RhoGAP-domain-containing protein

Overview
NameRhoGAP-domain-containing protein
Smed IDSMED30031131
Length (bp)3337
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RhoGAP-domain-containing protein (SMED30031131) t-SNE clustered cells

Violin plots show distribution of expression levels for RhoGAP-domain-containing protein (SMED30031131) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RhoGAP-domain-containing protein (SMED30031131) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RhoGAP-domain-containing protein (SMED30031131) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031131

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30031131SMESG000074052.1 dd_Smed_v4_7153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031131SMESG000074052.1 dd_Smed_v4_7153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30031131SMESG000074052.1 dd_Smed_v4_7153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031131SMESG000074052.1 dd_Smed_v4_7153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031131SMESG000074052.1 dd_Smed_v4_7153_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RhoGAP-domain-containing protein vs. Ensembl Human
Match: TAGAP (T cell activation RhoGTPase activating protein [Source:HGNC Symbol;Acc:HGNC:15669])

HSP 1 Score: 53.5286 bits (127), Expect = 2.326e-6
Identity = 38/150 (25.33%), Postives = 74/150 (49.33%), Query Frame = 1
Query: 1489 MPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKID-TTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            +P+ + ++L  L  +G   EGIFR + +     E   +++  D + ++   +H  A + K F+  I   LL+S       +L  E     +   +ED    L ++  K+P  NL L +H++ +L  I + S++N+M+  N++ C   N+ 
Sbjct:  100 LPRPIQDILTILCLKGPSTEGIFRRAANEKARKELKEELNSGDAVDLERLPVHLLAVVFKDFLRSIPRKLLSS-------DLFEEWMGALEMQDEEDRIEALKQVADKLPRPNLLLLKHLVYVLHLISKNSEVNRMDSSNLAICIGPNML 242          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Human
Match: ARHGAP24 (Rho GTPase activating protein 24 [Source:HGNC Symbol;Acc:HGNC:25361])

HSP 1 Score: 53.1434 bits (126), Expect = 2.841e-6
Identity = 37/162 (22.84%), Postives = 81/162 (50.00%), Query Frame = 1
Query: 1534 GVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVN 2013
            G++ EG+FR+ G   + +  +  +   E      +T +H  A++LK ++  +   ++     E F + +  ++  E+   +E     L K ++ +P  N NL ++I   LD +   S +N+M++QN++T F  N+ +   +D + I +    +  L S +++
Sbjct:   74 GLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKE-----LAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMIS 230          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Human
Match: ARHGAP22 (Rho GTPase activating protein 22 [Source:HGNC Symbol;Acc:HGNC:30320])

HSP 1 Score: 53.1434 bits (126), Expect = 3.381e-6
Identity = 41/174 (23.56%), Postives = 80/174 (45.98%), Query Frame = 1
Query: 1501 LMNLLADLFNE-GVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVN 2013
            L+    D   E G+  EG+FRM G   + +  +  +   E       T +H  A++LK ++  +   ++     E F + +  +   E      +   +L K +  +P  N NL ++I   LD +   S +N+M++QN++T F  N+ +   +D + I +    + HL + L+ 
Sbjct:  191 LVEQCVDFIRERGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEG-----EGTLELAKQVSNLPQANYNLLRYICKFLDEVQAYSNVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLVQHLMTVLIR 359          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Human
Match: ARHGAP22 (Rho GTPase activating protein 22 [Source:HGNC Symbol;Acc:HGNC:30320])

HSP 1 Score: 52.7582 bits (125), Expect = 3.540e-6
Identity = 41/174 (23.56%), Postives = 80/174 (45.98%), Query Frame = 1
Query: 1501 LMNLLADLFNE-GVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVN 2013
            L+    D   E G+  EG+FRM G   + +  +  +   E       T +H  A++LK ++  +   ++     E F + +  +   E      +   +L K +  +P  N NL ++I   LD +   S +N+M++QN++T F  N+ +   +D + I +    + HL + L+ 
Sbjct:   85 LVEQCVDFIRERGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEG-----EGTLELAKQVSNLPQANYNLLRYICKFLDEVQAYSNVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLVQHLMTVLIR 253          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Human
Match: ARHGAP24 (Rho GTPase activating protein 24 [Source:HGNC Symbol;Acc:HGNC:25361])

HSP 1 Score: 52.7582 bits (125), Expect = 3.718e-6
Identity = 37/161 (22.98%), Postives = 80/161 (49.69%), Query Frame = 1
Query: 1534 GVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLV 2010
            G++ EG+FR+ G   + +  +  +   E      +T +H  A++LK ++  +   ++     E F + +  ++  E+   +E     L K ++ +P  N NL ++I   LD +   S +N+M++QN++T F  N+ +   +D + I +    +  L S ++
Sbjct:  167 GLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKE-----LAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMI 322          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Celegans
Match: gei-1 (GEX Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q20440])

HSP 1 Score: 57.3806 bits (137), Expect = 7.666e-8
Identity = 40/159 (25.16%), Postives = 77/159 (48.43%), Query Frame = 1
Query: 1489 MPQWLMNLLADLFNEGVECEGIFRMSG---------SVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFK 1938
            +P+ ++ ++  L N   E  GIFR +G         S+ +S      +   ++L   T +H+ A++LK++   +   L+T    EVF N+ + +  +E   + +         I  +P  N    + +L+ L  + + SQ+N M  QN+S CF+ +LF+
Sbjct:  902 LPRPILEVMKFLRNIAPETVGIFRKNGVKSRIAELRSIIESYSGNTDVFVGENLLDSTQVHDVADLLKQYFRDLPEPLMTVKMSEVFANICSVVPDVERITALQ-------YAILLLPDENREALKTLLLFLKEVSRNSQVNNMTAQNLSVCFTPSLFQ 1053          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Celegans
Match: gei-1 (GEX Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q20440])

HSP 1 Score: 57.3806 bits (137), Expect = 7.666e-8
Identity = 40/159 (25.16%), Postives = 77/159 (48.43%), Query Frame = 1
Query: 1489 MPQWLMNLLADLFNEGVECEGIFRMSG---------SVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFK 1938
            +P+ ++ ++  L N   E  GIFR +G         S+ +S      +   ++L   T +H+ A++LK++   +   L+T    EVF N+ + +  +E   + +         I  +P  N    + +L+ L  + + SQ+N M  QN+S CF+ +LF+
Sbjct:  902 LPRPILEVMKFLRNIAPETVGIFRKNGVKSRIAELRSIIESYSGNTDVFVGENLLDSTQVHDVADLLKQYFRDLPEPLMTVKMSEVFANICSVVPDVERITALQ-------YAILLLPDENREALKTLLLFLKEVSRNSQVNNMTAQNLSVCFTPSLFQ 1053          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Celegans
Match: gei-1 (GEX Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q20440])

HSP 1 Score: 56.9954 bits (136), Expect = 8.533e-8
Identity = 40/159 (25.16%), Postives = 77/159 (48.43%), Query Frame = 1
Query: 1489 MPQWLMNLLADLFNEGVECEGIFRMSG---------SVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFK 1938
            +P+ ++ ++  L N   E  GIFR +G         S+ +S      +   ++L   T +H+ A++LK++   +   L+T    EVF N+ + +  +E   + +         I  +P  N    + +L+ L  + + SQ+N M  QN+S CF+ +LF+
Sbjct: 1071 LPRPILEVMKFLRNIAPETVGIFRKNGVKSRIAELRSIIESYSGNTDVFVGENLLDSTQVHDVADLLKQYFRDLPEPLMTVKMSEVFANICSVVPDVERITALQ-------YAILLLPDENREALKTLLLFLKEVSRNSQVNNMTAQNLSVCFTPSLFQ 1222          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Celegans
Match: gei-1 (GEX Interacting protein [Source:UniProtKB/TrEMBL;Acc:Q20440])

HSP 1 Score: 56.6102 bits (135), Expect = 1.130e-7
Identity = 40/159 (25.16%), Postives = 77/159 (48.43%), Query Frame = 1
Query: 1489 MPQWLMNLLADLFNEGVECEGIFRMSG---------SVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFK 1938
            +P+ ++ ++  L N   E  GIFR +G         S+ +S      +   ++L   T +H+ A++LK++   +   L+T    EVF N+ + +  +E   + +         I  +P  N    + +L+ L  + + SQ+N M  QN+S CF+ +LF+
Sbjct:  895 LPRPILEVMKFLRNIAPETVGIFRKNGVKSRIAELRSIIESYSGNTDVFVGENLLDSTQVHDVADLLKQYFRDLPEPLMTVKMSEVFANICSVVPDVERITALQ-------YAILLLPDENREALKTLLLFLKEVSRNSQVNNMTAQNLSVCFTPSLFQ 1046          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Fly
Match: conu (gene:FBgn0039994 transcript:FBtr0345008)

HSP 1 Score: 52.7582 bits (125), Expect = 1.653e-6
Identity = 42/160 (26.25%), Postives = 73/160 (45.62%), Query Frame = 1
Query: 1483 SEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISET---------DDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            S +P +L  L+ +L   G   EG+ R+ G   Q  E +Y   E+         D+L    T+H  +++LK+++  +   LLT+   ++FY            L   D    L  L   +P  N N  + +L   + II    IN+MN+ N++T  + ++F
Sbjct:  377 SLVPLFLEKLIGELLRRGSREEGLLRIGGHK-QKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHT--------LPSIDQMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMF 527          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Fly
Match: conu (gene:FBgn0039994 transcript:FBtr0111288)

HSP 1 Score: 52.7582 bits (125), Expect = 1.653e-6
Identity = 42/160 (26.25%), Postives = 73/160 (45.62%), Query Frame = 1
Query: 1483 SEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISET---------DDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            S +P +L  L+ +L   G   EG+ R+ G   Q  E +Y   E+         D+L    T+H  +++LK+++  +   LLT+   ++FY            L   D    L  L   +P  N N  + +L   + II    IN+MN+ N++T  + ++F
Sbjct:  377 SLVPLFLEKLIGELLRRGSREEGLLRIGGHK-QKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHT--------LPSIDQMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMF 527          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Fly
Match: conu (gene:FBgn0039994 transcript:FBtr0111285)

