Ribosomal protein S6 kinase

Overview
NameRibosomal protein S6 kinase
Smed IDSMED30031106
Length (bp)1617
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribosomal protein S6 kinase (SMED30031106) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribosomal protein S6 kinase (SMED30031106) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribosomal protein S6 kinase (SMED30031106) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribosomal protein S6 kinase (SMED30031106) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031106

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30031106h1SMcG0011130 Contig55119uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031106h1SMcG0011130 Contig55119newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30031106h1SMcG0011130 dd_Smed_v4_1228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031106h1SMcG0011130 dd_Smed_v4_1228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031106h1SMcG0011130 dd_Smed_v4_1228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031106h1SMcG0011130 dd_Smed_v4_1228_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031106h1SMcG0011130 Contig42913newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031106h1SMcG0011130 Contig42913uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribosomal protein S6 kinase vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 350.517 bits (898), Expect = 2.084e-115
Identity = 191/357 (53.50%), Postives = 243/357 (68.07%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  E++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   73 EISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSF 428          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 351.288 bits (900), Expect = 2.498e-115
Identity = 191/357 (53.50%), Postives = 243/357 (68.07%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  E++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   20 EISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSF 375          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 350.903 bits (899), Expect = 1.444e-114
Identity = 191/357 (53.50%), Postives = 243/357 (68.07%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  E++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   73 EISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSF 428          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Human
Match: RPS6KB2 (ribosomal protein S6 kinase B2 [Source:HGNC Symbol;Acc:HGNC:10437])

HSP 1 Score: 337.806 bits (865), Expect = 5.939e-110
Identity = 182/358 (50.84%), Postives = 240/358 (67.04%), Query Frame = 1
Query:  202 VDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            V++ E +VN    ++  H F+LL+ LGKGGYG+VF  +KV G   G+ +AMKV++KA+++ N K DT +   ERNILE+V HPF+V+L +AFQT   L+L+LE L+GGELF  LER+    ED A FYLAE TLALGHLHS G+IYRDLK EN+ML   GH+KLTDFGL KE  ++  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G+ PF   NR + + K+   KL +P +LT   + L+K  L +NP  R+GGG  D  +++RH FFR +NWD  LA  + PPF P L S +DVS FD     +  + SP  T   +S    F  F+YV+P V   + E  SF
Sbjct:   48 VELTETSVNVGPERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAK-DTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSF 404          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Human
Match: RPS6KB1 (ribosomal protein S6 kinase B1 [Source:HGNC Symbol;Acc:HGNC:10436])

HSP 1 Score: 316.235 bits (809), Expect = 2.235e-101
Identity = 163/303 (53.80%), Postives = 206/303 (67.99%), Query Frame = 1
Query:  367 KARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            KA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  E++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:  104 KAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSF 405          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Celegans
Match: rsks-1 (Ribosomal protein S6 kinase beta [Source:UniProtKB/Swiss-Prot;Acc:Q9NAH6])

HSP 1 Score: 340.117 bits (871), Expect = 1.774e-110
Identity = 178/365 (48.77%), Postives = 242/365 (66.30%), Query Frame = 1
Query:  184 DSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNI-----VSEPCMISPTTTDDSNCYWFENFSYVSPQVYLELSENG 1260
            D   +S+ +C   +NPP V+V   DF LLK LGKGGYG+VF  +K  G+  G+ FAMKV++KA ++ N+K DT +   ERNILEAV  PF+  L +AFQT   L+L+LEYL+GGELFM LER+    E+ A+FYL+E  ++L HLH  G+IYRDLK EN++LD YGHVKLTDFGL KE    D+ TH+FCGT+EYMAPEIL R GHG +VDWWS+G L++DML G  PF   NR + I K+   +L +P +L++  + L+K LL ++   RLG G  D EEIK H FF++ +W+   AR+L+ PF P + + +D SLFD        V  PC  + +   D+    F  F+YV+P V   +++ G
Sbjct:   58 DPMMESIQLCASAINPPNVRVGPEDFQLLKVLGKGGYGKVFQVRKTTGSDNGQIFAMKVLQKATIVRNQK-DTAHTKAERNILEAVKSPFICDLLYAFQTGGKLYLILEYLSGGELFMHLEREGMFMENVAKFYLSEIVVSLEHLHQQGIIYRDLKPENILLDAYGHVKLTDFGLCKEEIEGDQKTHTFCGTIEYMAPEILMRCGHGKAVDWWSLGALMFDMLTGGPPFTAENRRKTIDKILKGRLTLPAYLSNEARDLIKKLLKRHVDTRLGAGLSDAEEIKSHAFFKTTDWNLVYARQLEAPFKPNIENDEDTSLFDARFTKMTPVDSPCETNFSLNGDNP---FVGFTYVAPSVLEMMNKGG 418          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 311.997 bits (798), Expect = 1.415e-97
Identity = 173/361 (47.92%), Postives = 241/361 (66.76%), Query Frame = 1
Query:  172 KDEYDSTSKS-VDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDE-LTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY-WFENFSYVSPQVYLE 1245
            +++ DS+S++ +DI +  V   G K     F+LLK LG+G +G+VFL +KV G  +G  +AMKV+KKA L    +  TK    ERNIL  ++HPF+VKL++AFQT   L+L+L++L GG+LF +L ++   TED+ +FYLAE TLAL HLHS+G++YRDLK EN++LD  GH+K+TDFGLSKE  D E  T+SFCGTVEYMAPE++ RRGH  + D+WS+G+L+++ML G+ PF G +R+  + ++  AKL +P FLT   + LL+ L  +N + RLG G   VEEIKRH FF  I++ K L +E+ PPF P LS+ D  S FD          SP     +N +  F  FS+VS  V  E
Sbjct:   19 EEKTDSSSETEIDIGD--VRKCGEKADPRQFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDRQRTKL---ERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPEVINRRGHSMAADFWSLGVLMFEMLTGHLPFQGRDRNDTMTQILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAKIDFVKLLNKEIDPPFKPALSTVDSTSYFDPEFTKRTPKDSPALPASANGHEIFRGFSFVSNAVMEE 374          

HSP 2 Score: 105.145 bits (261), Expect = 1.739e-23
Identity = 61/202 (30.20%), Postives = 115/202 (56.93%), Query Frame = 1
Query:  346 FAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTL-TEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRY----GHVKLTDFGLSKE-RNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGG---NRSQVIQKVTNAKLKI 924
            +A+K+VKKA     ++ D         +L   +H F+VKL+  ++   +++++ E   GGEL  +L  + +L +E E    +A    A+ +LHS  V +RDL + N++          +++ DFG +K+ R ++ +  + C T +++APE+L+++G+  S D WS+G+LL+ ML G +PF  G      Q++Q+V + K+ +
Sbjct:  423 YAVKIVKKAVFDATEEVDI--------LLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFAMGPNDTPDQILQRVGDGKISM 616          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 310.842 bits (795), Expect = 3.743e-97
Identity = 177/376 (47.07%), Postives = 246/376 (65.43%), Query Frame = 1
Query:  127 INGIELEANDSDNLNKDEYDSTSKS-VDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDE-LTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY-WFENFSYVSPQVYLE 1245
            I+ I+   N+   L   + DS+S++ +DI +  V   G K     F+LLK LG+G +G+VFL +KV G  +G  +AMKV+KKA L    +  TK    ERNIL  ++HPF+VKL++AFQT   L+L+L++L GG+LF +L ++   TED+ +FYLAE TLAL HLHS+G++YRDLK EN++LD  GH+K+TDFGLSKE  D E  T+SFCGTVEYMAPE++ RRGH  + D+WS+G+L+++ML G+ PF G +R+  + ++  AKL +P FLT   + LL+ L  +N + RLG G   VEEIKRH FF  I++ K L +E+ PPF P LS+ D  S FD          SP     +N +  F  FS+VS  V  E
Sbjct:   42 IHIIQPPPNNGFRLMNWKTDSSSETEIDIGD--VRKCGEKADPRQFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDRQRTKL---ERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPEVINRRGHSMAADFWSLGVLMFEMLTGHLPFQGRDRNDTMTQILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAKIDFVKLLNKEIDPPFKPALSTVDSTSYFDPEFTKRTPKDSPALPASANGHEIFRGFSFVSNAVMEE 412          

HSP 2 Score: 104.76 bits (260), Expect = 2.401e-23
Identity = 61/202 (30.20%), Postives = 115/202 (56.93%), Query Frame = 1
Query:  346 FAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTL-TEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRY----GHVKLTDFGLSKE-RNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGG---NRSQVIQKVTNAKLKI 924
            +A+K+VKKA     ++ D         +L   +H F+VKL+  ++   +++++ E   GGEL  +L  + +L +E E    +A    A+ +LHS  V +RDL + N++          +++ DFG +K+ R ++ +  + C T +++APE+L+++G+  S D WS+G+LL+ ML G +PF  G      Q++Q+V + K+ +
Sbjct:  461 YAVKIVKKAVFDATEEVDI--------LLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFAMGPNDTPDQILQRVGDGKISM 654          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 310.842 bits (795), Expect = 5.161e-97
Identity = 173/357 (48.46%), Postives = 238/357 (66.67%), Query Frame = 1
Query:  184 DSTSKS-VDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDE-LTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY-WFENFSYVSPQVYLE 1245
            DS+S++ +DI +  V   G K     F+LLK LG+G +G+VFL +KV G  +G  +AMKV+KKA L    +  TK    ERNIL  ++HPF+VKL++AFQT   L+L+L++L GG+LF +L ++   TED+ +FYLAE TLAL HLHS+G++YRDLK EN++LD  GH+K+TDFGLSKE  D E  T+SFCGTVEYMAPE++ RRGH  + D+WS+G+L+++ML G+ PF G +R+  + ++  AKL +P FLT   + LL+ L  +N + RLG G   VEEIKRH FF  I++ K L +E+ PPF P LS+ D  S FD          SP     +N +  F  FS+VS  V  E
Sbjct:   41 DSSSETEIDIGD--VRKCGEKADPRQFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDRQRTKL---ERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPEVINRRGHSMAADFWSLGVLMFEMLTGHLPFQGRDRNDTMTQILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAKIDFVKLLNKEIDPPFKPALSTVDSTSYFDPEFTKRTPKDSPALPASANGHEIFRGFSFVSNAVMEE 392          

HSP 2 Score: 104.76 bits (260), Expect = 1.917e-23
Identity = 61/202 (30.20%), Postives = 115/202 (56.93%), Query Frame = 1
Query:  346 FAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTL-TEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRY----GHVKLTDFGLSKE-RNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGG---NRSQVIQKVTNAKLKI 924
            +A+K+VKKA     ++ D         +L   +H F+VKL+  ++   +++++ E   GGEL  +L  + +L +E E    +A    A+ +LHS  V +RDL + N++          +++ DFG +K+ R ++ +  + C T +++APE+L+++G+  S D WS+G+LL+ ML G +PF  G      Q++Q+V + K+ +
Sbjct:  441 YAVKIVKKAVFDATEEVDI--------LLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFAMGPNDTPDQILQRVGDGKISM 634          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Celegans
Match: rskn-1 (Putative ribosomal protein S6 kinase alpha-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21734])

HSP 1 Score: 311.612 bits (797), Expect = 6.293e-97
Identity = 177/376 (47.07%), Postives = 246/376 (65.43%), Query Frame = 1
Query:  127 INGIELEANDSDNLNKDEYDSTSKS-VDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDE-LTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY-WFENFSYVSPQVYLE 1245
            I+ I+   N+   L   + DS+S++ +DI +  V   G K     F+LLK LG+G +G+VFL +KV G  +G  +AMKV+KKA L    +  TK    ERNIL  ++HPF+VKL++AFQT   L+L+L++L GG+LF +L ++   TED+ +FYLAE TLAL HLHS+G++YRDLK EN++LD  GH+K+TDFGLSKE  D E  T+SFCGTVEYMAPE++ RRGH  + D+WS+G+L+++ML G+ PF G +R+  + ++  AKL +P FLT   + LL+ L  +N + RLG G   VEEIKRH FF  I++ K L +E+ PPF P LS+ D  S FD          SP     +N +  F  FS+VS  V  E
Sbjct:   61 IHIIQPPPNNGFRLMNWKTDSSSETEIDIGD--VRKCGEKADPRQFELLKVLGQGSFGKVFLVRKVRGRDSGHVYAMKVLKKATLKVRDRQRTKL---ERNILAHISHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEDDVKFYLAELTLALEHLHSLGIVYRDLKPENILLDADGHIKVTDFGLSKEAIDSEKKTYSFCGTVEYMAPEVINRRGHSMAADFWSLGVLMFEMLTGHLPFQGRDRNDTMTQILKAKLSMPHFLTQEAQSLLRALFKRNSQNRLGAGPDGVEEIKRHAFFAKIDFVKLLNKEIDPPFKPALSTVDSTSYFDPEFTKRTPKDSPALPASANGHEIFRGFSFVSNAVMEE 431          

