SMED30031100

Overview
NameSMED30031100
Smed IDSMED30031100
Length (bp)357
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Alignments
SMED30031100 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001516:34361..34820 +1742
v31.001516:34068..34650 +863
Homology
BLAST of SMED30031100 vs. Ensembl Human
Match: CNN1 (calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155])

HSP 1 Score: 73.1738 bits (178), Expect = 2.270e-16
Identity = 48/103 (46.60%), Postives = 64/103 (62.14%), Query Frame = 3
Query:   45 KGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            + +IGLQ G+NKFASQ GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNK ASQ GM++
Sbjct:   17 RNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLN--VSLQMGSNKGASQRGMTV 116          

HSP 2 Score: 50.0618 bits (118), Expect = 8.693e-8
Identity = 29/62 (46.77%), Postives = 39/62 (62.90%), Query Frame = 3
Query:  162 GKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            G+N+IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NK ASQ GM+
Sbjct:   16 GRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMT 76          
BLAST of SMED30031100 vs. Ensembl Human
Match: CNN1 (calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155])

HSP 1 Score: 72.7886 bits (177), Expect = 3.899e-16
Identity = 48/103 (46.60%), Postives = 64/103 (62.14%), Query Frame = 3
Query:   45 KGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            + +IGLQ G+NKFASQ GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNK ASQ GM++
Sbjct:  111 RNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLN--VSLQMGSNKGASQRGMTV 210          

HSP 2 Score: 49.6766 bits (117), Expect = 1.334e-7
Identity = 33/86 (38.37%), Postives = 47/86 (54.65%), Query Frame = 3
Query:  126 NDVSTGVEISD------------SGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            N V+ GV+ ++             G+N+IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NK ASQ GM+
Sbjct:   86 NKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMT 170          
BLAST of SMED30031100 vs. Ensembl Human
Match: CNN1 (calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155])

HSP 1 Score: 72.7886 bits (177), Expect = 3.899e-16
Identity = 48/103 (46.60%), Postives = 64/103 (62.14%), Query Frame = 3
Query:   45 KGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            + +IGLQ G+NKFASQ GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNK ASQ GM++
Sbjct:  111 RNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLN--VSLQMGSNKGASQRGMTV 210          

HSP 2 Score: 49.6766 bits (117), Expect = 1.334e-7
Identity = 33/86 (38.37%), Postives = 47/86 (54.65%), Query Frame = 3
Query:  126 NDVSTGVEISD------------SGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            N V+ GV+ ++             G+N+IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NK ASQ GM+
Sbjct:   86 NKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMT 170          
BLAST of SMED30031100 vs. Ensembl Human
Match: CNN1 (calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155])

HSP 1 Score: 72.4034 bits (176), Expect = 8.514e-16
Identity = 48/103 (46.60%), Postives = 64/103 (62.14%), Query Frame = 3
Query:   45 KGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            + +IGLQ G+NKFASQ GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNK ASQ GM++
Sbjct:  161 RNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLN--VSLQMGSNKGASQRGMTV 260          

HSP 2 Score: 49.2914 bits (116), Expect = 1.650e-7
Identity = 33/86 (38.37%), Postives = 47/86 (54.65%), Query Frame = 3
Query:  126 NDVSTGVEISD------------SGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            N V+ GV+ ++             G+N+IGLQ G+NK A+Q GM   GT+R + D   G +     +  I LQ G+NK ASQ GM+
Sbjct:  136 NKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMT 220          
BLAST of SMED30031100 vs. Ensembl Human
Match: CNN3 (calponin 3 [Source:HGNC Symbol;Acc:HGNC:2157])

HSP 1 Score: 69.707 bits (169), Expect = 8.799e-15
Identity = 50/113 (44.25%), Postives = 66/113 (58.41%), Query Frame = 3
Query:   18 RCDE-MCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            R DE    + + VIGLQ G+NK ASQ GM   GT+R + D     +     +  I LQ G+NKGA+QAGM   GT+R I D    ++  D+  + I LQ G+NK ASQ GMS+
Sbjct:  105 RFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTD-KPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN--STISLQMGTNKVASQKGMSV 214          
BLAST of SMED30031100 vs. Ensembl Celegans
Match: clik-1 (CaLponIn-liKe proteins [Source:UniProtKB/TrEMBL;Acc:H2L0M6])

HSP 1 Score: 60.8474 bits (146), Expect = 6.355e-12
Identity = 45/124 (36.29%), Postives = 68/124 (54.84%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGV--------EISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            ++A+I  ++   + KG   LQ+G+NKFASQ G    G  R +N  + G         E + +   ++ LQ+G+NK A+QAGM  IG  R + DV    +     +  I LQ G+NKFA+Q GM+
Sbjct:  135 NLAEITDEKKIANLKGSTWLQSGTNKFASQKGQSGFGAVRDVNYKTKGTGGASEVPEEKARASDGIVPLQSGTNKLASQAGMTGIGMPRIV-DVRRTNDQDRDSQGFIHLQMGTNKFANQAGMT 257          

HSP 2 Score: 58.151 bits (139), Expect = 7.294e-11
Identity = 48/128 (37.50%), Postives = 69/128 (53.91%), Query Frame = 3
Query:   15 IRCDEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQR-FINDVSTG--VEISDSGK--NVIG---LQAGSNKGATQAGMR-IGTQRFINDVSAGV--------EISDSGKNVIGLQAGSNKFASQTGMS 344
            I   E    ++G+I +QAGSNK+ASQ GM   G  R  I+ V +    EI+D  K  N+ G   LQ+G+NK A+Q G    G  R +N  + G         E + +   ++ LQ+G+NK ASQ GM+
Sbjct:   90 IHTKEKLMRSEGIIPIQAGSNKYASQKGMTGFGVPRDVIDKVKSDNLAEITDEKKIANLKGSTWLQSGTNKFASQKGQSGFGAVRDVNYKTKGTGGASEVPEEKARASDGIVPLQSGTNKLASQAGMT 217          
BLAST of SMED30031100 vs. Ensembl Celegans
Match: clik-1 (CaLponIn-liKe proteins [Source:UniProtKB/TrEMBL;Acc:H2L0M6])