HSP 1 Score: 52.7582 bits (125), Expect = 1.653e-6
Identity = 42/160 (26.25%), Postives = 73/160 (45.62%), Query Frame = 1
Query: 1483 SEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISET---------DDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            S +P +L  L+ +L   G   EG+ R+ G   Q  E +Y   E+         D+L    T+H  +++LK+++  +   LLT+   ++FY            L   D    L  L   +P  N N  + +L   + II    IN+MN+ N++T  + ++F
Sbjct:  377 SLVPLFLEKLIGELLRRGSREEGLLRIGGHK-QKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHT--------LPSIDQMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMF 527          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Fly
Match: conu (gene:FBgn0039994 transcript:FBtr0111287)

HSP 1 Score: 52.7582 bits (125), Expect = 1.653e-6
Identity = 42/160 (26.25%), Postives = 73/160 (45.62%), Query Frame = 1
Query: 1483 SEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISET---------DDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            S +P +L  L+ +L   G   EG+ R+ G   Q  E +Y   E+         D+L    T+H  +++LK+++  +   LLT+   ++FY            L   D    L  L   +P  N N  + +L   + II    IN+MN+ N++T  + ++F
Sbjct:  377 SLVPLFLEKLIGELLRRGSREEGLLRIGGHK-QKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHT--------LPSIDQMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMF 527          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Fly
Match: conu (gene:FBgn0039994 transcript:FBtr0302385)

HSP 1 Score: 52.7582 bits (125), Expect = 1.653e-6
Identity = 42/160 (26.25%), Postives = 73/160 (45.62%), Query Frame = 1
Query: 1483 SEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISET---------DDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            S +P +L  L+ +L   G   EG+ R+ G   Q  E +Y   E+         D+L    T+H  +++LK+++  +   LLT+   ++FY            L   D    L  L   +P  N N  + +L   + II    IN+MN+ N++T  + ++F
Sbjct:  377 SLVPLFLEKLIGELLRRGSREEGLLRIGGHK-QKTELLYNELESTFYQNPDNLDNLFRTATVHELSSLLKRWLRELPQPLLTNELIQLFYQCHT--------LPSIDQMNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMF 527          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Zebrafish
Match: tagapa (T cell activation RhoGTPase activating protein a [Source:ZFIN;Acc:ZDB-GENE-040426-1877])

HSP 1 Score: 59.3066 bits (142), Expect = 2.059e-8
Identity = 50/184 (27.17%), Postives = 93/184 (50.54%), Query Frame = 1
Query: 1480 DSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNK---ANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXX---XXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVN 2013
            D   P+ +M++L  L  +G+  EG+FR +G+     E   Q++  D +++D   H     A+++K F+  + G LL          +S +     D + +ED   K  ++      +P  N+ L +H++V+L  I +K+  N+M   N++TC S NL +  S+    I K+ E +  LT+ L++
Sbjct:   98 DGSPPEPIMDILILLQRKGLHTEGVFRRAGNTKAVKEIKAQLN--DGIEVDLKEHPVIWLADLIKDFLRHLPGGLL----------MSEKYKDWMDAMEKEDEDQKCAEIKMLINTLPVPNIQLLKHLIVLLFLISEKADTNKMVSTNLATCVSPNLLQTDSN----IEKMEE-VTKLTAFLID 264          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Zebrafish
Match: tagapa (T cell activation RhoGTPase activating protein a [Source:ZFIN;Acc:ZDB-GENE-040426-1877])

HSP 1 Score: 59.3066 bits (142), Expect = 2.059e-8
Identity = 50/184 (27.17%), Postives = 93/184 (50.54%), Query Frame = 1
Query: 1480 DSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNK---ANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXX---XXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVN 2013
            D   P+ +M++L  L  +G+  EG+FR +G+     E   Q++  D +++D   H     A+++K F+  + G LL          +S +     D + +ED   K  ++      +P  N+ L +H++V+L  I +K+  N+M   N++TC S NL +  S+    I K+ E +  LT+ L++
Sbjct:   98 DGSPPEPIMDILILLQRKGLHTEGVFRRAGNTKAVKEIKAQLN--DGIEVDLKEHPVIWLADLIKDFLRHLPGGLL----------MSEKYKDWMDAMEKEDEDQKCAEIKMLINTLPVPNIQLLKHLIVLLFLISEKADTNKMVSTNLATCVSPNLLQTDSN----IEKMEE-VTKLTAFLID 264          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Zebrafish
Match: tagapa (T cell activation RhoGTPase activating protein a [Source:ZFIN;Acc:ZDB-GENE-040426-1877])

HSP 1 Score: 59.3066 bits (142), Expect = 2.094e-8
Identity = 50/184 (27.17%), Postives = 93/184 (50.54%), Query Frame = 1
Query: 1480 DSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNK---ANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXX---XXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVN 2013
            D   P+ +M++L  L  +G+  EG+FR +G+     E   Q++  D +++D   H     A+++K F+  + G LL          +S +     D + +ED   K  ++      +P  N+ L +H++V+L  I +K+  N+M   N++TC S NL +  S+    I K+ E +  LT+ L++
Sbjct:   81 DGSPPEPIMDILILLQRKGLHTEGVFRRAGNTKAVKEIKAQLN--DGIEVDLKEHPVIWLADLIKDFLRHLPGGLL----------MSEKYKDWMDAMEKEDEDQKCAEIKMLINTLPVPNIQLLKHLIVLLFLISEKADTNKMVSTNLATCVSPNLLQTDSN----IEKMEE-VTKLTAFLID 247          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Zebrafish
Match: ARHGAP22 (si:dkey-191m6.4 [Source:ZFIN;Acc:ZDB-GENE-121214-182])

HSP 1 Score: 58.9214 bits (141), Expect = 2.863e-8
Identity = 41/163 (25.15%), Postives = 80/163 (49.08%), Query Frame = 1
Query: 1531 EGVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVN 2013
            +G++ EG+FRM G   + +  +  +   +      +T +H  A++LK ++  +   ++     E F   +  +   E+   QE     L KL+  +PA N NL ++I   LD +   S  N+M +QN++T F  N+ +   +D + I +    + HL + L++
Sbjct:  187 QGLDEEGLFRMPGQANLVKELQEAFDCGDKPQFDSNTDVHTVASLLKLYLRELPEPVVPFCKYEDFLTCAQLLTKDEEEGIQE-----LGKLVMTLPAANFNLLKYICKFLDEVQSHSHENKMGVQNLATVFGPNMLRPKMEDPVAIMEGTSLVQHLMTVLIS 344          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Zebrafish
Match: arhgap11a (Rho GTPase activating protein 11A [Source:ZFIN;Acc:ZDB-GENE-040426-2562])

HSP 1 Score: 55.0694 bits (131), Expect = 4.117e-7
Identity = 38/162 (23.46%), Postives = 78/162 (48.15%), Query Frame = 1
Query: 1483 SEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKIN 1968
             ++P +L+++   L +  ++ EG+FR SGSV +      ++ + +D        + A +LK+F   +   +LT        +L +     ++  + E+  +  + L   +P  NLN  ++    L T+ Q+   N+M+  N++  F+ NLF H  D   K++
Sbjct:   60 GDLPCFLVDICTTLLDH-LDTEGLFRKSGSVVRVKSLRAKLDQGEDCLSAALPLDIAGLLKQFFRELPEPVLT-------VDLHSAFLKAQELPTAEERTSATVLLSCVLPDTNLNTLRYFFSFLKTVSQRCAENKMDSSNLAVIFAPNLF-HCGDGGEKMS 212          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Xenopus
Match: trhd (tumorhead [Source:Xenbase;Acc:XB-GENE-1214876])

HSP 1 Score: 55.4546 bits (132), Expect = 6.357e-7
Identity = 42/150 (28.00%), Postives = 76/150 (50.67%), Query Frame = 1
Query: 1489 MPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDT-TIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            +P+ +M++L  L+ EG   +GIFR S +     E   ++   D+++ID  ++   A ++  F+  I  S+L+S      Y L  E   IE     E     + +L++++P  N  L QH+  +L  I +KS+ NQM   N++ C +  + 
Sbjct:  367 LPKPIMDMLLLLYEEGPNTKGIFRRSANAKTWKELKEKLISGDEVQIDGESVFVAAAVITDFLRNIPDSILSSD----MYGLWMEATEIEQ---HEYKIDIIKRLLEQLPEANFILLQHLFGVLHHIEKKSEENQMTAFNLALCIAPTML 509          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Xenopus
Match: ARHGAP24 (Rho GTPase activating protein 24 [Source:NCBI gene;Acc:100488856])

HSP 1 Score: 53.5286 bits (127), Expect = 2.028e-6
Identity = 39/147 (26.53%), Postives = 74/147 (50.34%), Query Frame = 1
Query: 1531 EGVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKI 1965
            +G+  EG+FRM G   + +  +  +   E      +T IH  A++LK ++  +   ++     E F + +  ++  E     E    +L+K ++ +P  N NL ++I   LD +   S +N+M++QN++T FS N+ +    D M I
Sbjct:  166 QGLTEEGLFRMPGQANLVKELQDAFDCGEKPSFDSNTDIHTVASLLKLYLRELPEPVIPFSKYEDFISSAKHLSKEE-----ESGMAELVKQVRSLPPVNYNLLKYICRFLDEVQSHSGVNKMSVQNLATVFSPNILRPKVQDPMTI 307          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Xenopus
Match: FAM13A (family with sequence similarity 13 member A [Source:NCBI gene;Acc:100488957])

HSP 1 Score: 52.373 bits (124), Expect = 5.625e-6
Identity = 38/160 (23.75%), Postives = 80/160 (50.00%), Query Frame = 1
Query: 1489 MPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDE--YVYQISETDDLKIDTTIHNKANILKKFI-----SIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLS 1947
            +P  + N++  L   G++ EG+FR++G+V   ++    Y+  E   L  +  +H+ A++LK F+      +I  +LL    +    N +   +S++D L Q             +P ++ +L +++   L  +++    N+MN+ N++T F  + F H+S
Sbjct:   82 IPTLVWNIVEYLRTIGMDQEGLFRVNGNVKMVEQLKLKYESGEQPILGEEMDVHSAASLLKLFLREMPDGVITTALLPKFIEGYQSNDTQRESSLKDLLKQ-------------LPDSHYSLLKYLCHFLTQVVEHCGENRMNVHNLATVFGPSCF-HVS 227          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Mouse
Match: Gm1527 (predicted gene 1527 [Source:MGI Symbol;Acc:MGI:2686373])