HSP 2 Score: 105.145 bits (261), Expect = 1.656e-23
Identity = 61/202 (30.20%), Postives = 115/202 (56.93%), Query Frame = 1
Query:  346 FAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTL-TEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRY----GHVKLTDFGLSKE-RNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGG---NRSQVIQKVTNAKLKI 924
            +A+K+VKKA     ++ D         +L   +H F+VKL+  ++   +++++ E   GGEL  +L  + +L +E E    +A    A+ +LHS  V +RDL + N++          +++ DFG +K+ R ++ +  + C T +++APE+L+++G+  S D WS+G+LL+ ML G +PF  G      Q++Q+V + K+ +
Sbjct:  480 YAVKIVKKAVFDATEEVDI--------LLRHSHHQFVVKLFDVYEDETAIYMIEELCEGGELLDKLVNKKSLGSEKEVAAIMANLLNAVQYLHSQQVAHRDLTAANILFALKDGDPSSLRIVDFGFAKQSRAENGMLMTPCYTAQFVAPEVLRKQGYDRSCDVWSLGVLLHTMLTGCTPFAMGPNDTPDQILQRVGDGKISM 673          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Fly
Match: S6k (gene:FBgn0283472 transcript:FBtr0077114)

HSP 1 Score: 363.229 bits (931), Expect = 4.033e-120
Identity = 188/373 (50.40%), Postives = 253/373 (67.83%), Query Frame = 1
Query:  127 INGIELEANDSDNLNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQV 1236
            ++ ++LE     NL++D      +++ +CEE VNP  +K+   DF+L K LGKGGYG+VF  +K  G  A +YFAMKV+KKA ++TN+K DT +   ERNILEAV HPF+V+L +AFQT+  L+L+LEYL+GGELFM LER+    ED   FYL+E  LALGHLH +G+IYRDLK EN++LD  GHVKLTDFGL KE   +  +TH+FCGT+EYMAPEIL R GHG +VDWWS+G L++DML G  PF   NR + I+ +  AKL +P +LT   + L++ L+ +    RLG G +D   ++ H FF+ +NWD  LAR L+PP  P L S DDVS FD     +  + SP  TT  +S    F+ F+YV+P +
Sbjct:   35 LDDVDLEPELCINLHQDT--EGQETIQLCEENVNPGKIKLGPKDFELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQK-DTAHTRAERNILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESANLIFQGFTYVAPSI 404          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Fly
Match: S6k (gene:FBgn0283472 transcript:FBtr0333264)

HSP 1 Score: 363.229 bits (931), Expect = 4.033e-120
Identity = 188/373 (50.40%), Postives = 253/373 (67.83%), Query Frame = 1
Query:  127 INGIELEANDSDNLNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQV 1236
            ++ ++LE     NL++D      +++ +CEE VNP  +K+   DF+L K LGKGGYG+VF  +K  G  A +YFAMKV+KKA ++TN+K DT +   ERNILEAV HPF+V+L +AFQT+  L+L+LEYL+GGELFM LER+    ED   FYL+E  LALGHLH +G+IYRDLK EN++LD  GHVKLTDFGL KE   +  +TH+FCGT+EYMAPEIL R GHG +VDWWS+G L++DML G  PF   NR + I+ +  AKL +P +LT   + L++ L+ +    RLG G +D   ++ H FF+ +NWD  LAR L+PP  P L S DDVS FD     +  + SP  TT  +S    F+ F+YV+P +
Sbjct:   35 LDDVDLEPELCINLHQDT--EGQETIQLCEENVNPGKIKLGPKDFELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQK-DTAHTRAERNILEAVKHPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMFDMLTGVPPFTAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFKHVNWDDVLARRLEPPIKPLLRSEDDVSQFDTRFTRQIPVDSPDDTTLSESANLIFQGFTYVAPSI 404          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Fly
Match: S6kII (gene:FBgn0262866 transcript:FBtr0333715)

HSP 1 Score: 287.73 bits (735), Expect = 6.848e-87
Identity = 150/325 (46.15%), Postives = 216/325 (66.46%), Query Frame = 1
Query:  292 YGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY-WFENFSYVSPQVYLELSENGS 1263
            +G+VFL +K+ G  AG  +AMKV+KKA L   K  D   +  ER IL  V H F+V+L++AFQT   L+L+L++L GG+LF +L ++   TE++ +FYLAE  LA+ HLH++G+IYRDLK EN++LD +GH+ LTDFGLSK+  D   T+SFCGTVEYMAPEI+ R+GH  + DWWS G+L+Y+ML GN PF G  R + + ++  +KL +P  L+   + LL+ L  +NP+ RLG G + + +IK H FF +I+W +   ++++PPFIP + SRDD   FD    S+    SP     ++ +  F  FS+V+P V LE    GS
Sbjct:  210 FGKVFLVRKIIGKDAGTLYAMKVLKKATL---KVKDRVRSTNERKILADVGHAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKPENILLDEHGHIALTDFGLSKQPLDGSKTYSFCGTVEYMAPEIVNRKGHDFAADWWSFGVLMYEMLTGNLPFHGQTRQETMNQILRSKLGMPENLSPEAQSLLRALFKRNPQNRLGAGAQGILDIKAHCFFATIDWVRLERKQVRPPFIPAV-SRDDAFYFDVEYTSKSPRDSPGGPISASAHEIFRGFSFVAP-VLLEGQCAGS 529          

HSP 2 Score: 109.383 bits (272), Expect = 1.241e-24
Identity = 66/183 (36.07%), Postives = 103/183 (56.28%), Query Frame = 1
Query:  340 EYFAMKVVKKARLITNKKNDTKYAMTERNI-LEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENV----MLDRYGHVKLTDFGLSKE-RNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFV 870
            +++A+KV++KA +     + +     E  I L   NHP +V LY  ++   S +LV+E L GGEL  ++     + E EA   L     A+ +LH  GV++RDLK  N+    M      +KL D G +K+ R D+ L  + C T  ++APE+L+R+G+  + D WS+G+LLY ML G +PF 
Sbjct:  592 KHYAVKVIEKAAVAAASTSTSADCWEEVEIMLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLRTIASAVAYLHEHGVVHRDLKPSNMIYASMRQTPETLKLCDLGFAKQLRADNGLLMTPCYTANFVAPEVLKRQGYDLACDIWSLGVLLYIMLSGRTPFA 774          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Fly
Match: S6kII (gene:FBgn0262866 transcript:FBtr0077360)

HSP 1 Score: 287.73 bits (735), Expect = 6.848e-87
Identity = 150/325 (46.15%), Postives = 216/325 (66.46%), Query Frame = 1
Query:  292 YGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY-WFENFSYVSPQVYLELSENGS 1263
            +G+VFL +K+ G  AG  +AMKV+KKA L   K  D   +  ER IL  V H F+V+L++AFQT   L+L+L++L GG+LF +L ++   TE++ +FYLAE  LA+ HLH++G+IYRDLK EN++LD +GH+ LTDFGLSK+  D   T+SFCGTVEYMAPEI+ R+GH  + DWWS G+L+Y+ML GN PF G  R + + ++  +KL +P  L+   + LL+ L  +NP+ RLG G + + +IK H FF +I+W +   ++++PPFIP + SRDD   FD    S+    SP     ++ +  F  FS+V+P V LE    GS
Sbjct:  210 FGKVFLVRKIIGKDAGTLYAMKVLKKATL---KVKDRVRSTNERKILADVGHAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHTLGIIYRDLKPENILLDEHGHIALTDFGLSKQPLDGSKTYSFCGTVEYMAPEIVNRKGHDFAADWWSFGVLMYEMLTGNLPFHGQTRQETMNQILRSKLGMPENLSPEAQSLLRALFKRNPQNRLGAGAQGILDIKAHCFFATIDWVRLERKQVRPPFIPAV-SRDDAFYFDVEYTSKSPRDSPGGPISASAHEIFRGFSFVAP-VLLEGQCAGS 529          

HSP 2 Score: 109.383 bits (272), Expect = 1.241e-24
Identity = 66/183 (36.07%), Postives = 103/183 (56.28%), Query Frame = 1
Query:  340 EYFAMKVVKKARLITNKKNDTKYAMTERNI-LEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENV----MLDRYGHVKLTDFGLSKE-RNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFV 870
            +++A+KV++KA +     + +     E  I L   NHP +V LY  ++   S +LV+E L GGEL  ++     + E EA   L     A+ +LH  GV++RDLK  N+    M      +KL D G +K+ R D+ L  + C T  ++APE+L+R+G+  + D WS+G+LLY ML G +PF 
Sbjct:  592 KHYAVKVIEKAAVAAASTSTSADCWEEVEIMLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLRTIASAVAYLHEHGVVHRDLKPSNMIYASMRQTPETLKLCDLGFAKQLRADNGLLMTPCYTANFVAPEVLKRQGYDLACDIWSLGVLLYIMLSGRTPFA 774          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Fly
Match: Akt1 (gene:FBgn0010379 transcript:FBtr0083226)

HSP 1 Score: 254.988 bits (650), Expect = 7.141e-78
Identity = 144/332 (43.37%), Postives = 210/332 (63.25%), Query Frame = 1
Query:  184 DSTSKSVDICEETVNPPGVK-VTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP 1173
            D  S+   +   T N  GVK VT  +F+ LK LGKG +G+V L ++   A   + +A+K++KK  +I  +K++  + +TE  +L++ NHPFL+ L ++FQTN  L  V++Y+ GGELF  L  +   TED  RFY AE   ALG+LHS G+IYRDLK EN++LD+ GH+K+ DFGL KE       T +FCGT EY+APE+L    +G +VDWW  G+++Y+M+ G  PF   +   +   +   ++K PR +TD  K+LL  LL K+PK RLGGG+ DV+EI+ H FF SINW   + +++ PPF P+++S  D   FDK    E   ++P
Sbjct:  159 DELSEQFSVQGTTCNSSGVKKVTLENFEFLKVLGKGTFGKVILCREKATA---KLYAIKILKKEVII--QKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTP 485          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Zebrafish
Match: rps6kb1b (ribosomal protein S6 kinase b, polypeptide 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2038])

HSP 1 Score: 354.369 bits (908), Expect = 1.953e-116
Identity = 190/360 (52.78%), Postives = 245/360 (68.06%), Query Frame = 1
Query:  196 KSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            + ++I E+ VN     +    F+LL+ LGKGGYG+VF  +KV+GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL ++  +RLG G  D  E++ H FFR +NWD  LAR+++PPF P L S +DVS FD    S+  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   44 EKIEISEDNVNQGTENIRPECFELLRVLGKGGYGKVFQVRKVSGAATGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFRHVNWDDLLARKVEPPFKPFLQSAEDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENIKEKFSF 402          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Zebrafish
Match: rps6kb1a (ribosomal protein S6 kinase b, polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-091113-52])

HSP 1 Score: 350.132 bits (897), Expect = 1.215e-114
Identity = 192/372 (51.61%), Postives = 248/372 (66.67%), Query Frame = 1
Query:  160 DNLNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            D  +  E+    +  +I E++VN    K+    F+LL+ LGKGGYG+VF  +KV GA +G+ FAMKV+KKA ++ N K DT +   ER+ILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE +LALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF   NR + I K+   KL +P +LT   + LLK LL +N   R+G   +DV +I+RH FFR INWD  LA ++ PPF P L S DDVS FD    S+  + SP  T   +S+   F  F+Y++P V   + E  +F
Sbjct:   32 DQCSGFEFMEDCEKFEISEDSVNQGTEKIRPECFELLRVLGKGGYGKVFQVRKVAGAASGKIFAMKVLKKAMIVRNAK-DTAHTKAERSILEEVKHPFIVDLIYAFQTGEKLYLILEYLSGGELFMQLEREGIFLEDTACFYLAEISLALGHLHQKGIIYRDLKPENIMLNYNGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILTRSGHNRAVDWWSLGALMYDMLTGAPPFTAENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNASVRIGASPRDVLDIQRHSFFRHINWDDLLAFKIDPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDTKLSESDNQVFLGFTYIAPSVLENIKEKFTF 402          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Zebrafish
Match: BX000486.1 (ribosomal protein S6 kinase b, polypeptide 1a [Source:NCBI gene;Acc:562242])

HSP 1 Score: 348.977 bits (894), Expect = 2.809e-114
Identity = 190/357 (53.22%), Postives = 243/357 (68.07%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E++VN    K+    F+LL+ LGKGGYG+VF  +KV GA +G+ FAMKV+KKA ++ N K DT +   ER+ILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE +LALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF   NR + I K+   KL +P +LT   + LLK LL +N   R+G   +DV +I+RH FFR INWD  LA ++ PPF P L S DDVS FD    S+  + SP  T   +S+   F  F+Y++P V   + E  +F
Sbjct:   48 EISEDSVNQGTEKIRPECFELLRVLGKGGYGKVFQVRKVAGAASGKIFAMKVLKKAMIVRNAK-DTAHTKAERSILEEVKHPFIVDLIYAFQTGEKLYLILEYLSGGELFMQLEREGIFLEDTACFYLAEISLALGHLHQKGIIYRDLKPENIMLNYNGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILTRSGHNRAVDWWSLGALMYDMLTGAPPFTAENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNASVRIGASPRDVLDIQRHSFFRHINWDDLLAFKIDPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDTKLSESDNQVFLGFTYIAPSVLENIKEKFTF 403          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Zebrafish
Match: rps6kb1b (ribosomal protein S6 kinase b, polypeptide 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2038])

