFAFPNMILMLTLAWLWLQFVYMGFNLKKTWGCGSVKTEKDI---AIYNLLRDQHRLLGPMSFGEISVLALFSLLVVLWFTRDPGFVAGWATYVFNSEAE-----YVTDATVAIFVAVLLFVFPSEPPRICCWRSRSFNTAPHQSVNSAPRLLTWKVAQKKLPWGIILLLGGGFALAKGSEVSGLSKWMGDQMTP-LQNIPPWGIAIILCLLIAVFTECTSNVATATLFLPVLAS------MSQSIGMNPLYVMVPCTLGASFAFMLPVATPPNAIVFSYGYLKVADMAKTGIVMNIIGILCIT 627          
BLAST of slc13a-3 vs. Ensembl Medaka
Match: slc13a2 (solute carrier family 13 member 2 [Source:NCBI gene;Acc:101161499])

HSP 1 Score: 199.134 bits (505), Expect = 2.085e-55
Identity = 155/555 (27.93%), Postives = 265/555 (47.75%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIE----VSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNG---ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIG--PREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXX-----XXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTT----ILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            C Y ++++A +W  + +P  VT+LLP++L P+M I  + ++S  +  D+ +L +G L++A A +   +H+R  L +L   G +P ++M+  MI    L+M+ISNTAT  +ML     VL +    E   E     E++F   G  ++   L          + T  E  P     +E    V +I S+ +  + +     +E K+ R +  +SL   Y+AS G  ATL    PNL+  G +DK F G   ++N+ ++     P  ++   ++W+W+  + +G   +  F C   S ++      ++   K LGR+ FAE++ + +   ++++W  R+ G   GW         A      YVSD T  +L+ +L ++ P+R                 +   LLTW   +  +PW II LLG G A+      S  +  +   LT  L+   PFAI +L + L    TE  S+T      LPIL S+   ++I      +      P T  +S AF LP AT PN   F+ G     +M++ G +++I+ +L ++
Sbjct:   41 CGYAIILMALYWCTECMPLAVTALLPVVLFPMMGIMKAGDVSIEYLKDSNMLFIGGLLVAIAVENWNLHKRIALRVLLLVGVRPALLMMGFMIVSAFLSMWISNTATTAMMLPIAHAVLQQLKTTELQAE-----ERDFQASGKDNVGFELESSQ----TKEPTTKEKIPDTKQELEAETYVCQISSDIEHESKMKA---MEDKYDRLTKGMSLSVCYSASIGGTATLTGTTPNLILKGQMDKLFPGNGDVINFASWFGFAFPSMLLMLAISWLWLQFMFLGFNMKRSFGCGAKSDRDKEAYAVMRAEYKKLGRMKFAEVAVLIIFILLVLLWFFREPGFFTGWATVLFNQEDA------YVSDGTVAILMSMLFFVIPSRMPTCSGYGCNEKGKTVKAPKALLTWKVVHERMPWNIILLLGGGFALAAGSEVSGLSVWLGSILTP-LEKIPPFAISILLSLLVATFTECSSNTATTTLFLPILASMATAIKI------HPLYVMLPCTIAASLAFMLPVATPPNAIAFSFGNLKVIDMVRAGFMLNIIGILCIN 570          
BLAST of slc13a-3 vs. Ensembl Medaka
Match: slc13a1 (solute carrier family 13 member 1 [Source:NCBI gene;Acc:101166470])

HSP 1 Score: 187.578 bits (475), Expect = 2.741e-51
Identity = 149/560 (26.61%), Postives = 273/560 (48.75%), Query Frame = 3
Query:  135 VHRTPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF---NGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPR-EFFACRK--NSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKL-EIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLL--LVSCYTYGV 1784
            V RT    C + ++++A +W  ++LP  +T++LP +L PL  I  S ++++ +  D   L +G + LA + +K  +HRR  L L+T  G  P  +ML  M  C +L+M++ NT+   +++  V  VL +  + +EG + + +   N      TDIS    ++   +      + E +  +  V +     +      ++++R    K+      A+S+G  Y+++ G I T+    PNL+    +++ +   N I N+GN++ + LP+SI+   LTW+W+  + IG    F  C K  +S KE    + I++    LG +   EI    +   ++++W+ R  G   GW   F K+ +       Y +DA   +L+ +L +I P                + ++TW     ++PW +  L+G G A+ E   +S  +  V+ EL   L +   FA+I +A  +  + TE  S+     I + I   L E  H   +N      P T C+SF+F LP +  PN  ++  G  +  +M+K GL ++++ LL  L++  T+G+