HSP 1 Score: 60.8474 bits (146), Expect = 6.355e-12
Identity = 45/124 (36.29%), Postives = 68/124 (54.84%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGV--------EISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            ++A+I  ++   + KG   LQ+G+NKFASQ G    G  R +N  + G         E + +   ++ LQ+G+NK A+QAGM  IG  R + DV    +     +  I LQ G+NKFA+Q GM+
Sbjct:  135 NLAEITDEKKIANLKGSTWLQSGTNKFASQKGQSGFGAVRDVNYKTKGTGGASEVPEEKARASDGIVPLQSGTNKLASQAGMTGIGMPRIV-DVRRTNDQDRDSQGFIHLQMGTNKFANQAGMT 257          

HSP 2 Score: 58.151 bits (139), Expect = 7.294e-11
Identity = 48/128 (37.50%), Postives = 69/128 (53.91%), Query Frame = 3
Query:   15 IRCDEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQR-FINDVSTG--VEISDSGK--NVIG---LQAGSNKGATQAGMR-IGTQRFINDVSAGV--------EISDSGKNVIGLQAGSNKFASQTGMS 344
            I   E    ++G+I +QAGSNK+ASQ GM   G  R  I+ V +    EI+D  K  N+ G   LQ+G+NK A+Q G    G  R +N  + G         E + +   ++ LQ+G+NK ASQ GM+
Sbjct:   90 IHTKEKLMRSEGIIPIQAGSNKYASQKGMTGFGVPRDVIDKVKSDNLAEITDEKKIANLKGSTWLQSGTNKFASQKGQSGFGAVRDVNYKTKGTGGASEVPEEKARASDGIVPLQSGTNKLASQAGMT 217          
BLAST of SMED30031100 vs. Ensembl Celegans
Match: unc-87 (pep chromosome:WBcel235:I:6761228:6767797:-1 gene:WBGene00006819.1 transcript:F08B6.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-87)

HSP 1 Score: 53.9138 bits (128), Expect = 2.041e-9
Identity = 39/123 (31.71%), Postives = 62/123 (50.41%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGM------RIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGM------RIGTQRFIN----DVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            +E    ++G++ LQAG+NK+ SQ GM      R  T + ++      +     ++ I LQ+G+NK A+Q GM      R  T + ++    D S    I  +    I  Q GSN++ASQ GM+
Sbjct:  137 EEKIRMSEGIVRLQAGTNKYDSQKGMTGFGTGRRETTKMVDSKHPEYDHEKPDQSEIPLQSGTNKFASQKGMTGFGTARRETTKMVDSNHPDYSHECSIDQT---TIPSQMGSNQYASQKGMT 256          

HSP 2 Score: 53.1434 bits (126), Expect = 3.874e-9
Identity = 37/127 (29.13%), Postives = 63/127 (49.61%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGM----------RIGTQRFINDVSTGVEISDS----GKNVIGLQAGSNKGATQAGM------RIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            +++ +   G + LQ+G+NK+ SQ GM          R G  R   + +   E+ +      + ++ LQAG+NK  +Q GM      R  T + ++      +     ++ I LQ+G+NKFASQ GM+
Sbjct:   84 EDIANRTHGEVRLQSGTNKYCSQRGMTGFGSGRDVCREGV-RVAQNPADLAELPEEKIRMSEGIVRLQAGTNKYDSQKGMTGFGTGRRETTKMVDSKHPEYDHEKPDQSEIPLQSGTNKFASQKGMT 209          

HSP 3 Score: 50.0618 bits (118), Expect = 4.602e-8
Identity = 41/108 (37.96%), Postives = 58/108 (53.70%), Query Frame = 3
Query:   54 IGLQAGSNKFASQTGM------RIGTQRFIN----DVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRF-INDVSAGVEISDSGKNVIGLQAGSNKFASQTGM 341
            I LQ+G+NKFASQ GM      R  T + ++    D S    I  +    I  Q GSN+ A+Q GM   G  R+ + D S   +   S + ++ LQ+G+N+FASQ GM
Sbjct:  193 IPLQSGTNKFASQKGMTGFGTARRETTKMVDSNHPDYSHECSIDQT---TIPSQMGSNQYASQKGMTGFGQPRWEVLDPSISWQNRKS-QGMVRLQSGTNRFASQAGM 296          
BLAST of SMED30031100 vs. Ensembl Celegans
Match: unc-87 (pep chromosome:WBcel235:I:6761228:6765611:-1 gene:WBGene00006819.1 transcript:F08B6.4a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-87)

HSP 1 Score: 49.2914 bits (116), Expect = 9.398e-8
Identity = 37/128 (28.91%), Postives = 64/128 (50.00%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDS--------------GKNVIGLQAGSNKGATQAGM------RIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            +++ +   G + LQ+G+NK+ SQ GM   G+ R +     GV ++ +               + ++ LQAG+NK  +Q GM      R  T + ++      +     ++ I LQ+G+NKFASQ GM+
Sbjct:  275 EDIANRTHGEVRLQSGTNKYCSQRGMTGFGSGRDV--CREGVRVAQNPADLAELPEEKIRMSEGIVRLQAGTNKYDSQKGMTGFGTGRRETTKMVDSKHPEYDHEKPDQSEIPLQSGTNKFASQKGMT 400          