HSP 1 Score: 315.849 bits (808), Expect = 3.770e-101
Identity = 181/382 (47.38%), Postives = 240/382 (62.83%), Query Frame = 1
Query:  196 KSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGEL-FMQLER----QHTLTED-----------------EARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            + ++I E+ VN     +    F+LL+ LGKGGYG+VF  +KV+GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+G  L F++++      H+                        FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL ++  +RLG G  D  E++ H FFR +NWD  LAR+++PPF P L S +DVS FD    S+  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   44 EKIEISEDNVNQGTENIRPECFELLRVLGKGGYGKVFQVRKVSGAATGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGLNLCFLEIDNFSFFPHSFCCCGVAKGLIQPLKCCSGLLTCSFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFRHVNWDDLLARKVEPPFKPFLQSAEDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENIKEKFSF 424          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Zebrafish
Match: rps6ka2 (ribosomal protein S6 kinase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-090827-1])

HSP 1 Score: 311.227 bits (796), Expect = 5.318e-97
Identity = 172/356 (48.31%), Postives = 233/356 (65.45%), Query Frame = 1
Query:  166 LNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERND-DELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY-WFENFSYVS 1227
            L K E DS  K  DI    V     K     F+LLK LG+G YG+VFL +K+ G+  G+ +AMKV+KKA L   K  D   +  ER+IL  VNHPF+VKL++AFQT   L+L+L++L GG+LF +L ++   TE++ +FYLAE  LAL HLHS+G+IYRDLK EN++LD  GH+K+TDFGLSKE  D D+  +SFCGT+EYMAPE++ RRGH  S DWWS G+L+++ML G+ PF G +R + +  +  AKL +P+FL+   + LL+ L  +NP  RLG G   VEEIKRH FF +I+W+K   RE+KPPF P +   +D   FD    S     SP     +N +  F  FS+V+
Sbjct:   29 LCKLEDDSILKEFDISHH-VKEGFEKADPSQFELLKVLGQGSYGKVFLVRKIKGSDTGQLYAMKVLKKATL---KVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSPEVQSLLRALFKRNPSNRLGAGPDGVEEIKRHIFFATIDWNKLYRREIKPPFKPAVGRPEDTFHFDPEFTSRTPTDSPGVPASANAHQLFRGFSFVA 380          

HSP 2 Score: 110.153 bits (274), Expect = 7.500e-25
Identity = 58/174 (33.33%), Postives = 101/174 (58.05%), Query Frame = 1
Query:  427 ILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVM-LDRYG---HVKLTDFGLSKE-RNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGG---NRSQVIQKVTNAKLKI 924
            +L    HP ++ L   +     ++LV+E + GGEL  ++ RQ   +E EA   L   T  + +LHS GV++RDLK  N++ +D  G    +++ DFG +K+ R ++ L  + C T  ++APE+L+++G+  + D WS+GILLY ML G +PF  G      +++ ++ + K  +
Sbjct:  460 LLRYGQHPNIITLKDVYDDGKFVYLVMELMRGGELLDRILRQKCFSEREASAVLCTITKTVEYLHSQGVVHRDLKPSNILYVDETGDPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKKQGYDAACDIWSLGILLYTMLAGFTPFANGPDDTPEEILARIGSGKFAL 633          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 352.058 bits (902), Expect = 2.662e-115
Identity = 201/396 (50.76%), Postives = 258/396 (65.15%), Query Frame = 1
Query:  103 DLKLKCDLINGIELEANDSDNLNKDEYDSTS-----KSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            DL    D I+  ELE    ++L  D   S+S     +  +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  +++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP   T  +S    F  F+YV+P V   + E  SF
Sbjct:    8 DLDQPEDAISDDELEDGVREDLLDDLLVSSSGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVIGAHTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESVKEKFSF 402          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 348.591 bits (893), Expect = 2.212e-114
Identity = 190/357 (53.22%), Postives = 242/357 (67.79%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  +++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP   T  +S    F  F+YV+P V   + E  SF
Sbjct:   18 EISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVIGAHTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESVKEKFSF 373          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 348.206 bits (892), Expect = 3.629e-114
Identity = 190/357 (53.22%), Postives = 242/357 (67.79%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  +++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP   T  +S    F  F+YV+P V   + E  SF
Sbjct:   26 EISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVIGAHTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESVKEKFSF 381          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 348.206 bits (892), Expect = 6.413e-114
Identity = 190/357 (53.22%), Postives = 242/357 (67.79%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  +++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP   T  +S    F  F+YV+P V   + E  SF
Sbjct:   40 EISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVIGAHTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESVKEKFSF 395          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Xenopus
Match: l3hypdh (L-3-hydroxyproline dehydratase (trans-) [Source:Xenbase;Acc:XB-GENE-1000732])

HSP 1 Score: 348.591 bits (893), Expect = 1.097e-113
Identity = 190/357 (53.22%), Postives = 242/357 (67.79%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  +++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP   T  +S    F  F+YV+P V   + E  SF
Sbjct:   71 EISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVIGAHTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGAGDAIDVQGHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDATLSESANQVFVGFTYVAPSVLESVKEKFSF 426          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Mouse
Match: Rps6kb1 (ribosomal protein S6 kinase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1270849])

HSP 1 Score: 350.903 bits (899), Expect = 9.806e-115
Identity = 191/357 (53.50%), Postives = 243/357 (68.07%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  E++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   73 EISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSF 428          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 341.273 bits (874), Expect = 1.765e-111
Identity = 183/358 (51.12%), Postives = 239/358 (66.76%), Query Frame = 1
Query:  202 VDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            V++ E +VN    ++  H F+LL  LGKGGYG+VF  +KV G   G+ +AMKV++KA+++ + K DT +   ERNILE+V HPF+V+L +AFQT   L+L+LE L+GGELF  LER+    ED A FYLAE TLALGHLHS G+IYRDLK EN+ML   GH+KLTDFGL KE  ++  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G+ PF   NR + + K+   KL +P +LT   + L K  L +NP  R+GGG  D  +++RH FFR INWD  LAR + PPF P L S +DVS FD     +  + SP  T   +S    F  F+YV+P V   + E  SF
Sbjct:   48 VELTESSVNLGPERIGPHCFELLSVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVCSAK-DTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFRHINWDDLLARRVDPPFRPSLQSEEDVSQFDARFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSF 404          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 341.273 bits (874), Expect = 1.765e-111
Identity = 183/358 (51.12%), Postives = 239/358 (66.76%), Query Frame = 1
Query:  202 VDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            V++ E +VN    ++  H F+LL  LGKGGYG+VF  +KV G   G+ +AMKV++KA+++ + K DT +   ERNILE+V HPF+V+L +AFQT   L+L+LE L+GGELF  LER+    ED A FYLAE TLALGHLHS G+IYRDLK EN+ML   GH+KLTDFGL KE  ++  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G+ PF   NR + + K+   KL +P +LT   + L K  L +NP  R+GGG  D  +++RH FFR INWD  LAR + PPF P L S +DVS FD     +  + SP  T   +S    F  F+YV+P V   + E  SF
Sbjct:   48 VELTESSVNLGPERIGPHCFELLSVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVCSAK-DTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFRHINWDDLLARRVDPPFRPSLQSEEDVSQFDARFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSF 404          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 334.339 bits (856), Expect = 5.625e-110
Identity = 178/348 (51.15%), Postives = 235/348 (67.53%), Query Frame = 1
Query:  196 KSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCYWFENFSYVSPQV 1236
            + V++ E +VN    ++  H F+LL  LGKGGYG+VF  +KV G   G+ +AMKV++KA+++ + K DT +   ERNILE+V HPF+V+L +AFQT   L+L+LE L+GGELF  LER+    ED A FYLAE TLALGHLHS G+IYRDLK EN+ML   GH+KLTDFGL KE  ++  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G+ PF   NR + + K+   KL +P +LT   + L K  L +NP  R+GGG  D  +++RH FFR INWD  LAR + PPF P L S +DVS FD     +  + SP   DD+      N +++ PQV
Sbjct:   46 EEVELTESSVNLGPERIGPHCFELLSVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVCSAK-DTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFRHINWDDLLARRVDPPFRPSLQSEEDVSQFDARFTRQTPVDSP---DDTALSESANQAFLPPQV 389          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Mouse
Match: Rps6kb2 (ribosomal protein S6 kinase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1927343])

HSP 1 Score: 334.339 bits (856), Expect = 5.625e-110
Identity = 178/348 (51.15%), Postives = 235/348 (67.53%), Query Frame = 1
Query:  196 KSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCYWFENFSYVSPQV 1236
            + V++ E +VN    ++  H F+LL  LGKGGYG+VF  +KV G   G+ +AMKV++KA+++ + K DT +   ERNILE+V HPF+V+L +AFQT   L+L+LE L+GGELF  LER+    ED A FYLAE TLALGHLHS G+IYRDLK EN+ML   GH+KLTDFGL KE  ++  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G+ PF   NR + + K+   KL +P +LT   + L K  L +NP  R+GGG  D  +++RH FFR INWD  LAR + PPF P L S +DVS FD     +  + SP   DD+      N +++ PQV
Sbjct:   46 EEVELTESSVNLGPERIGPHCFELLSVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVCSAK-DTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSHGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEILVRTGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLAKKFLKRNPTQRIGGGLGDAADVQRHPFFRHINWDDLLARRVDPPFRPSLQSEEDVSQFDARFTRQTPVDSP---DDTALSESANQAFLPPQV 389          
BLAST of Ribosomal protein S6 kinase vs. UniProt/SwissProt
Match: sp|Q8BSK8|KS6B1_MOUSE (Ribosomal protein S6 kinase beta-1 OS=Mus musculus OX=10090 GN=Rps6kb1 PE=1 SV=2)

HSP 1 Score: 350.903 bits (899), Expect = 6.859e-114
Identity = 191/357 (53.50%), Postives = 243/357 (68.07%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  E++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   73 EISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSF 428          
BLAST of Ribosomal protein S6 kinase vs. UniProt/SwissProt
Match: sp|P23443|KS6B1_HUMAN (Ribosomal protein S6 kinase beta-1 OS=Homo sapiens OX=9606 GN=RPS6KB1 PE=1 SV=2)