Sbjct:   31 VIRTKEAECAFVMLLMAVYWVTEILPLSITAMLPAVLFPLFGIMKSSDVAKWYFKDFHFLLVGVICLATSIEKWGLHRRIALRLVTLVGVNPAWLMLGFMSGCALLSMWVQNTSAVTMVMPIVEAVLQQILRAKEG-QCSGKDNPNL-ELDETDISNEKKKQPKSNGMQPHVLKETFVQIQPVSQPDTAEAAVPMHEAMNSR----KQDLMMCKAMSIGIAYSSNIGGITTIPGTSPNLIFSEYLNQVYPECNSI-NFGNWLLLCLPISILMLFLTWIWLYWLFIGSDFRFLRCHKGQHSEKEMSAKKVIEEEYSSLGTMGSQEIVTGVVFVLMVLLWLTRAPGFFPGWASLFPKSQSG------YFTDANVALLLGLLFFIIPA--------YGPAKKYEAMITWSEFQASMPWKVALLVGGGFALAEGTKESGLSLWVA-ELLTPLGDLPVFAVITVACVIVTMLTEVTSNAATTTIFLPILSPLAEAIH---VNPLYILIPTTLCTSFSFLLPVSNPPNAVVYAYGHITIMDMVKAGLGVNVIGLLSVLLAVGTWGI 565          
BLAST of slc13a-3 vs. Ensembl Medaka
Match: slc13a5a (solute carrier family 13 member 5 [Source:NCBI gene;Acc:101160832])

HSP 1 Score: 184.882 bits (468), Expect = 1.167e-50
Identity = 162/547 (29.62%), Postives = 255/547 (46.62%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEY-GKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQF--NG-ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPR--EFFACRK-NSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTI-GWGC-AFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXX-----XXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAI---TEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIV 1748
            C Y + ++A +W  +VLP  VT+LLP +L P++ I  S+++   +  D  +L +G L++A A +   +H+R  L +L   G +P ++ML  M     L+M+ISNTAT  +M+  V  VL +  GK+         A  +    G+T++     QK     N + T          V E+ ++ +E             E + +R S  L L   YAAS G IATL   GPNLV  G + + F  NG ++N+ ++     P  ++   L W W+  + IG      + C    S KE    + IK+    LG +++ E S + L   ++ +W  R    + GW    F  NA        +V+DAT  +LV +LL++ P+   +         S        LLTW  T + +PW I+ LLG G A+   +E+   S +  +    L      +    I LL AT     +   ++T  LPIL S      +    G+N      P T  +SFAF LP AT PN  +F+ G     +M KTG++M+I+
Sbjct:   21 CAYVIALMAVYWCTEVLPLAVTALLPTILFPMLGIMESKDVCMQYLKDTNMLFVGGLMVAVAVEHWNLHKRIALRVLLLVGVRPALLMLGFMGVTAFLSMWISNTATTAMMVPIVQAVLEQLNGKV-------GPAASSRNQSGATNLHQKPPQKESVAVNLENT--------GTVPELEELTNE-------------EDETRRISKGLLLCVCYAASIGGIATLTGTGPNLVLVGQMSQLFPQNGDVINFASWFVFAFPTMVLMLTLAWFWLQFLYIGSNLWSMWGCGSVPSEKEKAAYKVIKEEYDRLGPMSYGEGSVLALFILMVSLWFTRDPRFMDGWATHTFNTNAE-------FVTDATVSLLVSVLLFVLPSEPPYYLCCWKSCGSGEQRPAPPLLTWQVTQKKMPWNIVLLLGGGFALAKGSEVSGLSHWLGAQMTPLHSIPPWAIAIIICLLIATFTECASNVATATLFLPILAS------MSQSIGVNPLYVMIPCTLSASFAFMLPVATPPNAIVFSSGFLKVSDMAKTGVVMNII 526          
BLAST of slc13a-3 vs. Ensembl Medaka
Match: slc13a4 (solute carrier family 13 member 4 [Source:NCBI gene;Acc:101161624])

HSP 1 Score: 178.718 bits (452), Expect = 4.500e-48
Identity = 158/579 (27.29%), Postives = 269/579 (46.46%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNE-----YGKIEEGRELNDEAEQNFTHYGSTDIS------PILSQKNYGDFNSQL-TMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSL---ALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFN------GILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFAC----RKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTG-FVIIM---WILRKVGTI-GWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXX-XXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSS----TTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDI--VFLLLVSCYTYGV 1784