HSP 2 Score: 48.9062 bits (115), Expect = 1.269e-7
Identity = 39/123 (31.71%), Postives = 62/123 (50.41%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGM------RIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGM------RIGTQRFIN----DVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            +E    ++G++ LQAG+NK+ SQ GM      R  T + ++      +     ++ I LQ+G+NK A+Q GM      R  T + ++    D S    I    +  I  Q GSN++ASQ GM+
Sbjct:  328 EEKIRMSEGIVRLQAGTNKYDSQKGMTGFGTGRRETTKMVDSKHPEYDHEKPDQSEIPLQSGTNKFASQKGMTGFGTARRETTKMVDSNHPDYSHECSID---QTTIPSQMGSNQYASQKGMT 447          

HSP 3 Score: 45.8246 bits (107), Expect = 1.224e-6
Identity = 41/108 (37.96%), Postives = 58/108 (53.70%), Query Frame = 3
Query:   54 IGLQAGSNKFASQTGM------RIGTQRFIN----DVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRF-INDVSAGVEISDSGKNVIGLQAGSNKFASQTGM 341
            I LQ+G+NKFASQ GM      R  T + ++    D S    I    +  I  Q GSN+ A+Q GM   G  R+ + D S   +   S + ++ LQ+G+N+FASQ GM
Sbjct:  384 IPLQSGTNKFASQKGMTGFGTARRETTKMVDSNHPDYSHECSID---QTTIPSQMGSNQYASQKGMTGFGQPRWEVLDPSISWQNRKS-QGMVRLQSGTNRFASQAGM 487          
BLAST of SMED30031100 vs. Ensembl Celegans
Match: unc-87 (pep chromosome:WBcel235:I:6761567:6765734:-1 gene:WBGene00006819.1 transcript:F08B6.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-87)

HSP 1 Score: 49.2914 bits (116), Expect = 9.398e-8
Identity = 37/128 (28.91%), Postives = 64/128 (50.00%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDS--------------GKNVIGLQAGSNKGATQAGM------RIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            +++ +   G + LQ+G+NK+ SQ GM   G+ R +     GV ++ +               + ++ LQAG+NK  +Q GM      R  T + ++      +     ++ I LQ+G+NKFASQ GM+
Sbjct:  275 EDIANRTHGEVRLQSGTNKYCSQRGMTGFGSGRDV--CREGVRVAQNPADLAELPEEKIRMSEGIVRLQAGTNKYDSQKGMTGFGTGRRETTKMVDSKHPEYDHEKPDQSEIPLQSGTNKFASQKGMT 400          

HSP 2 Score: 48.9062 bits (115), Expect = 1.269e-7
Identity = 39/123 (31.71%), Postives = 62/123 (50.41%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGM------RIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGM------RIGTQRFIN----DVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            +E    ++G++ LQAG+NK+ SQ GM      R  T + ++      +     ++ I LQ+G+NK A+Q GM      R  T + ++    D S    I    +  I  Q GSN++ASQ GM+
Sbjct:  328 EEKIRMSEGIVRLQAGTNKYDSQKGMTGFGTGRRETTKMVDSKHPEYDHEKPDQSEIPLQSGTNKFASQKGMTGFGTARRETTKMVDSNHPDYSHECSID---QTTIPSQMGSNQYASQKGMT 447          

HSP 3 Score: 45.8246 bits (107), Expect = 1.224e-6
Identity = 41/108 (37.96%), Postives = 58/108 (53.70%), Query Frame = 3
Query:   54 IGLQAGSNKFASQTGM------RIGTQRFIN----DVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRF-INDVSAGVEISDSGKNVIGLQAGSNKFASQTGM 341
            I LQ+G+NKFASQ GM      R  T + ++    D S    I    +  I  Q GSN+ A+Q GM   G  R+ + D S   +   S + ++ LQ+G+N+FASQ GM
Sbjct:  384 IPLQSGTNKFASQKGMTGFGTARRETTKMVDSNHPDYSHECSID---QTTIPSQMGSNQYASQKGMTGFGQPRWEVLDPSISWQNRKS-QGMVRLQSGTNRFASQAGM 487          
BLAST of SMED30031100 vs. Ensembl Zebrafish
Match: cnn1b (calponin 1, basic, smooth muscle, b [Source:ZFIN;Acc:ZDB-GENE-091118-54])

HSP 1 Score: 83.9593 bits (206), Expect = 3.415e-20
Identity = 50/109 (45.87%), Postives = 72/109 (66.06%), Query Frame = 3
Query:   27 EMCDSAKGVIGLQAGSNKFASQTGM-RIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            E     + +IGLQ G+NKFASQ GM   GT+R + D  TG+E +   ++ I LQ G+NKGA+QAGM   GT+R I +    +E+ D+  +++ LQ G+NK ASQTGM++
Sbjct:  156 EKLKEGRNIIGLQMGTNKFASQKGMTSYGTRRHLYDPKTGME-NPLDQSTISLQMGTNKGASQAGMTAPGTKRQIFEKKLDMEMCDT--SIVSLQMGTNKVASQTGMTV 261          
BLAST of SMED30031100 vs. Ensembl Zebrafish
Match: cnn3a (calponin 3, acidic a [Source:ZFIN;Acc:ZDB-GENE-030131-5130])

HSP 1 Score: 78.1814 bits (191), Expect = 5.284e-18
Identity = 52/110 (47.27%), Postives = 67/110 (60.91%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            DE   + + VIGLQ G+NK ASQ GM   GT+R + D  T  E     +  I LQ G+NKGA+QAGM   GT+R I D  A ++  D+  + I LQ G+NK ASQ GMS+
Sbjct:  154 DEKMKAGQCVIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTE-KPYDQTTISLQMGTNKGASQAGMSAPGTRRDIYDQKAALQPMDN--STISLQMGTNKVASQKGMSV 260          
BLAST of SMED30031100 vs. Ensembl Zebrafish
Match: cnn3b (calponin 3, acidic b [Source:ZFIN;Acc:ZDB-GENE-050522-263])