HSP 1 Score: 350.903 bits (899), Expect = 6.933e-114
Identity = 191/357 (53.50%), Postives = 243/357 (68.07%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  E++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   73 EISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSF 428          
BLAST of Ribosomal protein S6 kinase vs. UniProt/SwissProt
Match: sp|P67999|KS6B1_RAT (Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus OX=10116 GN=Rps6kb1 PE=1 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 7.161e-114
Identity = 191/357 (53.50%), Postives = 243/357 (68.07%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  E++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   73 EISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSF 428          
BLAST of Ribosomal protein S6 kinase vs. UniProt/SwissProt
Match: sp|P67998|KS6B1_RABIT (Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus OX=9986 GN=RPS6KB1 PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 7.639e-114
Identity = 191/357 (53.50%), Postives = 243/357 (68.07%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  E++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   73 EISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSF 428          
BLAST of Ribosomal protein S6 kinase vs. UniProt/SwissProt
Match: sp|Q6TJY3|KS6B1_BOVIN (Ribosomal protein S6 kinase beta-1 OS=Bos taurus OX=9913 GN=RPS6KB1 PE=2 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 3.862e-113
Identity = 190/357 (53.22%), Postives = 242/357 (67.79%), Query Frame = 1
Query:  205 DICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            +I E +VN    K+    F+LL+ LGKGGYG+VF  +KV GA  G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +N  +RLG G  D  E++ H FFR INW++ LAR+++PPF P L S +DVS FD     +  + SP  +   +S    F  F+YV+P V   + E  SF
Sbjct:   73 EISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSALSESANQVFLGFTYVAPSVLESVKEKFSF 428          
BLAST of Ribosomal protein S6 kinase vs. TrEMBL
Match: A0A068YKN8 (Non-specific serine/threonine protein kinase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001044600 PE=4 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 1.570e-126
Identity = 205/364 (56.32%), Postives = 260/364 (71.43%), Query Frame = 1
Query:  166 LNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP---TTTDDSNCYWFENFSYVSPQVYLEL 1248
            L+ +E +   + V+ICE+TVNP   KV   DF LLK LGKGGYG+VFLA+K+ G  +G+ FAMKV+KKA ++TN K DT +  TERNILE + HPFLV+L++AFQT   L+LVLE+LAGGELF QLE++    ED+A FYL+E  LA+GHLH +G++YRDLK EN++LD  GHVKLTDFGLSKER D +LTH+FCGT+EYMAPEIL R+GHG SVDWWS+G L+YDML G  PF G +R + ++ V   +  +  +LT   K LLK LL K    RLG G  D EEIK+H FF+SINWD+  AR+L+PPF P L+S  DVS FD    SE  + SP        SNC  F+ F+YV PQV + +
Sbjct:   44 LSVEEMNEHVERVEICEDTVNPGQPKVRPQDFTLLKVLGKGGYGKVFLARKITGVDSGQIFAMKVLKKASIVTNAK-DTAHTKTERNILEMIKHPFLVQLHYAFQTPGKLYLVLEFLAGGELFTQLEKEGVFMEDQASFYLSEIILAIGHLHKMGIVYRDLKPENILLDTEGHVKLTDFGLSKERVDQDLTHTFCGTIEYMAPEILLRQGHGKSVDWWSLGTLMYDMLSGGPPFTGDDRKKTMEAVLRGRYTLAPYLTYEAKDLLKRLLKKTVSERLGSGPTDAEEIKQHPFFQSINWDQVYARQLEPPFKPSLTSETDVSRFDPLFTSENPVESPDDGVPISASNCNVFDGFTYVDPQVQISM 406          
BLAST of Ribosomal protein S6 kinase vs. TrEMBL
Match: A0A068WC56 (Non-specific serine/threonine protein kinase OS=Echinococcus granulosus OX=6210 GN=EgrG_001044600 PE=4 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 2.316e-126
Identity = 205/364 (56.32%), Postives = 260/364 (71.43%), Query Frame = 1
Query:  166 LNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP---TTTDDSNCYWFENFSYVSPQVYLEL 1248
            L+ +E +   + V+ICE+TVNP   KV   DF LLK LGKGGYG+VFLA+K+ G  +G+ FAMKV+KKA ++TN K DT +  TERNILE + HPFLV+L++AFQT   L+LVLE+LAGGELF QLE++    ED+A FYL+E  LA+GHLH +G++YRDLK EN++LD  GHVKLTDFGLSKER D +LTH+FCGT+EYMAPEIL R+GHG SVDWWS+G L+YDML G  PF G +R + ++ V   +  +  +LT   K LLK LL K    RLG G  D EEIK+H FF+SINWD+  AR+L+PPF P L+S  DVS FD    SE  + SP        SNC  F+ F+YV PQV + +
Sbjct:   44 LSVEEMNEHVERVEICEDTVNPGQPKVRPQDFTLLKVLGKGGYGKVFLARKITGVDSGQIFAMKVLKKASIVTNAK-DTAHTKTERNILEMIKHPFLVQLHYAFQTPGKLYLVLEFLAGGELFTQLEKEGVFMEDQASFYLSEIILAIGHLHKMGIVYRDLKPENILLDTEGHVKLTDFGLSKERVDQDLTHTFCGTIEYMAPEILLRQGHGKSVDWWSLGTLMYDMLSGGPPFTGDDRKKTMEAVLRGRYTLAPYLTYEAKDLLKRLLKKTVSERLGSGPTDAEEIKQHPFFQSINWDQVYARQLEPPFKPSLTSETDVSRFDPLFTSENPVESPDDGVPISASNCDVFDGFTYVDPQVQISM 406          
BLAST of Ribosomal protein S6 kinase vs. TrEMBL
Match: A0A0R3TRD3 (Non-specific serine/threonine protein kinase OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS10136 PE=4 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 4.661e-126
Identity = 205/364 (56.32%), Postives = 263/364 (72.25%), Query Frame = 1
Query:  166 LNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP---TTTDDSNCYWFENFSYVSPQVYLEL 1248
            L+ +E     + V+ICE+TVNP   KV   DF+LLK LGKGGYG+VFLA+K+ G   G+ FAMKV+KKA ++TN K DT +  TERNILE + HPFLV+L++AFQT   L+LVLE+LAGGELF QLE++    E++A FYL+E  LA+GHLHS+G++YRDLK EN++LD  GHVKLTDFGLSKER D +LTH+FCGT+EYMAPEIL R+GHG SVDWWS+G L+YDML G  PFVG +R + ++KV   + +I  +L+   K LL+ LL KN   RLG G  D EEIK+H FF SI+WD+  AR+L+PPF P L+S  DVS FD    SE  + SP        SN   F+ F+YV PQV++ +
Sbjct:   44 LSVEEMSEYIERVEICEDTVNPGQPKVRPQDFNLLKVLGKGGYGKVFLAQKITGVDCGQIFAMKVLKKASIVTNAK-DTAHTKTERNILELIKHPFLVQLHYAFQTPGKLYLVLEFLAGGELFTQLEKEGVFLEEQAIFYLSEIILAIGHLHSMGIVYRDLKPENILLDTEGHVKLTDFGLSKERVDHDLTHTFCGTIEYMAPEILLRQGHGKSVDWWSLGTLMYDMLSGGPPFVGEDRKKTMEKVIRGRFQIAPYLSAEAKDLLRKLLKKNVSERLGSGPTDAEEIKKHLFFASISWDQVYARQLEPPFKPSLTSETDVSRFDPLFTSENPVESPDDGVPISASNLDVFDGFTYVDPQVHISM 406          
BLAST of Ribosomal protein S6 kinase vs. TrEMBL
Match: A0A564YF52 (Non-specific serine/threonine protein kinase OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5369 PE=4 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 1.106e-125
Identity = 205/364 (56.32%), Postives = 262/364 (71.98%), Query Frame = 1
Query:  166 LNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP---TTTDDSNCYWFENFSYVSPQVYLEL 1248
            L+ +E     + V+ICE+TVNP   KV   DF+LLK LGKGGYG+VFLA+K+ G  +G+ FAMKV+KKA ++TN K DT +  TERNILE + HPFLV+L++AFQT   L+LVLE+LAGGELF QLE++    ED+A FYL+E  LA+GHLHS+G++YRDLK EN++LD  GHVKLTDFGLSKER D +LTH+FCGT+EYMAPEIL R+GHG SVDWWS+G L+YDML G  PFVG +R + ++KV   + ++  +L+   K LL+ LL KN   RLG G  D EEIK+H FF  INWD+  AR L+PPF P L+S  DVS FD    SE  + SP        SN   F+ F+YV PQV++ +
Sbjct:   44 LSVEEMSEHIERVEICEDTVNPGQPKVRPQDFNLLKVLGKGGYGKVFLAQKITGVDSGQIFAMKVLKKASIVTNAK-DTAHTKTERNILEMIKHPFLVQLHYAFQTPGKLYLVLEFLAGGELFTQLEKEGVFLEDQAIFYLSEIILAIGHLHSMGIVYRDLKPENILLDTGGHVKLTDFGLSKERVDHDLTHTFCGTIEYMAPEILLRQGHGKSVDWWSLGTLMYDMLSGGPPFVGEDRKKTMEKVIRGRFQLAPYLSAEAKDLLRKLLKKNVGERLGSGPTDAEEIKQHPFFAPINWDQVYARRLEPPFKPSLTSETDVSRFDPLFTSENPVESPDDGVPISASNLDVFDGFTYVDPQVHISM 406          
BLAST of Ribosomal protein S6 kinase vs. TrEMBL
Match: A0A0V0J6H0 (Non-specific serine/threonine protein kinase OS=Schistocephalus solidus OX=70667 GN=TR96085 PE=4 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 1.567e-123
Identity = 207/381 (54.33%), Postives = 268/381 (70.34%), Query Frame = 1
Query:  166 LNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP---TTTDDSNCYWFENFSYVSPQVYLELSEN-----GSFSRQRTR 1284
            L+ +E     + V+ICE+TVNP   KV   DF LLK LGKGGYG+VFLA+K++G  +G+ FAMKV+KKA ++T+ K DT +  TERNILE + HPFLV+L++AFQT   L+L LE+LAGGELF QLER+    ED+A FYLAE  LA+GHLHS+G++YRDLK EN++LD  GHVKLTDFGLSKER D +LTH+FCGT+EYMAPEIL R+GHG SVDWWS+G L+YDML G  PF G +R + ++ V   K  +  +L+   K LLK LL KN   RLG  E+D EEIK H FFR+ NWD+  AR+++PPF P L+S  DVS FD    +E  + SP        S C  FE F+YV PQV++ ++ +      ++ R+R R
Sbjct:   44 LSIEEMHDEVERVEICEDTVNPGQPKVRPQDFTLLKVLGKGGYGKVFLARKISGVDSGQVFAMKVLKKASIVTSAK-DTAHTKTERNILEMIKHPFLVQLHYAFQTPGKLYLALEFLAGGELFTQLEREGVFMEDQASFYLAEIILAIGHLHSMGIVYRDLKPENILLDTEGHVKLTDFGLSKERVDKDLTHTFCGTIEYMAPEILLRQGHGKSVDWWSLGTLMYDMLSGGPPFAGEDRKKTMELVLRGKFVLAPYLSREAKRLLKGLLRKNVAERLGSKEEDAEEIKAHPFFRNTNWDQVYARQVEPPFKPTLTSETDVSRFDPQFTNENPVESPDEGVPISASVCDVFEGFTYVDPQVHISMARDPWAFENTYLRRRRR 423          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Cavefish
Match: rps6kb1b (ribosomal protein S6 kinase B1 [Source:NCBI gene;Acc:103035647])

HSP 1 Score: 354.369 bits (908), Expect = 1.682e-116
Identity = 193/370 (52.16%), Postives = 249/370 (67.30%), Query Frame = 1
Query:  166 LNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            LN D+     + ++I E++VN     +    F+LL+ LGKGGYG+VF  +KV G  +G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL ++  +RLG G  D  E++ H FFR INWD  LAR+++PPF P L S +DVS FD    S+  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   35 LNMDD----CEKIEISEDSVNQGTESIRPECFELLRVLGKGGYGKVFQVRKVTGGGSGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFRHINWDDLLARKVEPPFKPFLQSAEDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENIKEKFSF 399          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Cavefish
Match: rps6kb1b (ribosomal protein S6 kinase B1 [Source:NCBI gene;Acc:103035647])

HSP 1 Score: 353.984 bits (907), Expect = 2.547e-116
Identity = 190/360 (52.78%), Postives = 245/360 (68.06%), Query Frame = 1
Query:  196 KSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            + ++I E++VN     +    F+LL+ LGKGGYG+VF  +KV G  +G+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL ++  +RLG G  D  E++ H FFR INWD  LAR+++PPF P L S +DVS FD    S+  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   44 EKIEISEDSVNQGTESIRPECFELLRVLGKGGYGKVFQVRKVTGGGSGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKRLLKRSASSRLGAGPGDATEVQTHPFFRHINWDDLLARKVEPPFKPFLQSAEDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENIKEKFSF 402          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Cavefish
Match: ENSAMXT00000004157.2 (ribosomal protein S6 kinase B2 [Source:NCBI gene;Acc:103031203])

HSP 1 Score: 344.354 bits (882), Expect = 4.093e-113
Identity = 191/387 (49.35%), Postives = 255/387 (65.89%), Query Frame = 1
Query:  136 IELEANDSDNLNKDEYDST--------SKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGS 1263
            I+LE+ D  +   + Y+ T        ++ V++  E VN    +V    F+LL  LGKGGYG+VF  +KV G+  G+ FAMKV++KA+++ N K DT +   ER ILE V HPF+V L++AFQT   L+L+LE L+GGELFMQLE++    ED A FYLAE TLALGHLHS G+IYRDLK EN+ML+  GH+KLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L++DM+ G+ PF G NR + I K+   K+ +P +LT   + L+K LL KNP  RLG G+ D  +I++H FFR INWD  L + ++PP+ P L S +DVS FD     +  + SP  TT   S  + F  F+YV+P V   L E  S
Sbjct:    7 IDLESEDVSDPEDEVYNFTVAESEPLETEEVELTSEVVNRDSERVGPDCFELLTVLGKGGYGKVFQVRKVQGSQMGKIFAMKVLRKAKIVRNAK-DTAHTRAEREILETVRHPFIVDLWYAFQTGGKLYLILECLSGGELFMQLEKEGIFMEDTACFYLAEITLALGHLHSNGIIYRDLKPENIMLNHEGHIKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILNRSGHNRAVDWWSLGALMFDMMTGSPPFTGENRKKTIDKILKCKICLPPYLTPDARDLIKKLLKKNPSQRLGSGKGDCADIQKHPFFRHINWDDLLHKRVEPPYRPSLQSDEDVSQFDSRFTRQTPVDSPDDTTLSGSADHAFAGFTYVAPSVLESLKEGFS 392          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Cavefish
Match: rps6kal (ribosomal protein S6 kinase a, like [Source:NCBI gene;Acc:337670])