HSP 1 Score: 54.299 bits (129), Expect = 9.323e-7
Identity = 40/153 (26.14%), Postives = 79/153 (51.63%), Query Frame = 1
Query: 1480 DSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDT-TIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            + + P+ ++++L+ +  +G   EGIF ++           ++   ++L +   ++H  A ILK+F+  I+G +LTS   E + ++ N++N+       +D    +  L+ K+P  N  L  ++  IL TI   S IN+M   NIST  + ++ 
Sbjct:  299 EGKWPKLIVDILSVIRKQGPSTEGIFVIAPEETSCKALKEKLESGEELDLKKFSVHEVAWILKEFLGHIKGCVLTSTLYEQWLDVPNKVNN-------KDKLRAVKSLLDKLPLENAALLGNLFRILHTIASSSSINKMKPYNISTGIASSIL 444          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Mouse
Match: Arhgap22 (Rho GTPase activating protein 22 [Source:MGI Symbol;Acc:MGI:2443418])

HSP 1 Score: 54.299 bits (129), Expect = 9.577e-7
Identity = 47/200 (23.50%), Postives = 89/200 (44.50%), Query Frame = 1
Query: 1501 LMNLLADLFNE-GVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVNPVTYSNIVKSYVQRKSSVGSVENHSK 2091
            L+    D   E G+  EG+FRM G   + +  +  +   E       T +H  A++LK ++  +   ++     E F + +  +   E      +   +L K +  +P  N NL ++I   LD +   S +N+M++QN++T F  N+ +   +D + I +    + HL + L+          S  +  S  G+VE  S+
Sbjct:  181 LVEQCVDFIRERGLSEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPEPVIPFARYEDFLSCAQLLTKDEG-----EGTVELAKQVSNLPQANYNLLRYICKFLDEVQAHSDVNKMSVQNLATVFGPNILRPQIEDPVTIMEGTSLVQHLMTVLIRKHGQLFAATSLEEPASPHGTVEWGSE 375          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Mouse
Match: 1700006A11Rik (RIKEN cDNA 1700006A11 gene [Source:MGI Symbol;Acc:MGI:1919074])

HSP 1 Score: 53.5286 bits (127), Expect = 1.449e-6
Identity = 40/157 (25.48%), Postives = 88/157 (56.05%), Query Frame = 1
Query: 1459 NMNVRWIDSEMPQWLMNLLADLFNEGVECEGIFRMSG--SVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFS 1923
            +++V   D  +P+ ++++L+ L  +G   EGIFR+SG  S   + +      +  +LK +  +   A++LK+F+  I+GS+LTS   +++ ++ ++ N       +E+    +  L+Q++P  N++L + +  +L  I + S +N+M   ++S C +
Sbjct:   70 DLSVVCDDGNLPKAILDMLSILNEKGAITEGIFRISGNMSACHALKERLDYGKKVNLKKECVL-AVASVLKEFLHNIQGSVLTSRLYDIWLDVLDQEN-------EEEKLAAVQSLLQRLPYPNVSLLRELFRMLHNIERNSAVNKMTAYSLSVCMA 218          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Mouse
Match: Arhgap24 (Rho GTPase activating protein 24 [Source:MGI Symbol;Acc:MGI:1922647])

HSP 1 Score: 52.373 bits (124), Expect = 3.737e-6
Identity = 37/162 (22.84%), Postives = 81/162 (50.00%), Query Frame = 1
Query: 1534 GVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVN 2013
            G++ EG+FR+ G   + +  +  +   E      +T +H  A++LK ++  +   ++     E F + +  ++  E+   +E     L+K ++ +P  N NL ++I   LD +   S +N+M+ QN++T F  N+ +   +D + I +    +  L S +++
Sbjct:   75 GLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVVPYAKYEDFLSCATLLSKEEEAGVKE-----LMKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSAQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMIS 231          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Mouse
Match: Arhgap24 (Rho GTPase activating protein 24 [Source:MGI Symbol;Acc:MGI:1922647])

HSP 1 Score: 51.6026 bits (122), Expect = 6.551e-6
Identity = 37/161 (22.98%), Postives = 80/161 (49.69%), Query Frame = 1
Query: 1534 GVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLV 2010
            G++ EG+FR+ G   + +  +  +   E      +T +H  A++LK ++  +   ++     E F + +  ++  E+   +E     L+K ++ +P  N NL ++I   LD +   S +N+M+ QN++T F  N+ +   +D + I +    +  L S ++
Sbjct:   72 GLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVVPYAKYEDFLSCATLLSKEEEAGVKE-----LMKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSAQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMI 227          
BLAST of RhoGAP-domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BL80|RHG22_MOUSE (Rho GTPase-activating protein 22 OS=Mus musculus OX=10090 GN=Arhgap22 PE=1 SV=2)

HSP 1 Score: 54.299 bits (129), Expect = 6.699e-6
Identity = 47/200 (23.50%), Postives = 89/200 (44.50%), Query Frame = 1
Query: 1501 LMNLLADLFNE-GVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVNPVTYSNIVKSYVQRKSSVGSVENHSK 2091
            L+    D   E G+  EG+FRM G   + +  +  +   E       T +H  A++LK ++  +   ++     E F + +  +   E      +   +L K +  +P  N NL ++I   LD +   S +N+M++QN++T F  N+ +   +D + I +    + HL + L+          S  +  S  G+VE  S+
Sbjct:  181 LVEQCVDFIRERGLSEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPEPVIPFARYEDFLSCAQLLTKDEG-----EGTVELAKQVSNLPQANYNLLRYICKFLDEVQAHSDVNKMSVQNLATVFGPNILRPQIEDPVTIMEGTSLVQHLMTVLIRKHGQLFAATSLEEPASPHGTVEWGSE 375          
BLAST of RhoGAP-domain-containing protein vs. TrEMBL
Match: A0A2I0LRJ4 (Rho GTPase-activating protein 20-like OS=Columba livia OX=8932 GN=A306_00012734 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.044e-7
Identity = 43/159 (27.04%), Postives = 81/159 (50.94%), Query Frame = 1
Query: 1480 DSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDT-TIHNKANILKKFISIIEGSLLTSITKEVFY------NLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            D  +P+ +M++L  L+NEG    GIFR S +     E   +++  DD+++D  ++   A ++  F+  I  S+L+S    ++       N +++I +I+  ++Q             +P  NL L +H+  +L  I Q S +NQMN  N++ C + N+ 
Sbjct:  147 DGILPKPIMDMLLLLYNEGPSTRGIFRRSANAKTCKELKEKLNSGDDVQVDGESVFVAAAVITDFLRNIPDSVLSSDMHGLWMEAVDTENRAHKIEAIKSLVNQ-------------LPEANLILLRHLFGVLHQIEQNSGVNQMNAFNLALCIAPNML 292          
BLAST of RhoGAP-domain-containing protein vs. TrEMBL
Match: A0A1V4KZE4 (Rho-GAP domain-containing protein OS=Patagioenas fasciata monilis OX=372326 GN=AV530_003569 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 8.661e-7
Identity = 42/159 (26.42%), Postives = 81/159 (50.94%), Query Frame = 1
Query: 1480 DSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDT-TIHNKANILKKFISIIEGSLLTSITKEVFY------NLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            D  +P+ +M++L  L+NEG    GIFR S +     E   +++  D++++D  ++   A ++  F+  I  S+L+S    ++       N +++I +I+  ++Q             +P  NL L +H+  +L  I Q S +NQMN  N++ C + N+ 
Sbjct:  367 DGILPKPIMDMLLLLYNEGPSTRGIFRRSANAKTCKELKEKLNSGDEVRVDGESVFVAAAVITDFLRNIPDSVLSSDMHGLWMEAVDTENRAHKIEAIKSLVNQ-------------LPEANLILLRHLFGVLHQIEQNSGVNQMNAFNLALCIAPNML 512          
BLAST of RhoGAP-domain-containing protein vs. TrEMBL
Match: A0A1V4KY74 (Rho GTPase-activating protein 20-like OS=Patagioenas fasciata monilis OX=372326 GN=AV530_003569 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.036e-7
Identity = 42/159 (26.42%), Postives = 81/159 (50.94%), Query Frame = 1
Query: 1480 DSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDT-TIHNKANILKKFISIIEGSLLTSITKEVFY------NLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            D  +P+ +M++L  L+NEG    GIFR S +     E   +++  D++++D  ++   A ++  F+  I  S+L+S    ++       N +++I +I+  ++Q             +P  NL L +H+  +L  I Q S +NQMN  N++ C + N+ 
Sbjct:  367 DGILPKPIMDMLLLLYNEGPSTRGIFRRSANAKTCKELKEKLNSGDEVRVDGESVFVAAAVITDFLRNIPDSVLSSDMHGLWMEAVDTENRAHKIEAIKSLVNQ-------------LPEANLILLRHLFGVLHQIEQNSGVNQMNAFNLALCIAPNML 512          
BLAST of RhoGAP-domain-containing protein vs. TrEMBL
Match: A0A093R306 (Rho GTPase-activating protein 20 (Fragment) OS=Phalacrocorax carbo OX=9209 GN=N336_02878 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.418e-6
Identity = 42/159 (26.42%), Postives = 82/159 (51.57%), Query Frame = 1
Query: 1480 DSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDT-TIHNKANILKKFISIIEGSLLTSITKEVFY------NLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            D  +P+ +M++L  L++EG    GIFR S +     E   +++  DD+++D  ++   A ++  F+  I  S+L+S    ++       N++++I +I+  ++Q             +P  NL L +H+  +L  I Q S +NQMN  N++ C + N+ 
Sbjct:  288 DGILPKPIMDMLLLLYHEGPSTRGIFRRSANAKTCKELKEKLNSGDDVQVDGESVFVAAAVITDFLRNIPDSVLSSDMHGLWMEAVDTENMAHKIEAIKSLVNQ-------------LPEANLILLRHLFGVLHHIEQNSGVNQMNAFNLALCIAPNML 433          
BLAST of RhoGAP-domain-containing protein vs. TrEMBL
Match: A0A2P4T5M9 (Uncharacterized protein (Fragment) OS=Bambusicola thoracicus OX=9083 GN=CIB84_004620 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.487e-6
Identity = 46/153 (30.07%), Postives = 83/153 (54.25%), Query Frame = 1
Query: 1480 DSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDT-TIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            D  +P+ L+++L+ L+ EG   EGIFR SGS     E   ++    ++ +   +I   A++ K F+  I GS+LTS        L ++  S+ D  + E+    + +LI+++P  N+ L ++I  +L  I  +S+ NQMN  N++ C + +L 
Sbjct:  158 DDNLPKPLLDMLSLLYQEGPSTEGIFRRSGSAKTCKELKEKLDSGAEVDLACESIFVTASLFKDFLRNIPGSILTS-------QLCDKWVSVMDQGNNEEKIKSIQRLIEQLPRANVVLLRYIFGVLHGIEMRSEENQMNAFNLAICIAPSLL 303          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-191m6.4 (rho GTPase-activating protein 22 [Source:NCBI gene;Acc:103041296])