HSP 1 Score: 74.3294 bits (181), Expect = 1.264e-16
Identity = 51/110 (46.36%), Postives = 66/110 (60.00%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            DE   + + VIGLQ G+NK ASQ GM   GT+R + D  T  +     +  I LQ G+NKGA+QAGM   GT+R I D    V+  D+  + I LQ G+NK ASQ GMS+
Sbjct:  113 DEKMKAGQCVIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQAD-KPFDQTTISLQMGTNKGASQAGMSAPGTRRDIFDQKVAVQPLDN--STISLQMGTNKVASQKGMSV 219          
BLAST of SMED30031100 vs. Ensembl Zebrafish
Match: cnn3b (calponin 3, acidic b [Source:ZFIN;Acc:ZDB-GENE-050522-263])

HSP 1 Score: 74.3294 bits (181), Expect = 1.628e-16
Identity = 51/110 (46.36%), Postives = 66/110 (60.00%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            DE   + + VIGLQ G+NK ASQ GM   GT+R + D  T  +     +  I LQ G+NKGA+QAGM   GT+R I D    V+  D+  + I LQ G+NK ASQ GMS+
Sbjct:  154 DEKMKAGQCVIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQAD-KPFDQTTISLQMGTNKGASQAGMSAPGTRRDIFDQKVAVQPLDN--STISLQMGTNKVASQKGMSV 260          
BLAST of SMED30031100 vs. Ensembl Zebrafish
Match: cnn2 (calponin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-542])

HSP 1 Score: 66.2402 bits (160), Expect = 1.066e-13
Identity = 45/111 (40.54%), Postives = 66/111 (59.46%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMG 350
            DE   + + VIGLQ G+NK ASQ GM   GT+R + D  + + +     + I LQ G+NKGA+QAGM   GT+R I D   G +  D+  + + LQ G ++ A+Q+G + G
Sbjct:  155 DEKMKAGQCVIGLQMGTNKCASQAGMNAYGTRRHLYDPKSHI-LPPMDHSTISLQMGTNKGASQAGMTAPGTRRAIYDQKTGTDKCDN--STMSLQMGYSQGANQSGQNFG 262          

HSP 2 Score: 47.3654 bits (111), Expect = 5.422e-7
Identity = 32/85 (37.65%), Postives = 44/85 (51.76%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDV 254
            H+ D +   +       I LQ G+NK ASQ GM   GT+R I D  TG +  D+  + + LQ G ++GA Q+G   G  R I D 
Sbjct:  188 HLYDPKSHILPPMDHSTISLQMGTNKGASQAGMTAPGTRRAIYDQKTGTDKCDN--STMSLQMGYSQGANQSGQNFGLGRQIYDA 270          
BLAST of SMED30031100 vs. Ensembl Xenopus
Match: tfdp1 (transcription factor Dp-1 [Source:Xenbase;Acc:XB-GENE-1219073])

HSP 1 Score: 73.559 bits (179), Expect = 2.530e-16
Identity = 50/110 (45.45%), Postives = 66/110 (60.00%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            DE   + + VIGLQ G+NK ASQ GM   GT+R + D     +     +  I LQ G+NKGA+QAGM   GT+R I D  A ++  D+  + I LQ G+NK ASQ GMS+
Sbjct:   89 DEKMKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTD-KPFDQTTISLQMGTNKGASQAGMPAPGTRRDIYDQKAILQPVDN--STISLQMGTNKVASQKGMSV 195          
BLAST of SMED30031100 vs. Ensembl Xenopus
Match: tfdp1 (transcription factor Dp-1 [Source:Xenbase;Acc:XB-GENE-1219073])

HSP 1 Score: 73.1738 bits (178), Expect = 6.420e-16
Identity = 50/110 (45.45%), Postives = 66/110 (60.00%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            DE   + + VIGLQ G+NK ASQ GM   GT+R + D     +     +  I LQ G+NKGA+QAGM   GT+R I D  A ++  D+  + I LQ G+NK ASQ GMS+
Sbjct:  154 DEKMKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTD-KPFDQTTISLQMGTNKGASQAGMPAPGTRRDIYDQKAILQPVDN--STISLQMGTNKVASQKGMSV 260          

HSP 2 Score: 47.7506 bits (112), Expect = 5.690e-7
Identity = 31/69 (44.93%), Postives = 41/69 (59.42%), Query Frame = 3
Query:  141 GVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            G E   +G++VIGLQ G+NK A+QAGM   GT+R + D     +     +  I LQ G+NK ASQ GM 
Sbjct:  153 GDEKMKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTD-KPFDQTTISLQMGTNKGASQAGMP 220          
BLAST of SMED30031100 vs. Ensembl Xenopus
Match: slc5a8.1 (solute carrier family 5 member 8, gene 1 [Source:Xenbase;Acc:XB-GENE-479634])

HSP 1 Score: 70.8626 bits (172), Expect = 3.050e-15
Identity = 47/103 (45.63%), Postives = 63/103 (61.17%), Query Frame = 3
Query:   45 KGVIGLQAGSNKFASQTGM-RIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            + +IGLQ G+NK+ASQ GM   GT+R + D     +     +  I LQ G+NKGA+Q+GM   GT+R I D   G+E  D+    I LQ GSNK ASQ GM++
Sbjct:  160 RNIIGLQMGTNKYASQKGMTSYGTRRHLYDPKLAND-QPLDQATISLQMGTNKGASQSGMTAPGTKRQIFDQKLGMEHCDT--QTISLQMGSNKGASQQGMTV 259          