HSP 1 Score: 310.071 bits (793), Expect = 6.100e-97
Identity = 158/328 (48.17%), Postives = 223/328 (67.99%), Query Frame = 1
Query:  292 YGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERND-DELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY-WFENFSYVSPQVYLELSENGSFS 1269
            +G+VFL +K+ G  AG+ +AMKV+KKA L    +  TK    ER+IL  VNHPF+VKL++AFQT   L+L+L++L GG++F +L ++   TE++ +FYLAE  LAL HLH++G++YRDLK EN++LD  GH+KLTDFGLSKE  D D   +SFCGTVEYMAPE++ RRGH  S DWWS+G+L+++ML G  PF G +R++ +  +  AKL +P+FL+   + LL+ L  +NP  RLG G   VEEIKRH FF +I+W+K   +EL+PPF P     DD   FD    ++    SP     +N +  F+ FS+V+P   LE S++  F+
Sbjct:   71 FGKVFLVRKIMGPDAGQLYAMKVLKKASLKVRDRVRTK---MERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVMFTEEDVKFYLAELALALDHLHNLGIVYRDLKPENILLDEAGHIKLTDFGLSKESVDQDRKAYSFCGTVEYMAPEVVNRRGHTQSADWWSLGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSLEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHAFFSTIDWNKLYRQELQPPFKPAAGKPDDTFCFDPEFTAKTPKDSPGIPPSANAHQLFKGFSFVAP-ASLEESKSSPFN 394          

HSP 2 Score: 109.383 bits (272), Expect = 9.042e-25
Identity = 62/199 (31.16%), Postives = 109/199 (54.77%), Query Frame = 1
Query:  295 GQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVM-LDRYGH---VKLTDFGLSKE-RNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGG 876
            G   + K+    +    FA+K++ K++   +++ +         ++    HP ++ L   +     ++LV E + GGEL  ++ RQ   +E EA   L   T  + +LH  GV++RDLK  N++ +D  G+   +++ DFG +K+ R D+ L  + C T  ++APE+L R+G+  + D WS+G+LLY ML G +PF  G
Sbjct:  421 GSYSICKRCIHRVTAMEFAVKIIDKSKRDPSEEIEI--------LMRYGQHPNIITLKDVYDEGRFVYLVTELMKGGELLDKILRQKFFSEREASAVLYTITKTVDYLHCQGVVHRDLKPSNILYMDDSGNPDSIRICDFGFAKQLRGDNGLLLTPCYTANFVAPEVLMRQGYDAACDIWSLGVLLYTMLAGYTPFANG 611          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Cavefish
Match: rps6ka2 (ribosomal protein S6 kinase A2 [Source:NCBI gene;Acc:103036630])

HSP 1 Score: 310.842 bits (795), Expect = 6.122e-97
Identity = 173/364 (47.53%), Postives = 237/364 (65.11%), Query Frame = 1
Query:  166 LNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERND-DELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY-WFENFSYVSPQVYLELS 1251
            L K E DS  K +DI    V     K     F+LLK LG+G YG+VFL +K+ G+  G+ +AMKV+KKA L   K  D   +  ER+IL  VNHPF+VKL++AFQT   L+L+L++L GG+LF +L ++   TE++ +FYLAE  LAL HLHS+G+IYRDLK EN++LD  GH+K+TDFGLSKE  D D+  +SFCGT+EYMAPE++ RRGH  S DWWS G+L+++ML G+ PF G +R + +  +  AKL +P+FL+   + LL+ L  +NP  RLG G   VEEIKRH FF +I+W+K   +E+KPPF P +   +D   FD    S     SP     +N +  F  FS+V+  +  E S
Sbjct:   29 LCKLEDDSILKEIDISNH-VKEGFEKADPSQFELLKVLGQGSYGKVFLVRKIKGSDTGQLYAMKVLKKATL---KVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEDGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSSEVQSLLRALFKRNPSNRLGAGPDGVEEIKRHHFFATIDWNKLYRKEIKPPFKPAVGRPEDTFHFDPEFTSRTPTDSPGVPPSANAHQLFRGFSFVATNLRPEQS 388          

HSP 2 Score: 109.383 bits (272), Expect = 9.512e-25
Identity = 60/182 (32.97%), Postives = 107/182 (58.79%), Query Frame = 1
Query:  346 FAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVM-LDRYG---HVKLTDFGLSKE-RNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGG 876
            +A+K+++K++   +++ +         +L    HP ++ L   +     ++LV+E + GGEL  ++ RQ   +E EA   L   T  + +LHS GV++RDLK  N++ +D  G    +++ DFG +K+ R ++ L  + C T  ++APE+L+++G+  + D WS+GILLY ML G +PF  G
Sbjct:  441 YAVKIIEKSKKDPSEEIEI--------LLRYGQHPNIITLKDVYDDGKFVYLVMELMRGGELLDRILRQKGFSEREASAVLCTITKTVEYLHSQGVVHRDLKPSNILYVDETGDPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKKQGYDAACDIWSLGILLYTMLAGFTPFANG 614          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 248.44 bits (633), Expect = 1.665e-76
Identity = 140/352 (39.77%), Postives = 212/352 (60.23%), Query Frame = 1
Query:  199 SVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHS-IGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELT-HSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPT-------TTDDSNCYWFENFSYVS 1227
            S +  +  ++ P  KVT ++FD LK LGKG +G+V L ++      G+Y+AMK++KK  ++   K++  + +TE  +L+   HPFL  L ++FQT+  L  V+EY+ GGELF  L R+   +ED  RFY AE   AL +LH+   V+YRDLK EN+MLD+ GH+K+ DFGL KE   D  T  +FCGT EY+APE+L+   +G +VDWW +G+++Y+M+ G  PF   +  ++ + +    ++ PR L++  + LL  LL K+PK RLGGG  D +EI RH FF  I W     R++ PPF P+++S  D   FD+   ++   I+P        + D+     F  FSY +
Sbjct:  130 STEQMDTILSKPKSKVTMNNFDYLKLLGKGTFGKVILVRE---KATGQYYAMKILKKEVIVA--KDEVAHTLTENRVLQTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDEEFTAQTITITPPDRFDSMESLDNERRPHFPQFSYCA 476          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 236.498 bits (602), Expect = 1.323e-72
Identity = 133/315 (42.22%), Postives = 202/315 (64.13%), Query Frame = 1
Query:  256 DFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNIL-EAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDE-LTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSN 1194
            DFD L  LGKG +G+V LAK  +    G ++A+KV+KK+ ++  +K + K+ M ERN+L + V HPFLV L+++FQ+   L+ V++Y+ GGELF  L+RQ +  E  A+FY AE   A+G+LHS+ ++YRDLK EN++LD  GH+ LTDFGL KE  D    T +FCGT EY+APE+L++  +  +VDWW +G +LY+ML G  PF   N  Q+ + + +  L++    T++   +L+ LL+K+P  RL G   D+ EIK H FF +INW+   A+ +  P+ P +S   D+  FD    +EP  +S   + D++
Sbjct:   91 DFDFLTVLGKGSFGKVLLAKHKSD---GIFYAVKVMKKSIIL--QKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILHQPLQLRPCTTNAAISVLEGLLHKDPHQRL-GATSDILEIKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFDPAFTAEPLSMSMAQSSDTS 399          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.527 bits (519), Expect = 4.108e-62
Identity = 100/268 (37.31%), Postives = 169/268 (63.06%), Query Frame = 1
Query:  334 AGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFD 1137
             G++ ++K  K+ +++  K+   ++ + E+ IL+A++ PFLV+L ++F+ N +L++VLEY+ GGE+F  L R    +E  +RFY A+  LA  +LHS+ +IYRDLK EN+++D+ G++++TDFG +K       T + CGT EY+APEI+  +G+  +VDWW++G+L+Y+M  G  PF      Q+ +K+ + K++ P   +   K LL+NLL  +   R G  +  V +IK H +F + +W     R+++ PFIP+     D S FD
Sbjct:    3 VGQHVSLKATKRTKVVKLKQ--VEHTLNEKRILQAISFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGR--TWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYQRKVEAPFIPKCKGPGDASNFD 266          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 209.534 bits (532), Expect = 2.880e-61
Identity = 115/276 (41.67%), Postives = 167/276 (60.51%), Query Frame = 1
Query:  292 YGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNIL-EAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHT--LTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPEL 1107
            +G+V LA+       G++FA+K +KK  ++    +D +  M E+ +L  A  HPFL  L   FQT   LF V+E+L GG+L   ++ +    L     RFY AE    L  LHS  +IYRDLK +NV+LDR GHVK+ DFG+ KE      L  +FCGT +Y+APEIL  R +G SVDWWSMG+L+Y+MLIG SPF G +  ++ + +       PR+L+DS +++L  L  ++   RLG     V +I+ H FF++I+W    AR++ PPF P++
Sbjct:  263 FGKVMLAELKE---QGKFFAIKALKKEVVLMG--DDVECTMVEKRVLLMACEHPFLTHLCGTFQTKEHLFFVMEFLTGGDLMFHIQDKGKFDLPTGTNRFYAAEVICGLQFLHSHNIIYRDLKLDNVLLDREGHVKIADFGMCKEHVGAGNLATTFCGTPDYIAPEILLGRAYGTSVDWWSMGVLIYEMLIGQSPFYGSDEDELFEAIKGHTPHYPRWLSDSSRNILSCLFERDHTKRLGA----VGDIRLHPFFKNIDWPSLEARKITPPFKPKV 529          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 199.904 bits (507), Expect = 1.267e-60
Identity = 115/274 (41.97%), Postives = 164/274 (59.85%), Query Frame = 1
Query:  298 QVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILE-AVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSS 1113
            QVFLA+    +    +FA+K +KK  +I +  +D +  + E+ IL  A  HP+L  LY  FQT   L  V+EYL GG+L   ++ +     D A FY AE    L  LH  G+IYRDLK +N++LD+ GHVK+ DFG+ KE    D    +FCGT +Y+APEI+  + +  SVDWWS G+LLY+MLIG SPF G +  ++ + +  +    PR++T   + +L  LL + P  RLG       EI++H FFR+INW+    REL+PPF P + S
Sbjct:    1 QVFLAEL--KSRPRNFFAIKALKKDVVIMS--DDVECTLVEKRILSLAWGHPYLAHLYSTFQTKEHLMFVMEYLNGGDLMFHIQVKGRFEIDRATFYAAEIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKENIVGDVRAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQSPFRGDDEEELFESIRTSVPYYPRWITKDSRDILPLLLEREPMKRLGV----TGEIRQHPFFRTINWEALEKRELEPPFKPRVVS 266          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 219.935 bits (559), Expect = 8.903e-67
Identity = 117/301 (38.87%), Postives = 187/301 (62.13%), Query Frame = 1
Query:  241 KVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSS-RDDVSLFDK 1140
            K +  DF +L+ LG G +G+V L   +     G Y+AMKV+KK  ++  K+   ++   ER +L  V HPF+++++  FQ    +F++++Y+ GGELF  L +        A+FY AE  LAL +LHS  +IYRDLK EN++LD+ GH+K+TDFG +K   D  +T++ CGT +Y+APE++  + +  S+DWWS GIL+Y+ML G +PF   N  +  +K+ NA+L+ P F  +  K LL  L+ ++   RLG  +   E++K H +F+ + W+K L+R ++ P+ P +   + D S FDK
Sbjct:   81 KYSLQDFQILRTLGTGSFGRVHL---IRSRHNGRYYAMKVLKKEIVVRLKQ--VEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDK 374          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 218.009 bits (554), Expect = 3.068e-66
Identity = 119/326 (36.50%), Postives = 196/326 (60.12%), Query Frame = 1
Query:  241 KVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSR-DDVSLFDKNIVSEPCMISPTTTDDSNCYWFENF 1215
            K T HDF +++ LG G +G+V L + V+    G Y+A+KV+KK +++  K+   ++   ER +L+ V HPFL++++  FQ   ++F+V++Y+ GGELF  L +        A+FY AE  LAL +LH+  +IYRDLK EN++LDR GH+K+TDFG +KE     +T + CGT +Y+APE++  + +  SVDWWS+G+L+Y+ML G +PF      +  +K+   K+  P +       LL  L+  +   R+G  +    +IK H +F  + W++ LA++++ P+ P ++S   D SLFD+    E  +      DD    +F++F
Sbjct:   64 KYTLHDFQIMRTLGTGSFGRVHLVRSVHN---GRYYAIKVLKKQQVVKMKQ--VEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQ--TVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQ--YPEEQLDYGIQGDDPYAEYFQDF 380          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 215.698 bits (548), Expect = 3.884e-65
Identity = 115/301 (38.21%), Postives = 187/301 (62.13%), Query Frame = 1
Query:  241 KVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSS-RDDVSLFDK 1140
            K +  DF +L+ LG G +G+V L +  +    G ++A+K +KK  ++  K+   ++   ER +L  V+HPF+++++  FQ +  +F+V++Y+ GGELF  L +        A+FY AE  LAL +LHS  +IYRDLK EN++LD+ GH+K+TDFG +K   D  +T++ CGT +Y+APE++  + +  SVDWWS G+L+Y+ML G +PF   N  +  + + NA+LK P F     + LLK L+ ++   RLG  +   E++K H +F  + W+K LAR ++ P+ P +   + D S FD+
Sbjct:   82 KYSLSDFQILRTLGTGSFGRVHLIRSNHN---GRFYALKTLKKHTIVKLKQ--VEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDR 375          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Yeast
Match: SCH9 (AGC family protein kinase; functional ortholog of mammalian S6 kinase; phosphorylated by Tor1p and required for TORC1-mediated regulation of ribosome biogenesis, translation initiation, and entry into G0 phase; involved in transactivation of osmostress-responsive genes; regulates G1 progression, cAPK activity and nitrogen activation of the FGM pathway; integrates nutrient signals and stress signals from sphingolipids to regulate lifespan [Source:SGD;Acc:S000001248])