HSP 1 Score: 57.3806 bits (137), Expect = 8.006e-8
Identity = 52/222 (23.42%), Postives = 104/222 (46.85%), Query Frame = 1
Query: 1501 LMNLLADLFNE-GVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVN------PVTYSNIVKSYVQRKSSVGSVENHSKSNGVGCIDQES-NSPT 2136
            L+    D   E G++ EG+FRM G   + +  +  +   +      +T +H  A++LK ++  +   ++     + F + +  +   E     E+   +L + ++ +PA N NL ++I   LD +   S  N+M++QN++T F  N+ +   +D + I +    + HL + L++      P   S   ++ ++ KS         ++N VG I +E   SPT
Sbjct:  178 LVEQCVDFIREQGLDEEGLFRMPGQANLVKELQDAFDCGDKPQFDSNTDVHTVASLLKLYLRELPEPVIPFCKYDDFLSCAQILAKDE-----EEALQQLWQQVKTLPAANFNLLKYICKFLDEVQSHSMQNKMSVQNLATVFGPNILRPKMEDPVAIMEGTSLVQHLMTVLISKHDQLYPEQDSEAPEACLEVKS------QDQQTNLVGWISEEDLQSPT 388          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000053633.1 (rho GTPase-activating protein 20-like [Source:NCBI gene;Acc:103036999])

HSP 1 Score: 56.6102 bits (135), Expect = 1.653e-7
Identity = 45/156 (28.85%), Postives = 77/156 (49.36%), Query Frame = 1
Query: 1462 MNVRWIDSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQI-SETDDLKID-TTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFS 1923
            ++V   D+ +P+ +M++L  L+ EG    GIFR S       E    + S   D+++   +I   A + K F+  I GSLL S   E +    +  +  ED     +    +  L+  +P+ N+ L +HIL +L  I  +++ NQMN  N++ C S
Sbjct:  366 LSVVCTDNSLPKPIMDMLVFLYQEGPFTRGIFRRSAGAKACRELRDILDSGFQDIQLARQSIFVIAAVFKDFLRSIPGSLLLSDLYEKWMATMDSSDEAED-----NQLQAIQSLVTSLPSENILLLKHILAVLYNIQLRAEENQMNAFNLAVCIS 516          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Cavefish
Match: arhgap25 (Rho GTPase activating protein 25 [Source:ZFIN;Acc:ZDB-GENE-060526-210])

HSP 1 Score: 51.6026 bits (122), Expect = 5.135e-6
Identity = 42/160 (26.25%), Postives = 78/160 (48.75%), Query Frame = 1
Query: 1501 LMNLLADLFNE-GVECEGIFRMSGSVFQSDEY--VYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINK 1971
            L+   A+   E G++ EGIFR+ G   Q   +   +   E      DT +H   ++LK ++  +   ++     + F + S  +++     +    + KL K I  +P  N NL  +I   L  + Q S++N+M+++N++T    NLFK   +DA+ + K
Sbjct:  133 LVEKCAEFIKEHGLDEEGIFRLPGQENQVKHFREAFDAGERPSFPSDTDVHTVGSLLKLYLRELPEPVVPWTQYQDFLDSSLMLDA-----TTAAGREKLEKQISLLPKVNYNLLSYICRFLFEVQQHSKVNKMSVENLATVMGVNLFKPQVEDAISMMK 287          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Sea Lamprey
Match: si:ch211-247j9.1 (si:ch211-247j9.1 [Source:ZFIN;Acc:ZDB-GENE-091204-212])

HSP 1 Score: 53.5286 bits (127), Expect = 1.912e-7
Identity = 50/204 (24.51%), Postives = 93/204 (45.59%), Query Frame = 1
Query: 1531 EGVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLS--QEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFK-HLSDDAMKINKLFECILHLTSKLVNPVTYSNIVKSYVQRKSSVGSVENHSKSNGVGCIDQESN 2127
            +G+  EG+FR+ G   + +  +  +   E      DT +H  A+++K ++  +   +       V ++L +E  S    L+  Q +   +L +L+  +P  N NL ++I   L  +   + IN+M+IQN++T F  N+ +  + D A  +      + HL S L+               KSS+      S++NG G   +ES 
Sbjct:   12 QGLAEEGLFRLPGQTNLVRELQEAFDCGERPIFDGDTDVHTVASLVKLYLRELPEPV-------VPFSLYSEFLSCASLLAKNQSEGVKELTQLVNSLPLANFNLLKYICSFLYEVQSHASINKMSIQNLATVFGPNILRPKVEDPATIMEAGATTVQHLMSTLIEQHAVLFARGPEASTKSSL------SRTNGTGFRRRESG 202          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Sea Lamprey
Match: ralbp1 (ralA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2098])

HSP 1 Score: 52.373 bits (124), Expect = 5.719e-7
Identity = 51/177 (28.81%), Postives = 93/177 (52.54%), Query Frame = 1
Query: 1534 GVECEGIFRMSGSVFQSDEY--VYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEIN-SIEDFLSQ---EDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCF---SQNLFKHLSDDAMKINKLFECILHLTSKLVNPVTYSNIV 2037
            G++CEGI+R+SG   + DE   +Y   E+ +L+ D   H  A++LK+++  +  SLLT            E++  IE+  S+   ED   +  +L+ ++P  N +L   ++V +D ++     N+MN+Q IS      +Q   + L    M +N LF+ + +L S  + P+ +SN+ 
Sbjct:  232 GLKCEGIYRVSGIKSKVDELKAIYDREESPNLE-DYDPHTVASVLKQYLRELPESLLT-----------RELHPKIEEACSRPLVEDRLAECKRLLAELPKFNRHLLSWLMVHMDHVVLHESDNKMNVQGISIVLHPTTQISHRLLYMFFMNVNDLFKNV-NLNSA-IRPLRWSNLA 394          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Sea Lamprey
Match: arhgap18 (Rho GTPase activating protein 18 [Source:ZFIN;Acc:ZDB-GENE-070502-1])

HSP 1 Score: 50.8322 bits (120), Expect = 1.439e-6
Identity = 47/157 (29.94%), Postives = 75/157 (47.77%), Query Frame = 1
Query: 1486 EMPQWLMNLLADLFNEGVECEGIFRMSG------SVFQSDEY-VYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLF 1935
            ++P +L  LL  L   G++ EGIFR+ G      S+ Q  E   Y  + T D   D   H+ A++LK FI  +   LLT+     F        S+E    ++     L  LI  +PA N ++ + IL +L  + + S   +M++ N+S   + NLF
Sbjct:  282 KVPLFLQELLTHLEQTGLDTEGIFRIPGSSSRIKSLRQELEAGFYDGAVTWD---DVRPHDAASLLKLFIRELPAPLLTAEYLTAF-------TSVEKIEIRKQRIRALNLLIILLPAANRDVLKAILELLLKVSEASTATRMDLWNVSLIMAPNLF 428          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Medaka
Match: si:dkey-191m6.4 (Rho GTPase activating protein 22 [Source:NCBI gene;Acc:101159226])

HSP 1 Score: 53.1434 bits (126), Expect = 1.934e-6
Identity = 44/181 (24.31%), Postives = 84/181 (46.41%), Query Frame = 1
Query: 1501 LMNLLADLFNE-GVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLS--------QEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLV 2010
            L+    D   E G++ EG+FRM G   + +  +  +   +      +T IH  A++LK ++  +   ++       FY         EDFL+        +E+   +L K +  +P  N NL ++I   LD +   S  N+M++QN++T F  N+ +   +D + + +    + HL + L+
Sbjct:  249 LVEQCVDFIRERGLDEEGLFRMPGQANLVKELQEAFDCGDKPLFDSNTDIHTVASLLKLYLRELPEPVIP------FYQ-------YEDFLTCAQLLAKNEEEGVQELGKQVGTLPQPNYNLLKYICKFLDEVQSHSNENKMSVQNLATVFGPNILRPKMEDPVSLMEGTSLVQHLMTVLI 416          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Medaka
Match: si:dkey-191m6.4 (Rho GTPase activating protein 22 [Source:NCBI gene;Acc:101159226])

HSP 1 Score: 52.7582 bits (125), Expect = 2.007e-6
Identity = 44/181 (24.31%), Postives = 84/181 (46.41%), Query Frame = 1
Query: 1501 LMNLLADLFNE-GVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLS--------QEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLV 2010
            L+    D   E G++ EG+FRM G   + +  +  +   +      +T IH  A++LK ++  +   ++       FY         EDFL+        +E+   +L K +  +P  N NL ++I   LD +   S  N+M++QN++T F  N+ +   +D + + +    + HL + L+
Sbjct:  166 LVEQCVDFIRERGLDEEGLFRMPGQANLVKELQEAFDCGDKPLFDSNTDIHTVASLLKLYLRELPEPVIP------FYQ-------YEDFLTCAQLLAKNEEEGVQELGKQVGTLPQPNYNLLKYICKFLDEVQSHSNENKMSVQNLATVFGPNILRPKMEDPVSLMEGTSLVQHLMTVLI 333          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Medaka
Match: si:dkey-191m6.4 (Rho GTPase activating protein 22 [Source:NCBI gene;Acc:101159226])