HSP 2 Score: 47.3654 bits (111), Expect = 7.192e-7
Identity = 30/64 (46.88%), Postives = 40/64 (62.50%), Query Frame = 3
Query:  159 SGKNVIGLQAGSNKGATQAGM-RIGTQRFINDVS-AGVEISDSGKNVIGLQAGSNKFASQTGMS 344
             G+N+IGLQ G+NK A+Q GM   GT+R + D   A  +  D     I LQ G+NK ASQ+GM+
Sbjct:  158 EGRNIIGLQMGTNKYASQKGMTSYGTRRHLYDPKLANDQPLDQA--TISLQMGTNKGASQSGMT 219          
BLAST of SMED30031100 vs. Ensembl Xenopus
Match: cnn1 (calponin 1, basic, smooth muscle [Source:NCBI gene;Acc:407907])

HSP 1 Score: 64.3142 bits (155), Expect = 7.775e-13
Identity = 44/102 (43.14%), Postives = 58/102 (56.86%), Query Frame = 3
Query:   51 VIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMG 350
            VIGLQ G+NK ASQ+GM   GT+R + D    + +     + I LQ GSNKGA+Q GM   GT+R I D   G E  D+    + LQ G  + A+Q+G   G
Sbjct:  165 VIGLQMGTNKCASQSGMTAYGTRRHLYDPKNTI-LPPMDHSTISLQMGSNKGASQVGMTAPGTRRHIYDTKLGTEKCDNSS--MSLQMGYTQGANQSGQIFG 263          

HSP 2 Score: 47.3654 bits (111), Expect = 9.251e-7
Identity = 29/63 (46.03%), Postives = 39/63 (61.90%), Query Frame = 3
Query:  159 SGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            +G  VIGLQ G+NK A+Q+GM   GT+R + D    + +     + I LQ GSNK ASQ GM+
Sbjct:  161 AGHCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNTI-LPPMDHSTISLQMGSNKGASQVGMT 222          
BLAST of SMED30031100 vs. Ensembl Mouse
Match: Cnn1 (calponin 1 [Source:MGI Symbol;Acc:MGI:104979])

HSP 1 Score: 72.7886 bits (177), Expect = 1.903e-16
Identity = 49/110 (44.55%), Postives = 65/110 (59.09%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
             E     + +IGLQ G+NKFASQ GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNK ASQ GM++
Sbjct:  104 PEKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLN--VSLQMGSNKGASQRGMTV 210          
BLAST of SMED30031100 vs. Ensembl Mouse
Match: Cnn1 (calponin 1 [Source:MGI Symbol;Acc:MGI:104979])

HSP 1 Score: 73.559 bits (179), Expect = 2.692e-16
Identity = 49/110 (44.55%), Postives = 65/110 (59.09%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
             E     + +IGLQ G+NKFASQ GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNK ASQ GM++
Sbjct:  154 PEKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLN--VSLQMGSNKGASQRGMTV 260          
BLAST of SMED30031100 vs. Ensembl Mouse
Match: Cnn3 (calponin 3, acidic [Source:MGI Symbol;Acc:MGI:1919244])

HSP 1 Score: 69.3218 bits (168), Expect = 7.396e-15
Identity = 50/113 (44.25%), Postives = 66/113 (58.41%), Query Frame = 3
Query:   18 RCDE-MCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            R DE    + + VIGLQ G+NK ASQ GM   GT+R + D     +     +  I LQ G+NKGA+QAGM   GT+R I D    ++  D+  + I LQ G+NK ASQ GMS+
Sbjct:  105 RFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTD-KPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN--STISLQMGTNKVASQKGMSV 214          
BLAST of SMED30031100 vs. Ensembl Mouse
Match: Cnn3 (calponin 3, acidic [Source:MGI Symbol;Acc:MGI:1919244])

HSP 1 Score: 69.3218 bits (168), Expect = 1.012e-14
Identity = 50/113 (44.25%), Postives = 66/113 (58.41%), Query Frame = 3
Query:   18 RCDE-MCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            R DE    + + VIGLQ G+NK ASQ GM   GT+R + D     +     +  I LQ G+NKGA+QAGM   GT+R I D    ++  D+  + I LQ G+NK ASQ GMS+
Sbjct:  151 RFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTD-KPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN--STISLQMGTNKVASQKGMSV 260          
BLAST of SMED30031100 vs. Ensembl Mouse
Match: Cnn2 (calponin 2 [Source:MGI Symbol;Acc:MGI:105093])

HSP 1 Score: 58.5362 bits (140), Expect = 7.641e-11
Identity = 41/102 (40.20%), Postives = 57/102 (55.88%), Query Frame = 3
Query:   51 VIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMG 350
            VIGLQ G+NK ASQ+GM   GT+R + D    + +       I LQ G+NK A+Q GM   GT+R I D   G +  D+  + + LQ G  + A+Q+G   G
Sbjct:  165 VIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHI-LPPMDHCTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDN--SSMSLQMGYTQGANQSGQVFG 263          
BLAST of SMED30031100 vs. UniProt/SwissProt
Match: sp|P26932|CNN1_CHICK (Calponin-1 OS=Gallus gallus OX=9031 GN=CNN1 PE=1 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 7.367e-19
Identity = 53/109 (48.62%), Postives = 69/109 (63.30%), Query Frame = 3
Query:   27 EMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            E     + +IGLQ G+NKFASQ GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I + S G+E  D+  N+IGLQ GSNK ASQ GM++
Sbjct:  155 EKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPSLGMERCDT--NIIGLQMGSNKGASQQGMTV 260          