            C Y L+V A +W  + +P G  +L+P  L PL  +  S  ++  +  D  +L +G + LA + +K  +H+R  L ++   G +P M++L  M     L+M++SNT+T  +++     VL +          E  E  D  E++         S      PIL +    D  +Q+ ++N+D  S+ +  +  +   E      +  R   +   KR  +    LSL   YAA+ G + T+     NL    +  +QFN       ++N+G +     P++II  +LTW+W+  + +G      C    ++ + +E +   RI +  + LG I++ E+    +TG F I+M   W  R+ G + GW   F+K          Y +DAT  VL+  LL++ P R      N+SS       ++TW    R +PW I+ L+G G A+   C  S  +  +  +L + +    P+A+ LLA  L    TEF S+    T  LPIL ++   L I      N  +   P T C SF   LP    PN  +F+ G     +M+K G  +++  V +++++  T+GV
Sbjct:   20 CAYVLMVTAVYWVSEAVPLGAAALVPAFLYPLFGVLKSSEVAAEYCKDTTLLLMGVICLAASIEKWNLHKRIALRMVMIAGAKPGMLVLGFMCCTVFLSMWLSNTSTTAMVMPIAEAVLQQLICTGLADGHEDSETMDAPEEDSGWLTLVLKSLNPVCFPILPRLLDNDNQNQVCSVNQDVKSLESANQ-QQAAVEIPNLKRVKARRDSQYPTKRDHMICKCLSLSITYAATIGGLITITGTSTNL----IFAEQFNTRYPEAKVINFGTWFIFSFPIAIIMLVLTWLWLHFLFLGCNFRETCSLSKKRKTRREMMSERRIHEEYEKLGPISYPEV----VTGVFFILMTLLWFTREPGFVPGWTSLFEKKG--------YRTDATVSVLLGFLLFLIPARRPFSSSNESSGSDPLAPMITWKDFQRLMPWEIVILVGGGYALAAGCKVSGLSMWIGRQL-EPMSGLPPWAVTLLACLLVSAVTEFASNPATLTVFLPILSALSETLLI------NPLHTLIPSTMCVSFGVMLPVGNPPNAIVFSYGHVKISDMVKAGFGVNLIGVAVVMLAITTWGV 574          
BLAST of slc13a-3 vs. Planmine SMEST
Match: SMESG000050959.1 (SMESG000050959.1)

HSP 1 Score: 1097.42 bits (2837), Expect = 0.000e+0
Identity = 578/580 (99.66%), Postives = 578/580 (99.66%), Query Frame = 3
Query:   69 MKTSXXXXXXXXXXXXXXXXALVHRTPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVSCYTYGVVGHIIKTD 1808
            MKTSIKIVCFILIPIICLPIALVH T GFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTRWDFWRNDSSRDSSNDRLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVSCYTYGVVGHIIKTD
Sbjct:    1 MKTSIKIVCFILIPIICLPIALVHTTKGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTRWDFWRNDSSRDSSNDRLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVSCYTYGVVGHIIKTD 580          
BLAST of slc13a-3 vs. Planmine SMEST
Match: SMESG000041354.1 (SMESG000041354.1)

HSP 1 Score: 208.764 bits (530), Expect = 1.722e-59
Identity = 155/548 (28.28%), Postives = 262/548 (47.81%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGI--LNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGC-----VTTEFLSSTTILPILVSIFIKLEIKHQD-GLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVSCYTY 1778
            C Y ++V+A FW  +VL   VTSL+PI+L P   I T + I+  +  D  I+ +G LI+A   +K ++H+R  L +L   GP P       M   + L+M+ISNTATA +M+     V  ++  +   RE      QN      T ++           +++  + ED               +R+            KK  + S  L L   YAA+ G IAT+   G N+V +G +++++     LN+ NF+    P+S+I  L+ W+ +    IG    F  R +  ++   ++ I      LG I + EIS + +   ++++WILR  GT  WG  F     +G   + Y  D+   +L  +L++I P+     +N      +N++L  W +   N  W ++FL G G A+   C +S  +  +   LT  LKN  P  II+   +LG      VT+   ++T +LPI++++   +++     GL+        T   SF+FCLPAA  PN  +F+ G     +M  +G +++I+ +L++S   Y