HSP 1 Score: 52.7582 bits (125), Expect = 2.020e-6
Identity = 44/181 (24.31%), Postives = 84/181 (46.41%), Query Frame = 1
Query: 1501 LMNLLADLFNE-GVECEGIFRMSGS--VFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLS--------QEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLV 2010
            L+    D   E G++ EG+FRM G   + +  +  +   +      +T IH  A++LK ++  +   ++       FY         EDFL+        +E+   +L K +  +P  N NL ++I   LD +   S  N+M++QN++T F  N+ +   +D + + +    + HL + L+
Sbjct:  147 LVEQCVDFIRERGLDEEGLFRMPGQANLVKELQEAFDCGDKPLFDSNTDIHTVASLLKLYLRELPEPVIP------FYQ-------YEDFLTCAQLLAKNEEEGVQELGKQVGTLPQPNYNLLKYICKFLDEVQSHSNENKMSVQNLATVFGPNILRPKMEDPVSLMEGTSLVQHLMTVLI 314          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045475.1 (Rho GTPase activating protein 40 [Source:NCBI gene;Acc:101163969])

HSP 1 Score: 50.447 bits (119), Expect = 9.695e-6
Identity = 41/160 (25.62%), Postives = 74/160 (46.25%), Query Frame = 1
Query: 1489 MPQWLMNLLADLFNEGVECEGIFRMSGSV---------FQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKH 1941
            +P +L  LL+ L   G++ EGI R+ GS           +++ Y   IS  +      + ++ A +LKKFI  +   LLT+          N  +++ +    +     L  LI  +P  N N  + +L  L  ++ + + N+MN+  ++T  + NLF H
Sbjct:  362 IPLFLERLLSFLEKRGIDSEGILRVPGSQSRIKLLQQNLEANFYSGHISWDE-----VSPNDAAALLKKFIRELPAPLLTA-------EYLNSFSAVREITELKQKLHMLNLLILLLPEPNRNTLKALLEFLSKVVSREKKNRMNLWAVATIMAPNLFLH 509          
BLAST of RhoGAP-domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000007062.2 (Rho GTPase activating protein 40 [Source:NCBI gene;Acc:101163969])

HSP 1 Score: 50.447 bits (119), Expect = 9.722e-6
Identity = 41/160 (25.62%), Postives = 74/160 (46.25%), Query Frame = 1
Query: 1489 MPQWLMNLLADLFNEGVECEGIFRMSGSV---------FQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKH 1941
            +P +L  LL+ L   G++ EGI R+ GS           +++ Y   IS  +      + ++ A +LKKFI  +   LLT+          N  +++ +    +     L  LI  +P  N N  + +L  L  ++ + + N+MN+  ++T  + NLF H
Sbjct:  352 IPLFLERLLSFLEKRGIDSEGILRVPGSQSRIKLLQQNLEANFYSGHISWDE-----VSPNDAAALLKKFIRELPAPLLTA-------EYLNSFSAVREITELKQKLHMLNLLILLLPEPNRNTLKALLEFLSKVVSREKKNRMNLWAVATIMAPNLFLH 499          
BLAST of RhoGAP-domain-containing protein vs. Planmine SMEST
Match: SMESG000074052.1 (SMESG000074052.1)

HSP 1 Score: 2026.52 bits (5249), Expect = 0.000e+0
Identity = 1034/1041 (99.33%), Postives = 1036/1041 (99.52%), Query Frame = 1
Query:   43 SDARLISPKLVRKRSSSLNTEAANRYRDNNIAQNKFQSKQMKKYASSGNLSNSDTGSTNKLKNKTNYDGYFLFVNWYKDFKSIKSSLLSIQDQNIFKNEFPRQTDINMKNYSSTTFLIINSQKIDNEYETFFINDYLTRLEELMNWAEKENKEFYDEIFKAIELITKQMGNEDEHQFLQTGDNHQELLEGQLKDRRSSEALIIQNKNQPIPSFLPREYQGQMNILRCACEFEIYYLSQDKKNERNYKSVPRIGVLSNQDINIFTKSFKLKDSYALKHTYLDQCSDTQIPNIDSCLRIGGPFGNDMIIRFQSPLTRNEWFNYVNDEINSYQETIKNSTTTITIFNDTVPSSSAPLVXXXXXXXXXXXXXXLKKMAMNTFEIKDIDVKDLSIVFLLKNKENVLHDDVSLMVLQEHANNVQENSCVKSCIYCDKGTAAVKIIYYLRCNRPLNESMNKGLAQTXXXXXXXXXQNKYNMNVRWIDSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVNPVTYSNIVKSYVQRKSSVGSVENHSKSNGVGCIDQESNSPTTSRTVSDSNEDKKPLIDQPRVPPRRKNINLHNRAAFNTPDESPDTLKRNSLTKKISLNDKQQSLSDELPTDGNNNPLDEVDSKLTARSPIDPILPVKSNSNLNQKPRRLSRSSNTFNASSPENVRLNESSNFYRQNQINRKHNKTNPITDISNSNTNNAKQNVNQLKTGAKLTRSTDRVITKARSRSQSKVGENVPSNTPRSNKTTYHFNANSSHDTDFQRKPIVERQRSSSACRVPKLTRQYESNLSTSKPPLPNKKNSIISEAPKVSKLVRDLEFKTTRPNERPASNVYLKPQGPIRPNHTIHINNAQELQVEKSSLSHPTNRFSLHEKLNDSNDEDVTYI 3165
            SDARLISPKLVRKRSSSLNTEAANRYRDNNIAQNK QSKQMKKYASSGNLSNSDTGSTNK+KNKTNYDGYFLFVNWYKDFKSIKSSLLSIQDQNIFKNEFPRQTDINMKNYSST FLIINSQKIDNEYETFFI+DYLTRLEELMNWAEKENKEFYDEIFKAIELITKQMGNEDEHQFLQTGDNHQELLEGQLKDRRSSEALIIQNKNQPIPSFLPREYQGQMNILRCACEFEIYYLSQDKKNERNYKSVPRIGVLSNQDINIFTKSFKLKDSYALKHTYLDQCSDTQIPNIDSCLRIGGPFGNDMIIRFQSPLTRNEWFNYVNDEINSYQETIKNSTTTITIFNDTVPSSSAPLVSRSITISGNTSGSSLKKMAMNTFEIKDIDVKDLSIVFLLKNKENVLHDDVSLMVLQEHANNVQENSCVKSCIYCDKGTAAVKIIYYLRCNRPLNESMNKGLAQTKKPVPVKPKQNKYNMNVRWIDSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDLQTKLLKLIQKIPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVNPVTYSNIVKSYVQRKSSVGSVENHSKSNGVGCIDQESNSPTTSRTVSDSNEDKKPLIDQPRVPPRRKNINL NRAAFNTPDESP TLKRNSLTKKISLNDKQQSLSDELPTDGNNNPLDEVDSKLTARSPIDPILPVKSNSNLNQKPRRLSRSSNTFNASSPENVRLNESSNFYRQNQINRKHNKTNPITDISNSNTNNAKQNVNQLKTGAKLTRSTDRVITKARSRSQSKVGENVPSNTPRSNKTTYHFNANSSHDTDFQRKPIVERQRSSSACRVPKLTRQYESNLSTSKPPLPNKKNSIISEAPKVSKLVRDLEFKTTRPNER ASNVYLKPQGPIRPNHTIHINNAQELQVEKSSLSHPTNRFSLHEKLNDSNDEDVTYI
Sbjct:    3 SDARLISPKLVRKRSSSLNTEAANRYRDNNIAQNKSQSKQMKKYASSGNLSNSDTGSTNKIKNKTNYDGYFLFVNWYKDFKSIKSSLLSIQDQNIFKNEFPRQTDINMKNYSST-FLIINSQKIDNEYETFFISDYLTRLEELMNWAEKENKEFYDEIFKAIELITKQMGNEDEHQFLQTGDNHQELLEGQLKDRRSSEALIIQNKNQPIPSFLPREYQGQMNILRCACEFEIYYLSQDKKNERNYKSVPRIGVLSNQDINIFTKSFKLKDSYALKHTYLDQCSDTQIPNIDSCLRIGGPFGNDMIIRFQSPLTRNEWFNYVNDEINSYQETIKNSTTTITIFNDTVPSSSAPLVSRSITISGNTSGSSLKKMAMNTFEIKDIDVKDLSIVFLLKNKENVLHDDVSLMVLQEHANNVQENSCVKSCIYCDKGTAAVKIIYYLRCNRPLNESMNKGLAQTKKPVPVKPKQNKYNMNVRWIDSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDLQTKLLKLIQKIPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVNPVTYSNIVKSYVQRKSSVGSVENHSKSNGVGCIDQESNSPTTSRTVSDSNEDKKPLIDQPRVPPRRKNINLRNRAAFNTPDESPVTLKRNSLTKKISLNDKQQSLSDELPTDGNNNPLDEVDSKLTARSPIDPILPVKSNSNLNQKPRRLSRSSNTFNASSPENVRLNESSNFYRQNQINRKHNKTNPITDISNSNTNNAKQNVNQLKTGAKLTRSTDRVITKARSRSQSKVGENVPSNTPRSNKTTYHFNANSSHDTDFQRKPIVERQRSSSACRVPKLTRQYESNLSTSKPPLPNKKNSIISEAPKVSKLVRDLEFKTTRPNERQASNVYLKPQGPIRPNHTIHINNAQELQVEKSSLSHPTNRFSLHEKLNDSNDEDVTYI 1042          
BLAST of RhoGAP-domain-containing protein vs. Planmine SMEST
Match: SMESG000074052.1 (SMESG000074052.1)