HSP 2 Score: 58.5362 bits (140), Expect = 5.452e-10
Identity = 41/87 (47.13%), Postives = 53/87 (60.92%), Query Frame = 3
Query:    3 HIADIRC--DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRI-GTQRFIND 251
            H+ D +   D+  D A   I LQ G+NK ASQ GM   GT+R I + S G+E  D+  N+IGLQ GSNKGA+Q GM + G  R + D
Sbjct:  187 HLYDPKLGTDQPLDQA--TISLQMGTNKGASQAGMTAPGTKRQIFEPSLGMERCDT--NIIGLQMGSNKGASQQGMTVYGLPRQVYD 269          
BLAST of SMED30031100 vs. UniProt/SwissProt
Match: sp|Q08290|CNN1_RAT (Calponin-1 OS=Rattus norvegicus OX=10116 GN=Cnn1 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.864e-15
Identity = 49/110 (44.55%), Postives = 65/110 (59.09%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
             E     + +IGLQ G+NKFASQ GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNK ASQ GM++
Sbjct:  154 PEKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLN--VSLQMGSNKGASQRGMTV 260          
BLAST of SMED30031100 vs. UniProt/SwissProt
Match: sp|Q7YRL2|CNN1_SHEEP (Calponin-1 OS=Ovis aries OX=9940 GN=CNN1 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.883e-15
Identity = 49/110 (44.55%), Postives = 65/110 (59.09%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
             E     + +IGLQ G+NKFASQ GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNK ASQ GM++
Sbjct:  154 PEKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLN--VSLQMGSNKGASQRGMTV 260          
BLAST of SMED30031100 vs. UniProt/SwissProt
Match: sp|Q08091|CNN1_MOUSE (Calponin-1 OS=Mus musculus OX=10090 GN=Cnn1 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.883e-15
Identity = 49/110 (44.55%), Postives = 65/110 (59.09%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
             E     + +IGLQ G+NKFASQ GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNK ASQ GM++
Sbjct:  154 PEKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLN--VSLQMGSNKGASQRGMTV 260          
BLAST of SMED30031100 vs. UniProt/SwissProt
Match: sp|Q08092|CNN1_PIG (Calponin-1 OS=Sus scrofa OX=9823 GN=CNN1 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.941e-15
Identity = 49/110 (44.55%), Postives = 65/110 (59.09%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
             E     + +IGLQ G+NKFASQ GM   GT+R + D   G +     +  I LQ G+NKGA+QAGM   GT+R I +   G+E  D+    + LQ GSNK ASQ GM++
Sbjct:  154 PEKLREGRNIIGLQMGTNKFASQQGMTAYGTRRHLYDPKLGTD-QPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLN--VSLQMGSNKGASQRGMTV 260          
BLAST of SMED30031100 vs. TrEMBL
Match: W6USP8 (Calponin OV9M OS=Echinococcus granulosus OX=6210 GN=EGR_00867 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 7.481e-34
Identity = 69/118 (58.47%), Postives = 88/118 (74.58%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            HIADI+  +M   A+G+IGLQAGSNK ASQ+GM IG  R I D+    ++S  GK VIGLQAGSNKGA+Q+GM +G  R + D+ A   IS+SGK VIGLQAG+NK ++Q+GMSMG +
Sbjct:   28 HIADIKAGDMTREAQGIIGLQAGSNKGASQSGMSIGAMRHIADLKID-QMSADGKTVIGLQAGSNKGASQSGMNMGGIRHVADIKAD-SISESGKKVIGLQAGTNKVSNQSGMSMGKI 143          

HSP 2 Score: 112.849 bits (281), Expect = 5.399e-29
Identity = 64/116 (55.17%), Postives = 83/116 (71.55%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMG 350
            HIAD++ D+M    K VIGLQAGSNK ASQ+GM +G  R + D+     IS+SGK VIGLQAG+NK + Q+GM +G  R I D+  G  +SD GK+VIGLQAGSN+ A+Q G++ G
Sbjct:   67 HIADLKIDQMSADGKTVIGLQAGSNKGASQSGMNMGGIRHVADIKAD-SISESGKKVIGLQAGTNKVSNQSGMSMGKIRHIADLKVGA-MSDEGKSVIGLQAGSNEGATQAGIAFG 180          

HSP 3 Score: 103.605 bits (257), Expect = 2.749e-25
Identity = 60/102 (58.82%), Postives = 74/102 (72.55%), Query Frame = 3
Query:   51 VIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            VIGLQAGSNK ASQ GM IG  R I D+  G +++   + +IGLQAGSNKGA+Q+GM IG  R I D+    ++S  GK VIGLQAGSNK ASQ+GM+MG +
Sbjct:    5 VIGLQAGSNKGASQKGMSIGAVRHIADIKAG-DMTREAQGIIGLQAGSNKGASQSGMSIGAMRHIADLKID-QMSADGKTVIGLQAGSNKGASQSGMNMGGI 104          

HSP 4 Score: 88.9669 bits (219), Expect = 1.396e-19
Identity = 46/81 (56.79%), Postives = 61/81 (75.31%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFI 245
            H+ADI+ D + +S K VIGLQAG+NK ++Q+GM +G  R I D+  G  +SD GK+VIGLQAGSN+GATQAG+  G +R I
Sbjct:  106 HVADIKADSISESGKKVIGLQAGTNKVSNQSGMSMGKIRHIADLKVGA-MSDEGKSVIGLQAGSNEGATQAGIAFGGRRDI 185          
BLAST of SMED30031100 vs. TrEMBL
Match: A0A2C9K5U7 (Transgelin OS=Biomphalaria glabrata OX=6526 GN=106052455 PE=3 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 3.449e-33
Identity = 65/118 (55.08%), Postives = 87/118 (73.73%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            H+ADIRCDE      G++GLQAG+NKFA+Q GMRIG QR ++D+    + +  G+ ++GLQAGSNK A+QAGMRIG QR + D+ A  + +  G+ ++GLQAGSNK ASQ GM MGA+
Sbjct:  752 HVADIRCDESTQEGHGILGLQAGTNKFATQAGMRIGAQRHVSDIRAD-DATREGQGILGLQAGSNKLASQAGMRIGAQRHVADIRAD-DATREGQGILGLQAGSNKLASQAGMRMGAI 867          