Sbjct:   36 CAYVVLVVAIFWITEVLNLPVTSLIPIVLFPTFGILTPKMIAACYMKDVSIMLIGGLIVAKTVEKQKLHKRLALGILKIMGPNPAFQYFGFMFATWFLSMWISNTATAAMMVTLAEAVAQQWRYLSSYRE---NRHQNINTVSETIVNGAYES------HTRFDIGED--------------CDREI-----------KKTDKISKGLFLSVAYAAACGGIATIPGTGANIVFYGYMEERYGSRINLNFSNFMLFTFPISVINVLIAWMLLSLRYIGFNTIFKRRVDPVRDGRIMKLINQEYIKLGNIKYGEISTLIVFILMVLLWILRDPGTPIWGLLFTHKTQSGKVVK-YWGDSITAILAALLVFILPS-----KNPFKHIHNNEKLNNWKFIENNFSWGVVFLFGGGFALAAGCEESGLSPIIGNSLT-YLKN-LPHFIIIFIISLGVSFLTEVTSNIATATVLLPIVLNMAEAIKMHPLILGLSS-------TIACSFSFCLPAANPPNAIVFSTGRVRVIDMASSGFMLNIICVLILSVMVY 534          
BLAST of slc13a-3 vs. Planmine SMEST
Match: SMESG000041354.1 (SMESG000041354.1)

HSP 1 Score: 208.379 bits (529), Expect = 2.137e-59
Identity = 155/548 (28.28%), Postives = 262/548 (47.81%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGI--LNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGC-----VTTEFLSSTTILPILVSIFIKLEIKHQD-GLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVSCYTY 1778
            C Y ++V+A FW  +VL   VTSL+PI+L P   I T + I+  +  D  I+ +G LI+A   +K ++H+R  L +L   GP P       M   + L+M+ISNTATA +M+     V  ++  +   RE      QN      T ++           +++  + ED               +R+            KK  + S  L L   YAA+ G IAT+   G N+V +G +++++     LN+ NF+    P+S+I  L+ W+ +    IG    F  R +  ++   ++ I      LG I + EIS + +   ++++WILR  GT  WG  F     +G   + Y  D+   +L  +L++I P+     +N      +N++L  W +   N  W ++FL G G A+   C +S  +  +   LT  LKN  P  II+   +LG      VT+   ++T +LPI++++   +++     GL+        T   SF+FCLPAA  PN  +F+ G     +M  +G +++I+ +L++S   Y
Sbjct:   32 CAYVVLVVAIFWITEVLNLPVTSLIPIVLFPTFGILTPKMIAACYMKDVSIMLIGGLIVAKTVEKQKLHKRLALGILKIMGPNPAFQYFGFMFATWFLSMWISNTATAAMMVTLAEAVAQQWRYLSSYRE---NRHQNINTVSETIVNGAYES------HTRFDIGED--------------CDREI-----------KKTDKISKGLFLSVAYAAACGGIATIPGTGANIVFYGYMEERYGSRINLNFSNFMLFTFPISVINVLIAWMLLSLRYIGFNTIFKRRVDPVRDGRIMKLINQEYIKLGNIKYGEISTLIVFILMVLLWILRDPGTPIWGLLFTHKTQSGKVVK-YWGDSITAILAALLVFILPS-----KNPFKHIHNNEKLNNWKFIENNFSWGVVFLFGGGFALAAGCEESGLSPIIGNSLT-YLKN-LPHFIIIFIISLGVSFLTEVTSNIATATVLLPIVLNMAEAIKMHPLILGLSS-------TIACSFSFCLPAANPPNAIVFSTGRVRVIDMASSGFMLNIICVLILSVMVY 530          
BLAST of slc13a-3 vs. Planmine SMEST
Match: SMESG000041335.1 (SMESG000041335.1)

HSP 1 Score: 204.912 bits (520), Expect = 7.690e-58
Identity = 147/539 (27.27%), Postives = 257/539 (47.68%), Query Frame = 3
Query:  159 CLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNG--ILNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLG-CVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVS 1766
            C Y + ++A FW  +V+   VTSL+PI+L P   I T   ++  +  D  ++ +G LI+A   +K  +H+R  + +L   GP P    L  M+  + L+M+ISNTAT  +M+     V+ ++  + +                              D   +LT N    S +N  E++ + +    S +  T +   KK ++F   L L   YAA+ G IATL    PNLV +G +++++     LN+G+FI    PLS+I  L  W+ +    +G    F  + +  ++   ++ I D L  LG  +F EIS + +   ++++W+LR+ G    G  F    + G   + Y +D+   +L  + ++  P         S     +++L+ W Y  R   W ++FL G G A+   C  S  +  +   LT+   N+ P   I+L  +LG    TE  S++  + IL+ I +K+       ++       +T   SF+FCLPAAT PN  +F+ G     +M  +G L++I+ ++++S