HSP 1 Score: 1950.64 bits (5052), Expect = 0.000e+0
Identity = 995/1001 (99.40%), Postives = 997/1001 (99.60%), Query Frame = 1
Query:  163 MKKYASSGNLSNSDTGSTNKLKNKTNYDGYFLFVNWYKDFKSIKSSLLSIQDQNIFKNEFPRQTDINMKNYSSTTFLIINSQKIDNEYETFFINDYLTRLEELMNWAEKENKEFYDEIFKAIELITKQMGNEDEHQFLQTGDNHQELLEGQLKDRRSSEALIIQNKNQPIPSFLPREYQGQMNILRCACEFEIYYLSQDKKNERNYKSVPRIGVLSNQDINIFTKSFKLKDSYALKHTYLDQCSDTQIPNIDSCLRIGGPFGNDMIIRFQSPLTRNEWFNYVNDEINSYQETIKNSTTTITIFNDTVPSSSAPLVXXXXXXXXXXXXXXLKKMAMNTFEIKDIDVKDLSIVFLLKNKENVLHDDVSLMVLQEHANNVQENSCVKSCIYCDKGTAAVKIIYYLRCNRPLNESMNKGLAQTXXXXXXXXXQNKYNMNVRWIDSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVNPVTYSNIVKSYVQRKSSVGSVENHSKSNGVGCIDQESNSPTTSRTVSDSNEDKKPLIDQPRVPPRRKNINLHNRAAFNTPDESPDTLKRNSLTKKISLNDKQQSLSDELPTDGNNNPLDEVDSKLTARSPIDPILPVKSNSNLNQKPRRLSRSSNTFNASSPENVRLNESSNFYRQNQINRKHNKTNPITDISNSNTNNAKQNVNQLKTGAKLTRSTDRVITKARSRSQSKVGENVPSNTPRSNKTTYHFNANSSHDTDFQRKPIVERQRSSSACRVPKLTRQYESNLSTSKPPLPNKKNSIISEAPKVSKLVRDLEFKTTRPNERPASNVYLKPQGPIRPNHTIHINNAQELQVEKSSLSHPTNRFSLHEKLNDSNDEDVTYI 3165
            MKKYASSGNLSNSDTGSTNK+KNKTNYDGYFLFVNWYKDFKSIKSSLLSIQDQNIFKNEFPRQTDINMKNYSST FLIINSQKIDNEYETFFI+DYLTRLEELMNWAEKENKEFYDEIFKAIELITKQMGNEDEHQFLQTGDNHQELLEGQLKDRRSSEALIIQNKNQPIPSFLPREYQGQMNILRCACEFEIYYLSQDKKNERNYKSVPRIGVLSNQDINIFTKSFKLKDSYALKHTYLDQCSDTQIPNIDSCLRIGGPFGNDMIIRFQSPLTRNEWFNYVNDEINSYQETIKNSTTTITIFNDTVPSSSAPLVSRSITISGNTSGSSLKKMAMNTFEIKDIDVKDLSIVFLLKNKENVLHDDVSLMVLQEHANNVQENSCVKSCIYCDKGTAAVKIIYYLRCNRPLNESMNKGLAQTKKPVPVKPKQNKYNMNVRWIDSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDLQTKLLKLIQKIPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVNPVTYSNIVKSYVQRKSSVGSVENHSKSNGVGCIDQESNSPTTSRTVSDSNEDKKPLIDQPRVPPRRKNINL NRAAFNTPDESP TLKRNSLTKKISLNDKQQSLSDELPTDGNNNPLDEVDSKLTARSPIDPILPVKSNSNLNQKPRRLSRSSNTFNASSPENVRLNESSNFYRQNQINRKHNKTNPITDISNSNTNNAKQNVNQLKTGAKLTRSTDRVITKARSRSQSKVGENVPSNTPRSNKTTYHFNANSSHDTDFQRKPIVERQRSSSACRVPKLTRQYESNLSTSKPPLPNKKNSIISEAPKVSKLVRDLEFKTTRPNER ASNVYLKPQGPIRPNHTIHINNAQELQVEKSSLSHPTNRFSLHEKLNDSNDEDVTYI
Sbjct:    1 MKKYASSGNLSNSDTGSTNKIKNKTNYDGYFLFVNWYKDFKSIKSSLLSIQDQNIFKNEFPRQTDINMKNYSST-FLIINSQKIDNEYETFFISDYLTRLEELMNWAEKENKEFYDEIFKAIELITKQMGNEDEHQFLQTGDNHQELLEGQLKDRRSSEALIIQNKNQPIPSFLPREYQGQMNILRCACEFEIYYLSQDKKNERNYKSVPRIGVLSNQDINIFTKSFKLKDSYALKHTYLDQCSDTQIPNIDSCLRIGGPFGNDMIIRFQSPLTRNEWFNYVNDEINSYQETIKNSTTTITIFNDTVPSSSAPLVSRSITISGNTSGSSLKKMAMNTFEIKDIDVKDLSIVFLLKNKENVLHDDVSLMVLQEHANNVQENSCVKSCIYCDKGTAAVKIIYYLRCNRPLNESMNKGLAQTKKPVPVKPKQNKYNMNVRWIDSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSIEDFLSQEDLQTKLLKLIQKIPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECILHLTSKLVNPVTYSNIVKSYVQRKSSVGSVENHSKSNGVGCIDQESNSPTTSRTVSDSNEDKKPLIDQPRVPPRRKNINLRNRAAFNTPDESPVTLKRNSLTKKISLNDKQQSLSDELPTDGNNNPLDEVDSKLTARSPIDPILPVKSNSNLNQKPRRLSRSSNTFNASSPENVRLNESSNFYRQNQINRKHNKTNPITDISNSNTNNAKQNVNQLKTGAKLTRSTDRVITKARSRSQSKVGENVPSNTPRSNKTTYHFNANSSHDTDFQRKPIVERQRSSSACRVPKLTRQYESNLSTSKPPLPNKKNSIISEAPKVSKLVRDLEFKTTRPNERQASNVYLKPQGPIRPNHTIHINNAQELQVEKSSLSHPTNRFSLHEKLNDSNDEDVTYI 1000          
BLAST of RhoGAP-domain-containing protein vs. Planmine SMEST
Match: SMESG000074055.1 (SMESG000074055.1)

HSP 1 Score: 121.324 bits (303), Expect = 9.017e-28
Identity = 118/451 (26.16%), Postives = 214/451 (47.45%), Query Frame = 1
Query:  844 KLKDSYALKHTYLDQCSDTQIPNIDSCLRIGGPFGNDMIIRFQSPLTRNEWFNYVNDEINSYQETIKNSTTTITI---FNDTVPSSSAPLVXXXXXXXXXXXXXXLKKMAMNTFEIKDIDVKDLSIVFLLKNKENVLHDDVSLMVLQEHAN-NVQENSCVKSCIYCD---KGTAAVKIIYYLRCNRPLNESMNKGLAQTXXXXXXXXXQNKYNMNVRWIDSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSI--EDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMK-INKLFECILHLTSKLVNPVTYSNIVKSYVQRKSSVGSVENHSKSNGVGCIDQESNSPTTSRTVSDSNE 2166
            KL     +KH  + + +D  IP IDSC  I  P G ++++ F+SP   +E+ +  ++ +  Y     N    + +    ND +  S+      ++++SG T G  LK      F   DI +    +   +  +   + DD +++ + EHA  +  +  C   C Y       T  ++I +Y       N ++     Q             Y++  +W   EMP+WL  LL+D++ +G + +G+FR++       ++   + + DD  I   I NKA I K F+  IEGSL+T  T++    L  +   I  E+F      Q+K +KL Q +P  +  LFQ+ILV+L+ II  S   ++    I+   + ++F  +       I+ L E  ++LT K+V P     I+ SY++ K+   +++N S+++    ++ +S +  +S T SDS +
Sbjct:   63 KLILDLCMKHALISRATDVAIPKIDSCRLISDPSGYEVLLNFKSPSIASEYESKFSESMRMYNTKFANICFDVNVTNLVNDKLKESA------NVSLSGLTLGKDLKSWIEQEFIFPDIHMPCYILQLHVGEELLTIRDDATILQVHEHAAYSHAKGHCFIGCFYESVKPNSTLLIEINFY-------NHTIEYENGQIP-----------YSIEEKWGVGEMPKWLTRLLSDIYCDGPDSKGVFRLNAKDSSFSKWYKHMLDCDDFIISEDIFNKAAIFKFFLRNIEGSLMTKNTRKQLNGLCKKFMEISFEEFFKNSKKQSKFIKLFQSLPKTHYFLFQNILVVLNAIID-SPNAKVEPFAIARAIAPSIFPLVRLSYWGNISNLLEAAIYLTDKIVKPADKKRIIDSYIKVKNESNNIKNESRNDSQTFVENDSMT-LSSITESDSKQ 487          
BLAST of RhoGAP-domain-containing protein vs. Planmine SMEST
Match: SMESG000074055.1 (SMESG000074055.1)

HSP 1 Score: 120.939 bits (302), Expect = 1.108e-27
Identity = 118/451 (26.16%), Postives = 214/451 (47.45%), Query Frame = 1
Query:  844 KLKDSYALKHTYLDQCSDTQIPNIDSCLRIGGPFGNDMIIRFQSPLTRNEWFNYVNDEINSYQETIKNSTTTITI---FNDTVPSSSAPLVXXXXXXXXXXXXXXLKKMAMNTFEIKDIDVKDLSIVFLLKNKENVLHDDVSLMVLQEHAN-NVQENSCVKSCIYCD---KGTAAVKIIYYLRCNRPLNESMNKGLAQTXXXXXXXXXQNKYNMNVRWIDSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSI--EDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMK-INKLFECILHLTSKLVNPVTYSNIVKSYVQRKSSVGSVENHSKSNGVGCIDQESNSPTTSRTVSDSNE 2166
            KL     +KH  + + +D  IP IDSC  I  P G ++++ F+SP   +E+ +  ++ +  Y     N    + +    ND +  S+      ++++SG T G  LK      F   DI +    +   +  +   + DD +++ + EHA  +  +  C   C Y       T  ++I +Y       N ++     Q             Y++  +W   EMP+WL  LL+D++ +G + +G+FR++       ++   + + DD  I   I NKA I K F+  IEGSL+T  T++    L  +   I  E+F      Q+K +KL Q +P  +  LFQ+ILV+L+ II  S   ++    I+   + ++F  +       I+ L E  ++LT K+V P     I+ SY++ K+   +++N S+++    ++ +S +  +S T SDS +
Sbjct:   65 KLILDLCMKHALISRATDVAIPKIDSCRLISDPSGYEVLLNFKSPSIASEYESKFSESMRMYNTKFANICFDVNVTNLVNDKLKESA------NVSLSGLTLGKDLKSWIEQEFIFPDIHMPCYILQLHVGEELLTIRDDATILQVHEHAAYSHAKGHCFIGCFYESVKPNSTLLIEINFY-------NHTIEYENGQIP-----------YSIEEKWGVGEMPKWLTRLLSDIYCDGPDSKGVFRLNAKDSSFSKWYKHMLDCDDFIISEDIFNKAAIFKFFLRNIEGSLMTKNTRKQLNGLCKKFMEISFEEFFKNSKKQSKFIKLFQSLPKTHYFLFQNILVVLNAIID-SPNAKVEPFAIARAIAPSIFPLVRLSYWGNISNLLEAAIYLTDKIVKPADKKRIIDSYIKVKNESNNIKNESRNDSQTFVENDSMT-LSSITESDSKQ 489          
BLAST of RhoGAP-domain-containing protein vs. Planmine SMEST
Match: SMESG000074055.1 (SMESG000074055.1)