HSP 1 Score: 219.935 bits (559), Expect = 2.948e-63
Identity = 133/300 (44.33%), Postives = 193/300 (64.33%), Query Frame = 1
Query:  253 HDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNIL---EAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPE-ILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPR-FLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFD 1137
             DF++L+ LGKG +GQV+  KK +       +AMKV+ K  ++  KKN+  + + ERNIL    + + PF+V L F+FQT   L+LV +Y++GGELF  L+++   +ED A+FY+AE  LAL HLH   ++YRDLK EN++LD  G++ L DFGLSK    D  T++FCGT EY+APE +L   G+   VD+WS+G+L+++M  G SPF   N  ++ QK+   K+K PR  L+  G+  +K LLN+NPK RLG  + D  E++ H FF  I+W+    +++ PPF P L S  D S FD
Sbjct:  410 QDFEVLRLLGKGTFGQVYQVKKKD---TQRIYAMKVLSKKVIV--KKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKDR-TNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGAID-DGRELRAHPFFADIDWEALKQKKIPPPFKPHLVSETDTSNFD 702          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Yeast
Match: PKC1 (Protein serine/threonine kinase; essential for cell wall remodeling during growth; localized to sites of polarized growth and the mother-daughter bud neck; homolog of the alpha, beta, and gamma isoforms of mammalian protein kinase C (PKC) [Source:SGD;Acc:S000000201])

HSP 1 Score: 211.846 bits (538), Expect = 1.237e-59
Identity = 121/321 (37.69%), Postives = 184/321 (57.32%), Query Frame = 1
Query:  292 YGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNIL---EAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDEL-----THSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMIS--PTTTDDSNCYWFENFSYV 1224
            +G+V L+K  N        A+KV+KK  +I N  +D + A  E+ +        HPFL  LY +FQT + ++  +E++ GG+L   ++ Q  L+   A+FY AE  LAL + H  GVIYRDLK EN++L   GH+K+ D+GL K    DE+     T +FCGT E+MAPEIL+ + +  +VDWW+ G+LLY ML+  SPF G +  +V   +   +   P  +      + + LL K+P+ RLG G +D +E+    FFR+IN+D  L   +KPP+IPE+ S +D S F++   S P  ++  P+    S    F  FS++
Sbjct:  835 FGKVILSKSKN---TDRLCAIKVLKKDNIIQN--HDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQR-LSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCK----DEMWYGNRTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGEIVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNINFDDILNLRVKPPYIPEIKSPEDTSYFEQEFTSAPPTLTPLPSVLTTSQQEEFRGFSFM 1145          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 350.132 bits (897), Expect = 1.985e-116
Identity = 196/401 (48.88%), Postives = 259/401 (64.59%), Query Frame = 1
Query:  127 INGIELEANDSDNLNKDEYDSTS------------KSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERN-DDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSFSRQRTR 1284
            IN + L A + +  + DE+D               +++ + EETVNP   KV    F+LLK LGKGGYG+VFL KK +G    + FAMKV+KKA +I ++K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYL+E ++AL HLH  G++YRDLK EN++LD  GHVKLTDFGL KE   ++ LTH+FCGT+EYMAPEIL R GHG +VDWWS+G L+YDML G  PF   NR + I K+   KL IP +LT   K  ++ LL ++P+ARLGG   D   IK H FFR I W+  LA++++PPF P +S  +DVS FD     +  + SP  +   +S    F+ F+YV+P V   L  + +FS  + R
Sbjct:    9 INDVALAAGEDELSSDDEFDEGQVYDEPMDGDERMETLQLSEETVNPKDEKVGPESFELLKVLGKGGYGKVFLVKKNHGHSKEKIFAMKVLKKAAIIRSQK-DTAHTKAERNILECVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTACFYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCADNRKKTIDKILKGKLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFRHICWEDLLAKKVEPPFRPSISGEEDVSQFDSKFTRQTPVDSPDDSMLSESASNIFQGFTYVAPSVLESLCRSDNFSPWKVR 408          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Nematostella
Match: EDO31895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWM6])

HSP 1 Score: 315.079 bits (806), Expect = 1.376e-100
Identity = 167/345 (48.41%), Postives = 227/345 (65.80%), Query Frame = 1
Query:  241 KVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY-WFENFSYVSPQVYLELSENGSFSR 1272
            K     F+LLK LG+G +G+VFL +KV GA AG  +AMKV+KKA L   K  D    M ER+IL  V HPF+V+L +AFQT   ++L+L++L GG+LF +L ++   TE++ +FYLAE  LAL HLH +G+IYRDLK EN++LD  GHV LTDFGLSKE   D+ T+SFCGTVEYMAPE++ RRGH  + DWWS G+L+++ML G+ PF G +R   +  +  AKL +P+FLT   + LL+ L  +NP  RLG G+  +E+IK+H FF +INW+    RE+KPPF P     DD   FD    S+    SP     + C+  F  FSYV+P + +E+   G  +R
Sbjct:    3 KADPSQFELLKVLGQGSFGKVFLVRKVIGADAGTLYAMKVLKKATL---KVRDRMRTMKERDILVDVQHPFIVRLNYAFQTEGKVYLILDFLRGGDLFTRLSKEIMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPENILLDASGHVALTDFGLSKESEHDQKTYSFCGTVEYMAPEVVNRRGHSQAADWWSYGVLMFEMLTGSLPFQGKDRKDTMNMILKAKLGMPQFLTPEAQSLLRQLFKRNPLNRLGAGDLGIEDIKKHPFFSTINWELLYKREIKPPFKPAAGRADDAFYFDPEFTSKTPQDSPAVPPSATCHQLFRGFSYVAPDI-VEVETRGPAAR 343          

HSP 2 Score: 103.99 bits (258), Expect = 1.352e-23
Identity = 68/207 (32.85%), Postives = 113/207 (54.59%), Query Frame = 1
Query:  319 VNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVML-DRYG---HVKLTDFGLSKE-RNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGG---NRSQVIQKVTNAK 915
            VN A   EY A+K+ +K       K D    M    +L   +HP +V L  A++    +++V+E + GGEL  ++ +   L+E EA   +   T  +  LH  GV++RDLK  N+M  D  G    +++ DFG +K+ R  + L  + C T  ++APE+L+++G+  + D WS+G+LLY ML G +PF  G     S +++++   K
Sbjct:  374 VNKADGKEY-AVKIFEKP------KKDPSEEM--EILLRFGHHPNIVHLRDAYEAGKQVYIVMELMRGGELLDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPESLRIVDFGFAKQMRATNGLLMTPCYTANFVAPEVLKKQGYDAACDIWSLGVLLYTMLSGLTPFAVGPEDTPSVILKRIGEGK 571          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 261.151 bits (666), Expect = 5.124e-82
Identity = 157/387 (40.57%), Postives = 234/387 (60.47%), Query Frame = 1
Query:  103 DLKLKCDLINGIELEANDSDNLNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNIL-EAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDE-LTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY---------WFENFSYVSP 1230
            D++    L N    +AND D     + D+  + +D+ E   NP   K    DF  LK +GKG +G+VFL+K        +++A+KV+ K+ +   K+N+ K+ M ERN+L + V HPFLV L+++FQT   L+ VL+Y+ GGELF  L+R+    E  ARFY AE   A+G+LH + +IYRDLK EN++LD  GH+ LTDFGL KE  D    T +FCGT EY+APE+L+++ +  SVDWW +G +LY+M+ G  PF   + +++   + +  L++   ++ S +H+L+ LL K+   RLG GE D E+I+ H FFRSINW + +AR ++PP+ P +S + D+  FD   V EP   S   + DSN            F  F+YV+P
Sbjct:   27 DVREFLSLDNPKNAQANDEDEQPGSD-DADVEKIDLGESN-NP---KAKPSDFLFLKVIGKGSFGKVFLSKN---KQEDKFYAIKVLNKSAI--RKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYDNILHKPLRLRTNISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRSINWQQLVARGIEPPYNPNVSGQLDLKHFDPEFVREPVPGSVGKSADSNFVSASVDDPDDAFVGFTYVAP 403          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Nematostella
Match: EDO39163 (Ribosomal protein S6 kinase [Source:UniProtKB/TrEMBL;Acc:A7SAZ2])

HSP 1 Score: 253.832 bits (647), Expect = 8.301e-76
Identity = 149/342 (43.57%), Postives = 211/342 (61.70%), Query Frame = 1
Query:  241 KVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNH-PFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKE---RNDDELTHSFCGTVEYMAPEILQ--RRGHGPSVDWWSMGILLYDMLIGNSPF-VGG---NRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCYWFENFSYVSPQV 1236
            KV   +F+LL+ LG G YG+VFLA+K  G   G  FAMKV+KKA ++   K   ++  TER +LEAV   PFLV L++AFQT   L L+++Y+ GGELF  L ++   TEDE R Y+ E  +AL HLH +G+IYRD+K EN++LD+ GHV LTDFGLSKE    N  E  +SFCGT+EYMAPE+++   RGH  +VDWWS+G+L+Y++L G SPF V G   ++S++ +++ +    +P  L+     LL  LL K+PK RLG   K   E+K H FF++ +W     + +  PF P +    DVS F +         SP     +    F  +S+V+P +
Sbjct:   10 KVGIENFELLRVLGTGAYGKVFLARKRGGHHDGRLFAMKVLKKATIVQKAKT-AEHTRTERQVLEAVRRCPFLVTLHWAFQTEAKLHLIMDYVNGGELFTHLYQREKFTEDEVRLYIGEIVVALDHLHQLGIIYRDIKLENILLDKDGHVVLTDFGLSKEFAAPNSGERAYSFCGTIEYMAPEVVKGGSRGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQSEISKRILHNNPPMPHDLSAEAIDLLHKLLQKDPKKRLGA--KGAHELKAHPFFKAFDWADLAEKRIPAPFKPRIRDELDVSNFSEEFTDMAPTYSPAAVPKTADRVFRGYSFVAPSI 348          

HSP 2 Score: 101.679 bits (252), Expect = 1.092e-22
Identity = 52/149 (34.90%), Postives = 82/149 (55.03%), Query Frame = 1
Query:  442 NHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVML---DRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQR----RGHGPSVDWWSMGILLYDMLIGNSPF 867
             HP +V LY  +Q     +LV+E LAGGEL  ++ ++   TE  A   + +   A+  +H  GV++RDLK EN++         +K+ DFG +  + + +   + C T+ Y APE+L +     G+  S D WS+G++LY ML G  PF
Sbjct:  445 GHPNIVTLYDVYQDEFHTYLVMELLAGGELLERIRKKKMFTESAASVIMRKIVSAVEFMHQRGVVHRDLKPENLLFVDNSEDAEIKIVDFGFACVKPEAQQLQTPCFTLSYAAPEVLDQTVSNSGYDESCDLWSLGVILYTMLSGQVPF 593          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Nematostella
Match: EDO35585 (Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7SL27])

HSP 1 Score: 232.646 bits (592), Expect = 4.001e-68
Identity = 136/337 (40.36%), Postives = 203/337 (60.24%), Query Frame = 1
Query:  241 KVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILE-AVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVE-EIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTD---DSNCYWFENFSYVSPQ 1233
            K+T  DF  +K LGKG +G+V LA++       E +A+K++KK  ++ +  +D +  M ER +L  +  HPFL  L+ +FQT   LF V+EY+ GG+L  Q+++     E+ +RFY AE  LAL  LH  GVIYRDLK +NV+LD  GH+KL DFG+ KE     + T +FCGT +Y+APEILQ + +G SVDWW++G+L+Y+M+ G  PF   N   + + + +  +  P +L+     +LK  + KN   RLG      E  I+ H FFR IN++K  AR++ PPF P++ SR DV  FD +   E   ++PT  +   + +   F  FS+V+P 
Sbjct:  377 KMTLKDFTFIKVLGKGSFGKVLLAERKG---TDEVYAIKILKKESVLQD--DDVECTMIERRVLALSAGHPFLTSLHSSFQTVERLFFVMEYVNGGDLMFQIQKSRKFDENRSRFYAAEVVLALQFLHQNGVIYRDLKLDNVLLDADGHIKLADFGMCKENMAPGKTTTTFCGTPDYIAPEILQEQPYGFSVDWWALGVLMYEMMAGQPPFEAENEEDLFESILHDDVLYPVWLSREAVSILKGFMTKNYLKRLGCTPTSTESSIREHAFFRLINFEKLEARQINPPFKPKIRSRTDVGNFDTDFTKEEPKLTPTDRNVIVNIDQREFRGFSFVNPH 708          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Medaka
Match: rps6kb1b (ribosomal protein S6 kinase beta-1-like [Source:NCBI gene;Acc:101174764])