Sbjct:   43 CGYIIGIVAVFWITEVMNLAVTSLIPIVLFPAFGILTPSTVAACYMKDITLMLIGGLIVAKTVEKQNLHKRLAIRILKLMGPNPIFQYLGFMLSTWFLSMWISNTATTAMMITLADAVVQQWQLMAQ-----------------------------SDHEEKLTRNGRRLSESNEFEMTNMKNVYTISENEETLNYELKKIQKFGKGLFLCVAYAATCGGIATLPGTAPNLVFYGFMEERYKDKMKLNFGSFILFSFPLSVIIVLFCWMLLCVRYVGISSIFKRKIDPQRDRKAMKLIDDELSSLGSFSFGEISTLLVFIGLVLLWVLREPGIPLLGKLFTFKNSKGQDVQ-YWTDSLSAILAALFVFNLPA---KNPFKSHNGEKSEKLIDWKYIERGFSWGLVFLFGGGFALAAGCENSGLSPIIGDVLTNL--NTLPHYAIILILSLGISFLTEITSNSATVTILLPIMLKMA--ECIRMHPMKIGLAVTIACSFSFCLPAATPPNAIVFSTGKIRVIDMATSGFLLNIICVIVLS 544          
BLAST of slc13a-3 vs. Planmine SMEST
Match: SMESG000041312.1 (SMESG000041312.1)

HSP 1 Score: 189.889 bits (481), Expect = 2.199e-52
Identity = 140/560 (25.00%), Postives = 259/560 (46.25%), Query Frame = 3
Query:  141 RTPGFLCLYQLVVLAAFWALDVLPYGVTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHRRFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLNEYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYPSMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGAIATLVAAGPNLVAFGVVDKQFNGI--LNYGNFIAIGLPLSIITFLLTWVWVGTVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFVIIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPTXXXXXXXXXXXXXXXXXLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQFTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFIKLEIKHQDGLNHFNYFFPLTFC--SSFAFCLPAATTPNIAIFNRGLASTKEMIKTGLLMDIVFLLLVSCYTYGVVGHIIKTD 1808
            R+P   C Y + ++  +W  +V+   +TSL+PILL PL  +   +++   +  D  ++ LG LI+A   +K  +H+R  L +L   GP      L  M+  + ++M+I+N++T  +M+     V +++ ++  GR  +   +++                N  D  ++    E+     N I          + T  S    +E K +  S  L L   Y+A++G IAT+    PN + +  +D ++     LN+G F+    P+S++  +L W  +    IG RE F       ++D+ +E+I+  L+ LG+IT+ EIS + +   ++ +WILR+ G       F            + +D +  VL  + ++  P+         +      +L+ W Y      W I+FL G G AI   C  S  ++ +   L+    ++ P   ++L  +LG     FL+  T   + V+I + + I   + ++       L  C  SS +FCLPA+T PN  IF+ G     +M+ TG +++ + ++++S   Y     I K+D
Sbjct:   34 RSPPLQCTYIIAIVGIYWITEVMNVAITSLIPILLFPLFGLLEPKDVVVCYMKDITLMLLGGLIVAKTIEKQNLHKRMALHILNLMGPNLIFQYLGFMLSTWFISMWINNSSTTAMMVTIANAVTDQWVEMATGRRYDVNRDEDL-------------NANNVDSKTEFQRGEE-----NTIST--------YETDSSVDKEIE-KMEYVSKGLILSIAYSATTGGIATISGTVPNYIFYEFMDIRYGSRLNLNFGTFMMFSFPVSLLFIILCWTLLIFRYIGSREIFNKESRQREDDLVMEKIRGELESLGQITYGEISTLIVFLGLVSLWILREPGVPLLSRLFTYKIQGKKIK--FWTDGSSAVLASLFVFNLPS---KNPFKYTSKKEIPKLMNWQYLESGFSWGIVFLFGGGFAIAAGCETSGLSKIIGEILSGF--STLPHLALILIISLGI---SFLTEITSNVVTVTIMLPILIHLAECIDMHPMRMGLAVCLSSSLSFCLPASTIPNAIIFSTGKIQVIDMLSTGFMLNFICVIVLSLMAYYYSCPIFKSD 556          
The following BLAST results are available for this feature:
BLAST of slc13a-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC13A37.146e-5528.42solute carrier family 13 member 3 [Source:HGNC Sym... [more]
SLC13A34.942e-5328.41solute carrier family 13 member 3 [Source:HGNC Sym... [more]
SLC13A34.942e-5328.41solute carrier family 13 member 3 [Source:HGNC Sym... [more]
SLC13A58.590e-5329.84solute carrier family 13 member 5 [Source:HGNC Sym... [more]
SLC13A41.590e-5225.98solute carrier family 13 member 4 [Source:HGNC Sym... [more]