HSP 1 Score: 120.939 bits (302), Expect = 1.336e-27
Identity = 118/451 (26.16%), Postives = 214/451 (47.45%), Query Frame = 1
Query:  844 KLKDSYALKHTYLDQCSDTQIPNIDSCLRIGGPFGNDMIIRFQSPLTRNEWFNYVNDEINSYQETIKNSTTTITI---FNDTVPSSSAPLVXXXXXXXXXXXXXXLKKMAMNTFEIKDIDVKDLSIVFLLKNKENVLHDDVSLMVLQEHAN-NVQENSCVKSCIYCD---KGTAAVKIIYYLRCNRPLNESMNKGLAQTXXXXXXXXXQNKYNMNVRWIDSEMPQWLMNLLADLFNEGVECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIEGSLLTSITKEVFYNLSNEINSI--EDFLSQEDXXXXXXXXXXXXPANNLNLFQHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMK-INKLFECILHLTSKLVNPVTYSNIVKSYVQRKSSVGSVENHSKSNGVGCIDQESNSPTTSRTVSDSNE 2166
            KL     +KH  + + +D  IP IDSC  I  P G ++++ F+SP   +E+ +  ++ +  Y     N    + +    ND +  S+      ++++SG T G  LK      F   DI +    +   +  +   + DD +++ + EHA  +  +  C   C Y       T  ++I +Y       N ++     Q             Y++  +W   EMP+WL  LL+D++ +G + +G+FR++       ++   + + DD  I   I NKA I K F+  IEGSL+T  T++    L  +   I  E+F      Q+K +KL Q +P  +  LFQ+ILV+L+ II  S   ++    I+   + ++F  +       I+ L E  ++LT K+V P     I+ SY++ K+   +++N S+++    ++ +S +  +S T SDS +
Sbjct:   50 KLILDLCMKHALISRATDVAIPKIDSCRLISDPSGYEVLLNFKSPSIASEYESKFSESMRMYNTKFANICFDVNVTNLVNDKLKESA------NVSLSGLTLGKDLKSWIEQEFIFPDIHMPCYILQLHVGEELLTIRDDATILQVHEHAAYSHAKGHCFIGCFYESVKPNSTLLIEINFY-------NHTIEYENGQI-----------PYSIEEKWGVGEMPKWLTRLLSDIYCDGPDSKGVFRLNAKDSSFSKWYKHMLDCDDFIISEDIFNKAAIFKFFLRNIEGSLMTKNTRKQLNGLCKKFMEISFEEFFKNSKKQSKFIKLFQSLPKTHYFLFQNILVVLNAIID-SPNAKVEPFAIARAIAPSIFPLVRLSYWGNISNLLEAAIYLTDKIVKPADKKRIIDSYIKVKNESNNIKNESRNDSQTFVENDSMT-LSSITESDSKQ 474          
The following BLAST results are available for this feature:
BLAST of RhoGAP-domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TAGAP2.326e-625.33T cell activation RhoGTPase activating protein [So... [more]
ARHGAP242.841e-622.84Rho GTPase activating protein 24 [Source:HGNC Symb... [more]
ARHGAP223.381e-623.56Rho GTPase activating protein 22 [Source:HGNC Symb... [more]
ARHGAP223.540e-623.56Rho GTPase activating protein 22 [Source:HGNC Symb... [more]
ARHGAP243.718e-622.98Rho GTPase activating protein 24 [Source:HGNC Symb... [more]
back to top
BLAST of RhoGAP-domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gei-17.666e-825.16GEX Interacting protein [Source:UniProtKB/TrEMBL;... [more]
gei-17.666e-825.16GEX Interacting protein [Source:UniProtKB/TrEMBL;... [more]
gei-18.533e-825.16GEX Interacting protein [Source:UniProtKB/TrEMBL;... [more]
gei-11.130e-725.16GEX Interacting protein [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of RhoGAP-domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
conu1.653e-626.25gene:FBgn0039994 transcript:FBtr0345008[more]
conu1.653e-626.25gene:FBgn0039994 transcript:FBtr0111288[more]
conu1.653e-626.25gene:FBgn0039994 transcript:FBtr0111285[more]
conu1.653e-626.25gene:FBgn0039994 transcript:FBtr0111287[more]
conu1.653e-626.25gene:FBgn0039994 transcript:FBtr0302385[more]
back to top
BLAST of RhoGAP-domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tagapa2.059e-827.17T cell activation RhoGTPase activating protein a [... [more]
tagapa2.059e-827.17T cell activation RhoGTPase activating protein a [... [more]
tagapa2.094e-827.17T cell activation RhoGTPase activating protein a [... [more]
ARHGAP222.863e-825.15si:dkey-191m6.4 [Source:ZFIN;Acc:ZDB-GENE-121214-1... [more]
arhgap11a4.117e-723.46Rho GTPase activating protein 11A [Source:ZFIN;Acc... [more]
back to top
BLAST of RhoGAP-domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
trhd6.357e-728.00tumorhead [Source:Xenbase;Acc:XB-GENE-1214876][more]
ARHGAP242.028e-626.53Rho GTPase activating protein 24 [Source:NCBI gene... [more]
FAM13A5.625e-623.75family with sequence similarity 13 member A [Sourc... [more]
back to top
BLAST of RhoGAP-domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm15279.323e-726.14predicted gene 1527 [Source:MGI Symbol;Acc:MGI:268... [more]
Arhgap229.577e-723.50Rho GTPase activating protein 22 [Source:MGI Symbo... [more]
1700006A11Rik1.449e-625.48RIKEN cDNA 1700006A11 gene [Source:MGI Symbol;Acc:... [more]
Arhgap243.737e-622.84Rho GTPase activating protein 24 [Source:MGI Symbo... [more]
Arhgap246.551e-622.98Rho GTPase activating protein 24 [Source:MGI Symbo... [more]
back to top
BLAST of RhoGAP-domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8BL80|RHG22_MOUSE6.699e-623.50Rho GTPase-activating protein 22 OS=Mus musculus O... [more]
back to top
BLAST of RhoGAP-domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2I0LRJ43.044e-727.04Rho GTPase-activating protein 20-like OS=Columba l... [more]
A0A1V4KZE48.661e-726.42Rho-GAP domain-containing protein OS=Patagioenas f... [more]
A0A1V4KY749.036e-726.42Rho GTPase-activating protein 20-like OS=Patagioen... [more]
A0A093R3061.418e-626.42Rho GTPase-activating protein 20 (Fragment) OS=Pha... [more]
A0A2P4T5M91.487e-630.07Uncharacterized protein (Fragment) OS=Bambusicola ... [more]
back to top
BLAST of RhoGAP-domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:dkey-191m6.48.006e-823.42rho GTPase-activating protein 22 [Source:NCBI gene... [more]
ENSAMXT00000053633.11.653e-728.85rho GTPase-activating protein 20-like [Source:NCBI... [more]
arhgap255.135e-626.25Rho GTPase activating protein 25 [Source:ZFIN;Acc:... [more]
back to top
BLAST of RhoGAP-domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-247j9.11.912e-724.51si:ch211-247j9.1 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
ralbp15.719e-728.81ralA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
arhgap181.439e-629.94Rho GTPase activating protein 18 [Source:ZFIN;Acc:... [more]
back to top
BLAST of RhoGAP-domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RhoGAP-domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RhoGAP-domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-191m6.41.934e-624.31Rho GTPase activating protein 22 [Source:NCBI gene... [more]
si:dkey-191m6.42.007e-624.31Rho GTPase activating protein 22 [Source:NCBI gene... [more]
si:dkey-191m6.42.020e-624.31Rho GTPase activating protein 22 [Source:NCBI gene... [more]
ENSORLT00000045475.19.695e-625.63Rho GTPase activating protein 40 [Source:NCBI gene... [more]
ENSORLT00000007062.29.722e-625.63Rho GTPase activating protein 40 [Source:NCBI gene... [more]
back to top
BLAST of RhoGAP-domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074052.10.000e+099.33SMESG000074052.1[more]
SMESG000074052.10.000e+099.40SMESG000074052.1[more]
SMESG000074055.19.017e-2826.16SMESG000074055.1[more]
SMESG000074055.11.108e-2726.16SMESG000074055.1[more]
SMESG000074055.11.336e-2726.16SMESG000074055.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031131 ID=SMED30031131|Name=RhoGAP-domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3337bp
GAAAATTTCGCTATTAAATTTATTATATTTTGAATTATGTTTAGTGATGC
ACGTTTAATATCTCCTAAACTGGTGAGGAAAAGATCTAGTAGTTTAAATA
CCGAAGCAGCAAATAGATATCGTGATAATAATATTGCTCAAAATAAATTT
CAAAGCAAGCAAATGAAGAAATATGCAAGTAGTGGAAATTTATCAAATTC
TGATACTGGAAGTACTAATAAACTAAAAAATAAAACGAATTATGACGGCT
ATTTTCTTTTCGTCAATTGGTATAAGGATTTTAAAAGCATCAAATCGTCT
TTATTAAGTATTCAAGATCAAAATATATTCAAGAATGAATTTCCTCGTCA
AACTGACATTAATATGAAAAATTATTCATCAACAACATTTTTAATAATTA
ATAGCCAGAAAATCGATAATGAATATGAGACTTTTTTTATCAATGACTAT
CTCACAAGATTGGAAGAATTAATGAATTGGGCTGAAAAGGAAAATAAGGA
GTTTTACGATGAAATTTTTAAAGCAATAGAATTGATAACAAAACAGATGG
GCAATGAGGATGAACATCAATTTCTCCAGACTGGTGACAATCATCAGGAA
TTATTGGAAGGACAACTTAAAGATCGAAGAAGCTCTGAAGCACTCATTAT
ACAAAATAAAAACCAACCAATACCTTCATTTCTACCTCGAGAATATCAAG
GCCAAATGAATATTTTACGATGTGCTTGTGAATTTGAGATATATTATTTG
AGTCAAGATAAAAAAAATGAAAGAAATTACAAAAGTGTTCCAAGAATCGG
CGTGCTTTCCAATCAAGATATCAATATTTTCACCAAGAGTTTCAAATTAA
AAGACAGTTATGCTTTAAAACACACGTATCTGGATCAGTGCTCCGATACG
CAGATCCCTAACATAGATTCTTGTTTAAGAATAGGAGGACCTTTTGGAAA
TGACATGATCATTCGATTTCAGTCCCCCCTCACTCGCAATGAATGGTTCA
ATTACGTAAACGATGAGATAAATTCTTATCAAGAAACTATAAAAAATTCT
ACAACAACTATTACAATTTTCAATGATACAGTCCCATCGTCTTCAGCGCC
ACTTGTCTCCAGATCTATTACAATCAGCGGAAATACATCTGGATCAAGTT
TAAAGAAAATGGCTATGAATACTTTTGAAATAAAAGATATTGACGTTAAA
GACCTATCAATTGTGTTCTTATTGAAAAACAAAGAAAATGTTCTTCATGA
TGATGTCTCACTAATGGTTTTACAAGAGCATGCCAACAATGTTCAAGAAA
ACAGTTGCGTTAAATCATGCATTTATTGTGACAAAGGGACTGCTGCAGTT
AAAATAATTTATTATTTGAGATGCAATAGACCTTTGAATGAGAGCATGAA
TAAAGGTCTCGCTCAAACTAAGAAGCCGGTTCCAGTGAAGCCTAAGCAAA
ATAAATACAACATGAATGTTAGATGGATAGACAGTGAAATGCCGCAATGG
CTTATGAATCTTCTAGCTGATTTGTTTAATGAGGGAGTAGAATGCGAAGG
AATATTTAGGATGTCCGGCTCGGTATTCCAATCGGATGAATATGTTTATC
AGATTTCCGAAACAGATGATTTGAAAATAGATACGACTATCCATAACAAG
GCAAATATTTTAAAAAAATTCATCAGCATTATTGAAGGGTCACTTTTGAC
TTCAATAACCAAAGAAGTTTTTTATAATTTATCCAATGAAATAAATTCTA
TCGAAGATTTTCTATCGCAAGAAGATTTACAAACAAAATTGCTTAAACTT
ATTCAAAAGATTCCAGCTAACAATTTGAATCTGTTTCAACACATTCTTGT
CATTCTCGATACTATAATACAGAAATCACAAATAAATCAAATGAATATCC
AGAATATTTCAACGTGTTTTTCACAAAATTTATTTAAACACCTTTCAGAT
GATGCAATGAAAATAAATAAATTGTTTGAATGCATTCTCCATTTAACGAG
TAAACTTGTCAATCCAGTTACATACAGCAATATCGTCAAATCCTATGTAC
AAAGGAAGTCATCAGTTGGATCAGTTGAAAATCACTCGAAATCAAACGGC
GTAGGGTGCATTGACCAAGAATCCAATTCACCAACAACTTCAAGAACTGT
GTCAGATTCTAATGAAGATAAAAAGCCACTCATAGATCAACCTCGAGTTC
CTCCTAGGCGGAAAAACATAAATCTTCATAATCGTGCAGCATTCAATACC
CCAGATGAAAGTCCTGACACTTTGAAGAGAAATTCTCTTACAAAGAAAAT
AAGTCTTAATGACAAACAGCAGTCTCTTTCAGATGAATTACCGACAGATG
GAAATAATAACCCTCTTGATGAAGTCGATTCTAAATTGACTGCCCGAAGC
CCAATAGATCCAATATTACCAGTAAAATCTAATTCAAATCTAAATCAAAA
ACCTAGAAGACTATCAAGAAGCTCCAATACTTTCAATGCTTCTTCTCCAG
AAAATGTAAGATTAAATGAATCCAGTAATTTTTATCGTCAAAACCAAATT
AACCGTAAGCACAACAAAACTAATCCAATTACTGACATATCAAATTCAAA
CACTAACAATGCCAAACAAAATGTGAATCAATTAAAAACCGGTGCTAAAT
TAACACGAAGCACTGATAGAGTTATCACCAAAGCCCGCTCTAGATCTCAA
AGCAAAGTAGGAGAAAATGTGCCAAGTAATACTCCTCGTTCAAACAAAAC
TACATACCATTTCAATGCCAATTCATCACATGATACAGATTTTCAGAGGA
AACCAATAGTAGAGAGACAAAGAAGTAGTTCCGCTTGTCGAGTTCCAAAG
CTTACAAGACAATATGAATCTAATTTATCAACTTCAAAACCACCTCTTCC
AAACAAGAAAAATTCTATCATTTCAGAAGCCCCAAAAGTATCTAAACTGG
TTAGAGATCTTGAATTCAAAACAACTCGACCAAACGAACGACCAGCCTCT
AATGTTTATCTCAAACCTCAGGGCCCAATTAGGCCGAATCATACTATTCA
TATAAATAATGCTCAAGAACTCCAAGTTGAAAAGTCAAGCCTCTCACATC
CAACGAATAGGTTCTCATTGCATGAAAAGTTAAATGATAGCAATGATGAG
GATGTCACTTACATTTAATATCAAAGATATTATTTTTTAATTTTTTTGCT
AGTTGAAAATATTATTTTTTGTAAAAGAAAAAATTTTGTCAATTATTATT
ATGCAGATTGTATTTGTATGTAATTATGTAGAAATTTTTTATTGTTTGTT
GAATGGTAACATATCGTTTAACTTTGAAATAGATCGC
back to top