HSP 2 Score: 123.635 bits (309), Expect = 3.585e-30
Identity = 68/118 (57.63%), Postives = 85/118 (72.03%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            H+ADIR D+     +G++GLQAGSNK ASQ GMR+G  R I D+    + S  G+++I LQAGSNKGA+QAGM  G  R I D+ A  ++S  G+NVIGLQAGSNK ASQ+GMS GAV
Sbjct:  830 HVADIRADDATREGQGILGLQAGSNKLASQAGMRMGAIRHIADIRAD-DASKEGQSIISLQAGSNKGASQAGMAFGAVRHIADIRAD-DMSKEGQNVIGLQAGSNKGASQSGMSFGAV 945          

HSP 3 Score: 119.398 bits (298), Expect = 8.898e-29
Identity = 70/117 (59.83%), Postives = 82/117 (70.09%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGA 353
            HIADIR D+M    + VIGLQAGSNK ASQ+GM  G  R I D+    + S  G++VIGLQAGSNKGA+Q+GM  G  R I D+ A  + S  G+ VIGLQAGSNK ASQ GMSMGA
Sbjct:  908 HIADIRADDMSKEGQNVIGLQAGSNKGASQSGMSFGAVRHIADIRAD-DASKEGQSVIGLQAGSNKGASQSGMSFGAVRHIADIRAD-DASREGQTVIGLQAGSNKGASQAGMSMGA 1022          

HSP 4 Score: 117.087 bits (292), Expect = 6.196e-28
Identity = 68/118 (57.63%), Postives = 82/118 (69.49%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            HIADIR D+     + +I LQAGSNK ASQ GM  G  R I D+    ++S  G+NVIGLQAGSNKGA+Q+GM  G  R I D+ A  + S  G++VIGLQAGSNK ASQ+GMS GAV
Sbjct:  869 HIADIRADDASKEGQSIISLQAGSNKGASQAGMAFGAVRHIADIRAD-DMSKEGQNVIGLQAGSNKGASQSGMSFGAVRHIADIRAD-DASKEGQSVIGLQAGSNKGASQSGMSFGAV 984          

HSP 5 Score: 112.464 bits (280), Expect = 2.891e-26
Identity = 61/115 (53.04%), Postives = 77/115 (66.96%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            H++DIRCDE      G+IGLQ+GSNKFASQ GMR+G  R I D+    + SD GK  + LQ G+NK A+QAGM   G  R+I+D+    E SD GK  + LQ G+NK+ASQ GMS
Sbjct:  315 HVSDIRCDESTPEGHGIIGLQSGSNKFASQAGMRMGAIRHIADIRAD-DASDEGKAALSLQCGTNKYASQAGMVGFGAIRYISDIRVD-EASDEGKAALSLQCGTNKYASQAGMS 427          

HSP 6 Score: 112.079 bits (279), Expect = 3.613e-26
Identity = 62/119 (52.10%), Postives = 82/119 (68.91%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            H++DIRCDE     +G+I LQ+G+NKFA+Q GMRIG  R I D+    + SD GK VI LQ+G+NK A+QAGM   G  R + D+ A    S  G+ +IGLQ+GSNKFA+Q GM +GA+
Sbjct:  474 HVSDIRCDESTLEGQGIISLQSGTNKFATQKGMRIGAIRHIADIRAD-DASDEGKAVISLQSGTNKFASQAGMLGFGAVRHVADIRAD-NASQEGQGIIGLQSGSNKFANQKGMRIGAI 590          

HSP 7 Score: 111.694 bits (278), Expect = 5.075e-26
Identity = 61/118 (51.69%), Postives = 81/118 (68.64%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGA 353
            HI+DI+ D+  D  K VI LQ+G+NKFASQ GM   G  R + D+    E +  G  ++GLQAG+NK ATQAGMRIG QR ++D+ A  + +  G+ ++GLQAGSNK ASQ GM +GA
Sbjct:  712 HISDIKVDDATDEGKAVISLQSGTNKFASQAGMMGFGAVRHVADIRCD-ESTQEGHGILGLQAGTNKFATQAGMRIGAQRHVSDIRAD-DATREGQGILGLQAGSNKLASQAGMRIGA 827          

HSP 8 Score: 107.842 bits (268), Expect = 1.178e-24
Identity = 62/116 (53.45%), Postives = 77/116 (66.38%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMG 350
            HIADIR D+     + VIGLQAGSNK ASQ+GM  G  R I D+    + S  G+ VIGLQAGSNKGA+QAGM +G QR + D+    ++S + K  I LQ G NK A+Q+GMS G
Sbjct:  947 HIADIRADDASKEGQSVIGLQAGSNKGASQSGMSFGAVRHIADIRAD-DASREGQTVIGLQAGSNKGASQAGMSMGAQRHVADIKVD-DVSQASKATINLQYGQNKGANQSGMSYG 1060          

HSP 9 Score: 107.457 bits (267), Expect = 1.260e-24
Identity = 61/115 (53.04%), Postives = 78/115 (67.83%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            H+ADIR D      +G+IGLQ+GSNKFA+Q GMRIG  R I D+    + S+ GK  I LQ+G+NK A+QAGM  IG  R ++D+    E +  G  +IGLQ+GSNKFASQ GMS
Sbjct:  553 HVADIRADNASQEGQGIIGLQSGSNKFANQKGMRIGAIRHIADIRAD-DASEEGKAFISLQSGTNKFASQAGMSAIGAVRHVSDIRCD-ESTQEGHGIIGLQSGSNKFASQAGMS 665          