back to top
BLAST of slc13a-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nac-12.055e-4625.70Sodium-dependent low-affinity dicarboxylate transp... [more]
nac-24.648e-4224.04Sodium-dependent high-affinity dicarboxylate trans... [more]
nac-27.307e-4224.77Sodium-dependent high-affinity dicarboxylate trans... [more]
B0285.67.637e-3823.70Uncharacterized transporter B0285.6 [Source:UniPr... [more]
nac-35.010e-2225.66Sodium-dependent high-affinity dicarboxylate trans... [more]
back to top
BLAST of slc13a-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Indy4.997e-3623.24gene:FBgn0036816 transcript:FBtr0301857[more]
Indy4.997e-3623.24gene:FBgn0036816 transcript:FBtr0075082[more]
Indy4.997e-3623.24gene:FBgn0036816 transcript:FBtr0075083[more]
Indy6.411e-3623.24gene:FBgn0036816 transcript:FBtr0075081[more]
CG339343.214e-3024.54gene:FBgn0064119 transcript:FBtr0301700[more]
back to top
BLAST of slc13a-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc13a5a7.945e-5829.86solute carrier family 13 member 5a [Source:ZFIN;Ac... [more]
slc13a5a9.792e-5629.87solute carrier family 13 member 5a [Source:ZFIN;Ac... [more]
slc13a34.312e-5328.28solute carrier family 13 member 3 [Source:ZFIN;Acc... [more]
slc13a34.312e-5328.28solute carrier family 13 member 3 [Source:ZFIN;Acc... [more]
slc13a11.342e-5228.06solute carrier family 13 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc13a-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc13a26.926e-5628.40solute carrier family 13 member 2 [Source:NCBI gen... [more]
slc13a31.347e-5229.37solute carrier family 13 (sodium-dependent dicarbo... [more]
nppb1.915e-5029.57natriuretic peptide B [Source:Xenbase;Acc:XB-GENE-... [more]
pias32.601e-4928.12protein inhibitor of activated STAT 3 [Source:Xenb... [more]
slc13a33.489e-4929.04solute carrier family 13 (sodium-dependent dicarbo... [more]
back to top
BLAST of slc13a-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc13a31.720e-5328.28solute carrier family 13 (sodium-dependent dicarbo... [more]
Slc13a23.635e-5228.18solute carrier family 13 (sodium-dependent dicarbo... [more]
Slc13a42.004e-4924.70solute carrier family 13 (sodium/sulfate symporter... [more]
Slc13a51.460e-4227.06solute carrier family 13 (sodium-dependent citrate... [more]
Slc13a37.734e-4225.88solute carrier family 13 (sodium-dependent dicarbo... [more]
back to top
BLAST of slc13a-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WWT9|S13A3_HUMAN3.432e-5428.42Solute carrier family 13 member 3 OS=Homo sapiens ... [more]
sp|Q9Z0Z5|S13A3_RAT4.332e-5327.79Solute carrier family 13 member 3 OS=Rattus norveg... [more]
sp|Q91Y63|S13A3_MOUSE1.203e-5228.28Solute carrier family 13 member 3 OS=Mus musculus ... [more]
sp|Q86YT5|S13A5_HUMAN4.125e-5229.84Solute carrier family 13 member 5 OS=Homo sapiens ... [more]
sp|Q9UKG4|S13A4_HUMAN7.637e-5225.98Solute carrier family 13 member 4 OS=Homo sapiens ... [more]
back to top