HSP 1 Score: 360.533 bits (924), Expect = 2.864e-119
Identity = 195/374 (52.14%), Postives = 250/374 (66.84%), Query Frame = 1
Query:  154 DSDNLNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            D D   ++  D  ++ ++I E+ VN     +    F+LL+ LGKGGYG+VF  +KV GA AG+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +   +RLG G  D  E++ H FFR INW+  LAR+++PPF P L S DDVS FD    S+  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:    8 DLDQPEENVSDDENEEIEISEDNVNQGTESIRPECFELLRVLGKGGYGKVFQVRKVVGAAAGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNSQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKRLLKRTASSRLGAGPGDATEVQAHPFFRHINWEDLLARKVEPPFKPVLQSADDVSQFDSKFTSQTPVDSPDDSTLSESANQAFLGFTYVAPSVLENMKERFSF 380          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Medaka
Match: rps6kb1b (ribosomal protein S6 kinase beta-1-like [Source:NCBI gene;Acc:101174764])

HSP 1 Score: 356.295 bits (913), Expect = 3.087e-117
Identity = 192/360 (53.33%), Postives = 244/360 (67.78%), Query Frame = 1
Query:  196 KSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            + ++I E+ VN     +    F+LL+ LGKGGYG+VF  +KV GA AG+ FAMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL +   +RLG G  D  E++ H FFR INW+  LAR+++PPF P L S DDVS FD    S+  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   49 EQIEISEDNVNQGTESIRPECFELLRVLGKGGYGKVFQVRKVVGAAAGKIFAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNSQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKRLLKRTASSRLGAGPGDATEVQAHPFFRHINWEDLLARKVEPPFKPVLQSADDVSQFDSKFTSQTPVDSPDDSTLSESANQAFLGFTYVAPSVLENMKERFSF 407          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Medaka
Match: rps6kb1a (ribosomal protein S6 kinase beta-1 [Source:NCBI gene;Acc:101174287])

HSP 1 Score: 355.525 bits (911), Expect = 3.266e-117
Identity = 196/373 (52.55%), Postives = 250/373 (67.02%), Query Frame = 1
Query:  157 SDNLNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            + NL     D   K  ++ E  VN    ++    F+LLK LGKGGYG+VF  +KV+GA +G+ +AMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL ++  +RLGGG  D  E++ H FFR INWD  LAR+++PPF P L S DDVS FD    S+  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:    6 TTNLRMGNMDDCEK-FELSENNVNKGTEQIRPECFELLKVLGKGGYGKVFQVRKVSGASSGKIYAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNDSGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLSLPPYLTQEARDLLKKLLKRSASSRLGGGPGDAAEVQVHPFFRHINWDDLLARKVEPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENVKEKFSF 376          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Medaka
Match: rps6kb1a (ribosomal protein S6 kinase beta-1 [Source:NCBI gene;Acc:101174287])

HSP 1 Score: 354.755 bits (909), Expect = 1.010e-116
Identity = 197/381 (51.71%), Postives = 254/381 (66.67%), Query Frame = 1
Query:  133 GIELEANDSDNLNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            G  +E   S + N D+ +      ++ E  VN    ++    F+LLK LGKGGYG+VF  +KV+GA +G+ +AMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL ++  +RLGGG  D  E++ H FFR INWD  LAR+++PPF P L S DDVS FD    S+  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   11 GEYMEQCSSFDFNMDDCEK----FELSENNVNKGTEQIRPECFELLKVLGKGGYGKVFQVRKVSGASSGKIYAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNDSGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLSLPPYLTQEARDLLKKLLKRSASSRLGGGPGDAAEVQVHPFFRHINWDDLLARKVEPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENVKEKFSF 386          
BLAST of Ribosomal protein S6 kinase vs. Ensembl Medaka
Match: rps6kb1a (ribosomal protein S6 kinase beta-1 [Source:NCBI gene;Acc:101174287])

HSP 1 Score: 354.369 bits (908), Expect = 2.698e-116
Identity = 197/381 (51.71%), Postives = 254/381 (66.67%), Query Frame = 1
Query:  133 GIELEANDSDNLNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER-NDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISP--TTTDDSNCYWFENFSYVSPQVYLELSENGSF 1266
            G  +E   S + N D+     +  ++ E  VN    ++    F+LLK LGKGGYG+VF  +KV+GA +G+ +AMKV+KKA ++ N K DT +   ERNILE V HPF+V L +AFQT   L+L+LEYL+GGELFMQLER+    ED A FYLAE ++ALGHLH  G+IYRDLK EN+ML+  GHVKLTDFGL KE  +D  +TH+FCGT+EYMAPEIL R GH  +VDWWS+G L+YDML G  PF G NR + I K+   KL +P +LT   + LLK LL ++  +RLGGG  D  E++ H FFR INWD  LAR+++PPF P L S DDVS FD    S+  + SP  +T  +S    F  F+YV+P V   + E  SF
Sbjct:   28 GEYMEQCSSFDFNMDD----CEKFELSENNVNKGTEQIRPECFELLKVLGKGGYGKVFQVRKVSGASSGKIYAMKVLKKAMIVRNAK-DTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNDSGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLSLPPYLTQEARDLLKKLLKRSASSRLGGGPGDAAEVQVHPFFRHINWDDLLARKVEPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENVKEKFSF 403          
BLAST of Ribosomal protein S6 kinase vs. Planmine SMEST
Match: SMESG000068122.1 (SMESG000068122.1)

HSP 1 Score: 823.543 bits (2126), Expect = 0.000e+0
Identity = 441/441 (100.00%), Postives = 441/441 (100.00%), Query Frame = 1
Query:   55 MAIVNASSIEGLKIFKDLKLKCDLINGIELEANDSDNLNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCYWFENFSYVSPQVYLELSENGSFSRQRTRXXXXXXXXXXXXXXXXQTTQFLFEEDFVDLK 1377
            MAIVNASSIEGLKIFKDLKLKCDLINGIELEANDSDNLNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDLLKKLGKGGYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGKHLLKNLLNKNPKARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCYWFENFSYVSPQVYLELSENGSFSRQRTRSGVSHSSSSPGDSHHHQTTQFLFEEDFVDLK
Sbjct:    1 MAIVNASSIEGLKIFKDLKLKCDLINGIELEANDSDNLNKDEYDSTSKSVDICEETVNPPGVKVTSHDFDLLKKLGKGGYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGKHLLKNLLNKNPKARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCYWFENFSYVSPQVYLELSENGSFSRQRTRSGVSHSSSSPGDSHHHQTTQFLFEEDFVDLK 441          
BLAST of Ribosomal protein S6 kinase vs. Planmine SMEST
Match: SMESG000004478.1 (SMESG000004478.1)

HSP 1 Score: 328.946 bits (842), Expect = 3.609e-106
Identity = 192/408 (47.06%), Postives = 269/408 (65.93%), Query Frame = 1
Query:  172 KDEYDSTSKSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVN-GAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVG-GNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRS--INWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCY--WFENFSYVSPQVYLE-LSENGSFSRQRTRXXXXXXXXXXXXXXXXQTTQFLFEEDFVDL 1374
            K E D   +SV+IC+  VNP GVK++  DF +L  +G+GGYG+VFL +K + G    + +AMKV+KKAR+I N+K DT +  +ERNILE + HPFLVKL++AFQ   +L++VL Y +GGELF  LER+ TL E++A FY+AE +LA+GHLH  G+IYRDLK ENV+LD+ GHVKLTDFGLSKE     LT++FCGT+EYMAPEIL+R GHG  VDWWS+G LL+DML G  PF    ++ + I K+ ++ +  P++ +     L++ LL +NPK RL G + DVE+IK H FF++  INW     R + PPF PEL S  DVS FD     +  +++P   + ++     F+ FSYV+P V    L+E  +   + TR   +   S    +  +  + FL E DF+++
Sbjct:   42 KREEDDDIESVEICQSVVNP-GVKISMEDFKVLNVIGRGGYGKVFLVQKSSSGHDENKLYAMKVLKKARIIRNEK-DTAHTKSERNILEMIRHPFLVKLHYAFQNQSNLYIVLTYCSGGELFTYLEREGTLMENQACFYVAEISLAIGHLHKTGIIYRDLKPENVLLDKKGHVKLTDFGLSKE--SVSLTNTFCGTIEYMAPEILKRGGHGKEVDWWSLGTLLFDMLSGGPPFSQECDKQETITKILHSTIAYPKYFSSEVVRLIQGLLKRNPKERL-GCKNDVEDIKNHEFFKTHDINWSDVYHRRMDPPFKPELKSEMDVSCFDSTFTGQQPIMTPDDCNGAHILPDLFQGFSYVAPNVASSVLNEPMTGVSRHTRRRNNSGLSGNAFNGLNANSPFLNENDFIEM 444          
BLAST of Ribosomal protein S6 kinase vs. Planmine SMEST
Match: SMESG000059433.1 (SMESG000059433.1)

HSP 1 Score: 314.309 bits (804), Expect = 2.087e-98
Identity = 174/379 (45.91%), Postives = 244/379 (64.38%), Query Frame = 1
Query:  127 INGIELEANDSDNLNKDEYDSTS-KSVDICEETVNPPGVKVTSHDFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKER--NDD-ELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSE-----PCMISPTTTDDSNCYWFENFSYVSPQV 1236
            +N +E++   SDN    E ++T   +VD+ +E       K+ S  F+LL+ LG+G +G+VFL +KV+    G  +AMKV+KKA L   K  D K    ER+IL A+ HPF+V L++AFQ    ++L+LE+L GG+LF +L ++   TED+ +FYLAE  LAL HLHS+G++YRDLK EN++LD  GH+KLTDFGLSKE   NDD   T SFCGTVEYMAPE++ R+GHG + DWWS G+L+++ML G  PF G +R + +  +  AKL +P+FL+   + LL+ L  +NP  R+G G K +EEIK   FF+ INW   L R++ PPF P+ +  DD S FD    S+     PC  +  T ++     F  FSYV+P V
Sbjct:   15 LNEVEVDEEFSDNAFSQEEEATEVNAVDLVDE-------KLDSSHFELLRVLGQGSFGKVFLVRKVSEPQQGILYAMKVLKKASL---KVQDRKRTKMERDILAAIRHPFIVTLHYAFQNEGKVYLILEFLKGGDLFSRLSKEFMFTEDDVKFYLAELALALDHLHSLGIVYRDLKPENILLDEDGHIKLTDFGLSKESIYNDDANRTFSFCGTVEYMAPEVVNRKGHGTAADWWSFGVLMFEMLTGQLPFQGSSRKETMTMILKAKLSMPQFLSSEAQTLLRVLFKRNPSNRIGFGPKGIEEIKSQPFFQLINWKDLLNRKVTPPFKPKATCLDDTSCFDSQFTSKTPKESPCQPASATANE----IFRGFSYVAPDV 379          

HSP 2 Score: 101.679 bits (252), Expect = 2.103e-22
Identity = 55/163 (33.74%), Postives = 96/163 (58.90%), Query Frame = 1
Query:  415 TERNILEAVN-------HPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYG----HVKLTDFGLSK-ERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPF 867
            T+R+++E V        HP +VKL   +   +++ L++EYL GGEL   +  Q   +E EA   L   T  + +LH+  V++RDLK  N++  +      ++ + DFG +K +R ++ L  + C T  ++APE+L+++G+  + D WS+G+LL+ ML G +PF
Sbjct:  445 TKRDVIEEVEILFRFGAHPHIVKLKEVYVQQNTVSLIMEYLEGGELLTNILSQKYFSEKEASKILYVLTETVHYLHTNLVVHRDLKPSNILYSKKDTNPENLVICDFGFAKQQRAENGLLMTPCYTANFVAPEVLKKQGYDKASDVWSLGVLLFIMLSGKTPF 607          
BLAST of Ribosomal protein S6 kinase vs. Planmine SMEST
Match: SMESG000022857.1 (SMESG000022857.1)

HSP 1 Score: 240.35 bits (612), Expect = 6.507e-73
Identity = 145/344 (42.15%), Postives = 212/344 (61.63%), Query Frame = 1
Query:  256 DFDXXXXXXXXXYGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNIL-EAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDE-LTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKI----PRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEP-------------CMISPTTTDDSNCYWFENFSYVSP 1230
            DFD +K +GKG +G+VFLA++ +    G  FA+KV+ K  +   K+N+ K+ M+ERNIL + + HPFL +LYF+FQT   L+  L+Y+ GGELF  L+++ + ++  A+FY AE   +LG+LHS  +IYRDLK EN++LD  GH+ LTDFGL KE  + E  T +FCGT EY+APE++++  +  SVDWWS G ++Y+ML G  PF   +  Q+ Q++ N+ L +    P  ++D    +L  L+ KNPK RL G + D +EIK H FF  I+W   + +++KPPF+P++SS  D+   D     EP               +S    DDS    F  FSYV P
Sbjct:  142 DFDFIKTIGKGSFGKVFLARRKSD---GAVFAVKVLYKENI--KKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQGHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISD----ILVKLIRKNPKERL-GYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDS----FVGFSYVPP 471          
BLAST of Ribosomal protein S6 kinase vs. Planmine SMEST
Match: SMESG000077752.1 (SMESG000077752.1)