protein sequence of SMED30031131-orf-1

>SMED30031131-orf-1 ID=SMED30031131-orf-1|Name=SMED30031131-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1044bp
MFSDARLISPKLVRKRSSSLNTEAANRYRDNNIAQNKFQSKQMKKYASSG
NLSNSDTGSTNKLKNKTNYDGYFLFVNWYKDFKSIKSSLLSIQDQNIFKN
EFPRQTDINMKNYSSTTFLIINSQKIDNEYETFFINDYLTRLEELMNWAE
KENKEFYDEIFKAIELITKQMGNEDEHQFLQTGDNHQELLEGQLKDRRSS
EALIIQNKNQPIPSFLPREYQGQMNILRCACEFEIYYLSQDKKNERNYKS
VPRIGVLSNQDINIFTKSFKLKDSYALKHTYLDQCSDTQIPNIDSCLRIG
GPFGNDMIIRFQSPLTRNEWFNYVNDEINSYQETIKNSTTTITIFNDTVP
SSSAPLVSRSITISGNTSGSSLKKMAMNTFEIKDIDVKDLSIVFLLKNKE
NVLHDDVSLMVLQEHANNVQENSCVKSCIYCDKGTAAVKIIYYLRCNRPL
NESMNKGLAQTKKPVPVKPKQNKYNMNVRWIDSEMPQWLMNLLADLFNEG
VECEGIFRMSGSVFQSDEYVYQISETDDLKIDTTIHNKANILKKFISIIE
GSLLTSITKEVFYNLSNEINSIEDFLSQEDLQTKLLKLIQKIPANNLNLF
QHILVILDTIIQKSQINQMNIQNISTCFSQNLFKHLSDDAMKINKLFECI
LHLTSKLVNPVTYSNIVKSYVQRKSSVGSVENHSKSNGVGCIDQESNSPT
TSRTVSDSNEDKKPLIDQPRVPPRRKNINLHNRAAFNTPDESPDTLKRNS
LTKKISLNDKQQSLSDELPTDGNNNPLDEVDSKLTARSPIDPILPVKSNS
NLNQKPRRLSRSSNTFNASSPENVRLNESSNFYRQNQINRKHNKTNPITD
ISNSNTNNAKQNVNQLKTGAKLTRSTDRVITKARSRSQSKVGENVPSNTP
RSNKTTYHFNANSSHDTDFQRKPIVERQRSSSACRVPKLTRQYESNLSTS
KPPLPNKKNSIISEAPKVSKLVRDLEFKTTRPNERPASNVYLKPQGPIRP
NHTIHINNAQELQVEKSSLSHPTNRFSLHEKLNDSNDEDVTYI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
GO:0035091phosphatidylinositol binding
Vocabulary: biological process
TermDefinition
GO:0043547positive regulation of GTPase activity
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000198RhoGAP_dom
IPR008936Rho_GTPase_activation_prot
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 138..158
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 705..719
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 30..59
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 884..902
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 793..822
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 676..704
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 873..902
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 676..822
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 730..780
NoneNo IPR availablePANTHERPTHR23179T-CELL ACTIVATION RHO GTPASE ACTIVATING PROTEIN-RELATEDcoord: 249..949
NoneNo IPR availableCDDcd00159RhoGAPcoord: 495..653
e-value: 1.3397E-22
score: 93.5204
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 482..657
e-value: 5.2E-7
score: 39.3
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 485..636
e-value: 2.8E-20
score: 72.7
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 475..657
score: 21.882
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 470..657
e-value: 8.9E-24
score: 85.8
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 480..649