BLAST of slc13a-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF830.000e+0100.00Slc13a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A4S2L1X04.213e-7929.95Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2L6A41.130e-7829.95Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2L6932.179e-7829.86Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3R7F5057.323e-7730.16Solute carrier family 13 member 3 OS=Clonorchis si... [more]
back to top
BLAST of slc13a-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc13a5b3.402e-5929.70solute carrier family 13 member 5-like [Source:NCB... [more]
ENSAMXT00000016775.25.287e-5527.09solute carrier family 13 member 2-like [Source:NCB... [more]
ENSAMXT00000033979.15.287e-5527.09solute carrier family 13 member 2-like [Source:NCB... [more]
slc13a5a6.706e-5328.37solute carrier family 13 member 5 [Source:NCBI gen... [more]
slc13a47.572e-5026.22solute carrier family 13 member 4 [Source:NCBI gen... [more]
back to top
BLAST of slc13a-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc13a43.139e-3623.46solute carrier family 13 member 4 [Source:ZFIN;Acc... [more]
slc13a12.737e-1625.57solute carrier family 13 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc13a-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO912.472e-929.55Low-affinity vacuolar phosphate transporter; expor... [more]
back to top
BLAST of slc13a-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO421232.008e-5428.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445446.930e-4928.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc13a-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc13a5b4.184e-5729.96solute carrier family 13 member 5 [Source:NCBI gen... [more]
slc13a22.085e-5527.93solute carrier family 13 member 2 [Source:NCBI gen... [more]
slc13a12.741e-5126.61solute carrier family 13 member 1 [Source:NCBI gen... [more]
slc13a5a1.167e-5029.62solute carrier family 13 member 5 [Source:NCBI gen... [more]
slc13a44.500e-4827.29solute carrier family 13 member 4 [Source:NCBI gen... [more]
back to top
BLAST of slc13a-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050959.10.000e+099.66SMESG000050959.1[more]
SMESG000041354.11.722e-5928.28SMESG000041354.1[more]
SMESG000041354.12.137e-5928.28SMESG000041354.1[more]
SMESG000041335.17.690e-5827.27SMESG000041335.1[more]
SMESG000041312.12.199e-5225.00SMESG000041312.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30031134
GenBankAKN21482.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031134 ID=SMED30031134|Name=slc13a-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1887bp
CTTTGTACAAAATATTTTACATAAATTATAGATTTAATAAAAATTTTTGA
TTCATTTATACTTAAATAATGAAAACAAGCATTAAAATCGTTTGTTTTAT
CCTGATACCAATAATTTGTTTGCCAATTGCGTTGGTTCACAGAACACCAG
GTTTTCTATGTCTTTATCAGCTAGTTGTGCTAGCAGCATTCTGGGCATTA
GATGTATTGCCATATGGAGTTACGTCTTTACTCCCAATATTGCTGGCTCC
CTTGATGAGCATAGATACCTCTCAGAATATTTCGGAAACTTTTTCATCAG
ATGCACTTATTCTTTGTTTGGGTCGACTGATATTGGCGTGTGCTTTTCAA
AAACATCAAATACATCGAAGATTTGGCTTGTTTCTACTAACAAAATTTGG
ACCGCAACCAAGAATGATAATGCTGTCTTGCATGATACCTTGTTACATCC
TCACCATGTTTATCAGCAACACTGCCACAGCTCCGATTATGTTAGAGTTT
GTTCTTGAAGTATTAAATGAATATGGGAAAATTGAAGAAGGAAGGGAATT
AAACGACGAAGCCGAGCAGAATTTCACGCATTATGGAAGTACAGATATCT