HSP 1 Score: 225.328 bits (573), Expect = 1.543e-68
Identity = 117/308 (37.99%), Postives = 187/308 (60.71%), Query Frame = 1
Query:  292 YGQVFLAKKVNGAMAGEYFAMKVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLVLEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKSENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGPSVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGXXXXXXXXXXXXXARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPELSSRDDVSLFDKNIVSEPCMISPTTTDDSNCYWFENF 1215
            +G+V + ++      G Y+A+K++    ++  K+   ++ ++E+ ILE ++HPF+V LY+       L+++LEY  GGELF  L       +  A FY AE   A+ +LH + ++YRDLK EN++LD+ GH+K+TDFG +K   D   T++ CGT EY+APEI+Q +G+  +VDWW++GIL+Y+ML GN PF   N  Q+ QK+ N+K + P+ +    K L+K LL  +   RLG  +   E++ RH +F+SI+W++ L R+++PP IP ++   D   +D     +   ISP TT       F NF
Sbjct:   59 FGRVMVVREKE---TGSYYALKIMIIEDILKMKQ--VEHVLSEKQILEQISHPFIVDLYWTKSDIKFLYMLLEYACGGELFTYLRNMAKFPDSTAMFYSAEIVSAISYLHGLRIVYRDLKPENLLLDQKGHIKITDFGFAKFLTDR--TYTMCGTPEYLAPEIIQGKGYNKAVDWWALGILIYEMLSGNPPFSDDNPMQIYQKILNSKFEFPKQIDSIAKDLIKKLLISDRMRRLGNMKGGSEDVMRHRWFKSIDWNELLKRKIEPPIIPNITHVGDTRCYDNYDEQDWRKISPATTKSQEI--FRNF 357          
The following BLAST results are available for this feature:
BLAST of Ribosomal protein S6 kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPS6KB12.084e-11553.50ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
RPS6KB12.498e-11553.50ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
RPS6KB11.444e-11453.50ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
RPS6KB25.939e-11050.84ribosomal protein S6 kinase B2 [Source:HGNC Symbol... [more]
RPS6KB12.235e-10153.80ribosomal protein S6 kinase B1 [Source:HGNC Symbol... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsks-11.774e-11048.77Ribosomal protein S6 kinase beta [Source:UniProtK... [more]
rskn-11.415e-9747.92Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-13.743e-9747.07Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-15.161e-9748.46Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
rskn-16.293e-9747.07Putative ribosomal protein S6 kinase alpha-1 [Sou... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
S6k4.033e-12050.40gene:FBgn0283472 transcript:FBtr0077114[more]
S6k4.033e-12050.40gene:FBgn0283472 transcript:FBtr0333264[more]
S6kII6.848e-8746.15gene:FBgn0262866 transcript:FBtr0333715[more]
S6kII6.848e-8746.15gene:FBgn0262866 transcript:FBtr0077360[more]
Akt17.141e-7843.37gene:FBgn0010379 transcript:FBtr0083226[more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps6kb1b1.953e-11652.78ribosomal protein S6 kinase b, polypeptide 1b [Sou... [more]
rps6kb1a1.215e-11451.61ribosomal protein S6 kinase b, polypeptide 1a [Sou... [more]
BX000486.12.809e-11453.22ribosomal protein S6 kinase b, polypeptide 1a [Sou... [more]
rps6kb1b3.770e-10147.38ribosomal protein S6 kinase b, polypeptide 1b [Sou... [more]
rps6ka25.318e-9748.31ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l3hypdh2.662e-11550.76L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh2.212e-11453.22L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh3.629e-11453.22L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh6.413e-11453.22L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
l3hypdh1.097e-11353.22L-3-hydroxyproline dehydratase (trans-) [Source:Xe... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rps6kb19.806e-11553.50ribosomal protein S6 kinase, polypeptide 1 [Source... [more]
Rps6kb21.765e-11151.12ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
Rps6kb21.765e-11151.12ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
Rps6kb25.625e-11051.15ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
Rps6kb25.625e-11051.15ribosomal protein S6 kinase, polypeptide 2 [Source... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BSK8|KS6B1_MOUSE6.859e-11453.50Ribosomal protein S6 kinase beta-1 OS=Mus musculus... [more]
sp|P23443|KS6B1_HUMAN6.933e-11453.50Ribosomal protein S6 kinase beta-1 OS=Homo sapiens... [more]
sp|P67999|KS6B1_RAT7.161e-11453.50Ribosomal protein S6 kinase beta-1 OS=Rattus norve... [more]
sp|P67998|KS6B1_RABIT7.639e-11453.50Ribosomal protein S6 kinase beta-1 OS=Oryctolagus ... [more]
sp|Q6TJY3|KS6B1_BOVIN3.862e-11353.22Ribosomal protein S6 kinase beta-1 OS=Bos taurus O... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068YKN81.570e-12656.32Non-specific serine/threonine protein kinase OS=Ec... [more]
A0A068WC562.316e-12656.32Non-specific serine/threonine protein kinase OS=Ec... [more]
A0A0R3TRD34.661e-12656.32Non-specific serine/threonine protein kinase OS=Ro... [more]
A0A564YF521.106e-12556.32Non-specific serine/threonine protein kinase OS=Hy... [more]
A0A0V0J6H01.567e-12354.33Non-specific serine/threonine protein kinase OS=Sc... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps6kb1b1.682e-11652.16ribosomal protein S6 kinase B1 [Source:NCBI gene;A... [more]
rps6kb1b2.547e-11652.78ribosomal protein S6 kinase B1 [Source:NCBI gene;A... [more]
ENSAMXT00000004157.24.093e-11349.35ribosomal protein S6 kinase B2 [Source:NCBI gene;A... [more]
rps6kal6.100e-9748.17ribosomal protein S6 kinase a, like [Source:NCBI g... [more]
rps6ka26.122e-9747.53ribosomal protein S6 kinase A2 [Source:NCBI gene;A... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008480.11.665e-7639.77pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
ENSPMAT00000006766.11.323e-7242.22pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
ENSPMAT00000001814.14.108e-6237.31pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
PRKCD2.880e-6141.67protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
PRKCD1.267e-6041.97protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK18.903e-6738.87cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK23.068e-6636.50cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK33.884e-6538.21cAMP-dependent protein kinase catalytic subunit; p... [more]
SCH92.948e-6344.33AGC family protein kinase; functional ortholog of ... [more]
PKC11.237e-5937.69Protein serine/threonine kinase; essential for cel... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO411661.985e-11648.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318951.376e-10048.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378005.124e-8240.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391638.301e-7643.57Ribosomal protein S6 kinase [Source:UniProtKB/TrE... [more]
EDO355854.001e-6840.36Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps6kb1b2.864e-11952.14ribosomal protein S6 kinase beta-1-like [Source:NC... [more]
rps6kb1b3.087e-11753.33ribosomal protein S6 kinase beta-1-like [Source:NC... [more]
rps6kb1a3.266e-11752.55ribosomal protein S6 kinase beta-1 [Source:NCBI ge... [more]
rps6kb1a1.010e-11651.71ribosomal protein S6 kinase beta-1 [Source:NCBI ge... [more]
rps6kb1a2.698e-11651.71ribosomal protein S6 kinase beta-1 [Source:NCBI ge... [more]
back to top
BLAST of Ribosomal protein S6 kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068122.10.000e+0100.00SMESG000068122.1[more]
SMESG000004478.13.609e-10647.06SMESG000004478.1[more]
SMESG000059433.12.087e-9845.91SMESG000059433.1[more]
SMESG000022857.16.507e-7342.15SMESG000022857.1[more]
SMESG000077752.11.543e-6837.99SMESG000077752.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031106 ID=SMED30031106|Name=Ribosomal protein S6 kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1617bp
TATTGCTTGCATTGTTAGATGCGTTTGAAAAAAATAGTTTAAGTTTTACT
ATCAATGGCAATAGTTAATGCTTCTTCAATCGAAGGTTTAAAGATTTTTA
AAGATCTTAAATTAAAATGTGATTTAATCAATGGAATTGAACTAGAAGCT
AATGACTCCGATAACTTAAATAAAGACGAATATGATTCAACCTCAAAATC
AGTAGATATATGTGAAGAAACAGTTAATCCTCCTGGAGTAAAAGTTACAT
CTCACGATTTTGATTTACTAAAAAAACTTGGTAAAGGTGGTTATGGGCAA
GTATTTTTAGCGAAAAAAGTCAATGGGGCAATGGCTGGTGAATATTTTGC
TATGAAAGTTGTCAAAAAGGCTCGTTTGATTACAAATAAAAAAAACGACA
CTAAATATGCAATGACTGAAAGAAACATACTGGAAGCAGTCAATCATCCG
TTTCTTGTGAAATTGTATTTTGCGTTTCAAACAAACCACAGCCTTTTTTT
AGTGTTAGAGTATCTTGCTGGAGGCGAACTGTTTATGCAGCTTGAAAGGC
AGCATACATTAACAGAAGATGAAGCTAGATTTTACCTAGCTGAAACAACT
CTAGCATTGGGACATCTGCATTCCATTGGTGTTATTTATAGAGATCTGAA
ATCAGAAAATGTGATGCTCGATAGGTATGGCCATGTAAAGCTGACTGATT
TTGGGTTGTCTAAAGAAAGAAACGATGATGAATTGACGCATTCGTTTTGT
GGAACTGTGGAATATATGGCTCCTGAAATTCTTCAACGCCGAGGCCATGG
CCCGAGTGTTGATTGGTGGAGTATGGGCATCCTGTTATACGATATGCTTA
TTGGGAACTCGCCATTTGTCGGTGGAAATCGTAGTCAAGTTATCCAGAAA
GTTACCAACGCAAAATTAAAGATACCGAGATTTCTCACAGATTCTGGCAA
ACACTTACTGAAAAATTTATTGAATAAAAATCCAAAAGCTAGATTAGGAG
GAGGGGAAAAAGATGTTGAAGAAATTAAAAGACATTTTTTCTTTAGATCT
ATCAATTGGGATAAAGCACTTGCAAGAGAATTGAAGCCTCCTTTCATTCC
CGAATTATCGAGTCGGGATGATGTCAGTTTGTTTGATAAAAACATCGTGT
CAGAACCGTGCATGATTAGTCCAACGACAACTGATGATTCTAATTGTTAC
TGGTTTGAAAATTTCAGTTATGTAAGTCCTCAAGTATATTTGGAATTATC
GGAAAACGGAAGTTTTTCTCGACAACGAACTAGAAGTGGAGTTTCACATT
CTAGCAGTTCTCCTGGAGATTCACATCATCATCAAACGACTCAATTTTTG
TTTGAAGAAGATTTTGTAGATTTGAAATGACCATCTATTTATTGTCGGAT
ATTGTCGAAACTAAATTTAAATCAATTCTTGGATTTTAACTTTTTTGAAA
ATTTTACAATTCTCATATCTTAAATTCCATTTAAAATCATAATTCACTAA
AAAGAAACCCAAAGGTTGTTGGCGAAATTTCCACCTATTGCAACTCAAAT
CATTATCATAGTTTTACAATTTGAGGCATCTACACTGTTCCAGGAAAAAT
AGGTTAAATGCACATCG
back to top

protein sequence of SMED30031106-orf-1

>SMED30031106-orf-1 ID=SMED30031106-orf-1|Name=SMED30031106-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=442bp
MAIVNASSIEGLKIFKDLKLKCDLINGIELEANDSDNLNKDEYDSTSKSV
DICEETVNPPGVKVTSHDFDLLKKLGKGGYGQVFLAKKVNGAMAGEYFAM
KVVKKARLITNKKNDTKYAMTERNILEAVNHPFLVKLYFAFQTNHSLFLV
LEYLAGGELFMQLERQHTLTEDEARFYLAETTLALGHLHSIGVIYRDLKS
ENVMLDRYGHVKLTDFGLSKERNDDELTHSFCGTVEYMAPEILQRRGHGP
SVDWWSMGILLYDMLIGNSPFVGGNRSQVIQKVTNAKLKIPRFLTDSGKH
LLKNLLNKNPKARLGGGEKDVEEIKRHFFFRSINWDKALARELKPPFIPE
LSSRDDVSLFDKNIVSEPCMISPTTTDDSNCYWFENFSYVSPQVYLELSE
NGSFSRQRTRSGVSHSSSSPGDSHHHQTTQFLFEEDFVDLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000961AGC-kinase_C
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007165signal transduction
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 331..391
e-value: 4.4E-11
score: 52.8
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 331..399
score: 15.039
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 69..330
e-value: 3.8E-96
score: 335.4
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 70..330
e-value: 1.4E-67
score: 227.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 69..330
score: 50.379
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 158..351
e-value: 8.0E-118
score: 394.9
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 30..314
e-value: 1.1E-30
score: 104.4
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 67..367
e-value: 8.0E-118
score: 394.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 406..427
NoneNo IPR availablePANTHERPTHR24351:SF166RIBOSOMAL PROTEIN S6 KINASEcoord: 35..396
NoneNo IPR availablePANTHERPTHR24351RIBOSOMAL PROTEIN S6 KINASEcoord: 35..396
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 75..105
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 193..205
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 67..404