CACCTATACTCAGTCAAAAGAACTACGGTGATTTCAATTCTCAGCTCACA
ATGAATGAAGATTATCCAAGCATGACGAATGTCATCGAAGTTTCGAAGAT
ATTTTCGGAGAGAAAATTTTCAACTTCTATTTCAACCAGAAGTATATTAG
AGAAAAAATTCAAAAGATTCTCTCTGGCTTTAAGTCTAGGTACGGGTTAT
GCAGCCTCTAGTGGTGCGATAGCAACCCTTGTAGCAGCTGGTCCAAATTT
AGTTGCATTTGGTGTTGTTGACAAACAATTCAATGGAATATTGAACTATG
GAAATTTTATAGCAATTGGGTTGCCATTATCTATAATCACATTTCTATTA
ACATGGGTTTGGGTGGGCACTGTCAATATAGGACCCAGAGAATTTTTCGC
TTGTCGTAAAAACAGCAGTAAAGAAGATATATTCCTTGAAAGAATAAAAG
ATTTGTTAAAGGATTTGGGTAGAATAACATTTGCTGAAATTTCTTGCATT
GGTCTTACCGGATTTGTAATTATAATGTGGATTTTAAGGAAAGTTGGAAC
AATAGGATGGGGCTGTGCATTTCAAAAAAATGCTACAGCTGGTCACTGTG
GTGAAATGTATGTTTCCGATGCTACTCCGATGGTTTTAGTCGTTATATTG
CTTTATATATGGCCCACAAGGTGGGACTTTTGGAGAAATGACTCTTCAAG
AGATTCGAGCAATGATAGGTTACTAACATGGGATTACACGAATCGAAATT
TGCCTTGGGCCATCATTTTTTTATTAGGTACAGGGCTTGCTATTACAGAA
ATCTGTAATAAATCTCAATTTACACAGTCAGTTTCTTATGAGCTAACTGA
TAGGCTTAAAAATAGTTCACCTTTCGCTATAATCTTGCTTGCAGCAACAT
TGGGATGTGTAACAACTGAATTTCTTTCCTCAACTACTATTTTACCGATA
TTAGTCTCAATATTCATCAAATTGGAAATCAAACATCAAGATGGTTTAAA
TCACTTTAACTATTTTTTCCCGCTTACCTTTTGTTCAAGTTTTGCTTTCT
GCTTACCAGCGGCAACCACGCCAAACATTGCAATTTTTAATCGAGGTCTT
GCATCTACAAAGGAAATGATCAAAACTGGACTACTTATGGATATTGTTTT
CCTATTACTGGTATCCTGCTATACATATGGAGTTGTTGGACATATTATAA
AAACAGATTAACAAAGATTTTATATAATAAAATAGACAATATAAAATGTT
ATTTTGTTTAAAATATATCTGAAAATTGAAAAAAAAA
back to top

protein sequence of SMED30031134-orf-1

>SMED30031134-orf-1 ID=SMED30031134-orf-1|Name=SMED30031134-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=581bp
MKTSIKIVCFILIPIICLPIALVHRTPGFLCLYQLVVLAAFWALDVLPYG
VTSLLPILLAPLMSIDTSQNISETFSSDALILCLGRLILACAFQKHQIHR
RFGLFLLTKFGPQPRMIMLSCMIPCYILTMFISNTATAPIMLEFVLEVLN
EYGKIEEGRELNDEAEQNFTHYGSTDISPILSQKNYGDFNSQLTMNEDYP
SMTNVIEVSKIFSERKFSTSISTRSILEKKFKRFSLALSLGTGYAASSGA
IATLVAAGPNLVAFGVVDKQFNGILNYGNFIAIGLPLSIITFLLTWVWVG
TVNIGPREFFACRKNSSKEDIFLERIKDLLKDLGRITFAEISCIGLTGFV
IIMWILRKVGTIGWGCAFQKNATAGHCGEMYVSDATPMVLVVILLYIWPT
RWDFWRNDSSRDSSNDRLLTWDYTNRNLPWAIIFLLGTGLAITEICNKSQ
FTQSVSYELTDRLKNSSPFAIILLAATLGCVTTEFLSSTTILPILVSIFI
KLEIKHQDGLNHFNYFFPLTFCSSFAFCLPAATTPNIAIFNRGLASTKEM
IKTGLLMDIVFLLLVSCYTYGVVGHIIKTD*
back to top
Aliases
The feature 'slc13a-3' has the following synonyms
Synonym
slc13a-3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001898SLC13A/DASS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001898Solute carrier family 13PFAMPF00939Na_sulph_sympcoord: 7..565
e-value: 4.6E-51
score: 174.3
NoneNo IPR availablePANTHERPTHR10283SOLUTE CARRIER FAMILY 13 MEMBERcoord: 5..572
NoneNo IPR availablePANTHERPTHR10283:SF82PROTEIN I'M NOT DEAD YET-RELATEDcoord: 5..572
NoneNo IPR availableTMHMMTMhelixcoord: 423..445
NoneNo IPR availableTMHMMTMhelixcoord: 41..63
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
NoneNo IPR availableTMHMMTMhelixcoord: 513..535
NoneNo IPR availableTMHMMTMhelixcoord: 278..300
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
NoneNo IPR availableTMHMMTMhelixcoord: 333..355
NoneNo IPR availableTMHMMTMhelixcoord: 469..500
NoneNo IPR availableTMHMMTMhelixcoord: 380..402
NoneNo IPR availableTMHMMTMhelixcoord: 555..577