HSP 10 Score: 105.531 bits (262), Expect = 6.131e-24
Identity = 61/114 (53.51%), Postives = 76/114 (66.67%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGM 341
            HI+DI+ DE  D  K VI LQ G+NKFASQ GM   G  R ++D+    E +  G+ +I LQ+G+NK ATQ GMRIG  R I D+ A  + SD GK VI LQ+G+NKFASQ GM
Sbjct:  434 HISDIKVDEATDEGKAVISLQCGTNKFASQAGMSGFGAVRHVSDIRCD-ESTLEGQGIISLQSGTNKFATQKGMRIGAIRHIADIRAD-DASDEGKAVISLQSGTNKFASQAGM 545          

HSP 11 Score: 100.908 bits (250), Expect = 2.891e-22
Identity = 59/114 (51.75%), Postives = 74/114 (64.91%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGM 341
            HIADIR D+M    +G+IGLQAGSNK ASQ GM  G  R I D+    E +  G  +I LQ+GSNK A+QAGM   G  R ++D+    E +  G+ +I LQ+GSNKFASQ GM
Sbjct:  196 HIADIRADDMVKEGQGIIGLQAGSNKGASQAGMSFGAVRHIADIRAD-ESTQEGHGIISLQSGSNKFASQAGMMGFGAVRHVSDIRCD-ESTPEGQGIISLQSGSNKFASQAGM 307          

HSP 12 Score: 98.5969 bits (244), Expect = 1.938e-21
Identity = 56/113 (49.56%), Postives = 74/113 (65.49%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGM 341
            H+ +    E   + +G+IGLQAG+NK ASQ GM++G  R I D+    ++   G+ +IGLQAGSNKGA+QAGM  G  R I D+ A  E +  G  +I LQ+GSNKFASQ GM
Sbjct:  158 HVVEF-TQEQLRAGQGIIGLQAGTNKCASQAGMKMGASRHIADIRAD-DMVKEGQGIIGLQAGSNKGASQAGMSFGAVRHIADIRAD-ESTQEGHGIISLQSGSNKFASQAGM 267          

HSP 13 Score: 95.1301 bits (235), Expect = 2.742e-20
Identity = 55/119 (46.22%), Postives = 76/119 (63.87%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGA 353
            HI+DI+ D+  D  K  + LQ G+NK+ASQ GM   G  R I+D+    + +D GK VI LQ+G+NK A+QAGM   G  R + D+    E +  G  ++GLQAG+NKFA+Q GM +GA
Sbjct:  672 HISDIKVDDASDEGKATLSLQCGTNKYASQAGMSGFGAIRHISDIKVD-DATDEGKAVISLQSGTNKFASQAGMMGFGAVRHVADIRCD-ESTQEGHGILGLQAGTNKFATQAGMRIGA 788          

HSP 14 Score: 75.8702 bits (185), Expect = 1.558e-13
Identity = 42/81 (51.85%), Postives = 52/81 (64.20%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFI 245
            HIADIR D+     + VIGLQAGSNK ASQ GM +G QR + D+    ++S + K  I LQ G NKGA Q+GM  G +R I
Sbjct:  986 HIADIRADDASREGQTVIGLQAGSNKGASQAGMSMGAQRHVADIKVD-DVSQASKATINLQYGQNKGANQSGMSYGGRRDI 1065          

HSP 15 Score: 70.0922 bits (170), Expect = 1.711e-11
Identity = 44/101 (43.56%), Postives = 64/101 (63.37%), Query Frame = 3
Query:   54 IGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            +G +A  N F   T     +++ + + +   E   +G+ +IGLQAG+NK A+QAGM++G  R I D+ A  ++   G+ +IGLQAGSNK ASQ GMS GAV
Sbjct:  136 LGTEAQRNGFNGPTCGPKPSEKHVVEFTQ--EQLRAGQGIIGLQAGTNKCASQAGMKMGASRHIADIRAD-DMVKEGQGIIGLQAGSNKGASQAGMSFGAV 233          
BLAST of SMED30031100 vs. TrEMBL
Match: A0A068WI79 (Transgelin OS=Echinococcus granulosus OX=6210 GN=EgrG_001004800 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 4.207e-32
Identity = 69/118 (58.47%), Postives = 88/118 (74.58%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            HIADI+  +M   A+G+IGLQAGSNK ASQ+GM IG  R I D+    ++S  GK VIGLQAGSNKGA+Q+GM +G  R + D+ A   IS+SGK VIGLQAG+NK ++Q+GMSMG +
Sbjct:  170 HIADIKAGDMTREAQGIIGLQAGSNKGASQSGMSIGAMRHIADLKID-QMSADGKTVIGLQAGSNKGASQSGMNMGGIRHVADIKAD-SISESGKKVIGLQAGTNKVSNQSGMSMGKI 285          

HSP 2 Score: 112.464 bits (280), Expect = 1.668e-27
Identity = 64/116 (55.17%), Postives = 83/116 (71.55%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMG 350
            HIAD++ D+M    K VIGLQAGSNK ASQ+GM +G  R + D+     IS+SGK VIGLQAG+NK + Q+GM +G  R I D+  G  +SD GK+VIGLQAGSN+ A+Q G++ G
Sbjct:  209 HIADLKIDQMSADGKTVIGLQAGSNKGASQSGMNMGGIRHVADIKAD-SISESGKKVIGLQAGTNKVSNQSGMSMGKIRHIADLKVGA-MSDEGKSVIGLQAGSNEGATQAGIAFG 322          

HSP 3 Score: 103.219 bits (256), Expect = 7.219e-24
Identity = 60/102 (58.82%), Postives = 74/102 (72.55%), Query Frame = 3
Query:   51 VIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            VIGLQAGSNK ASQ GM IG  R I D+  G +++   + +IGLQAGSNKGA+Q+GM IG  R I D+    ++S  GK VIGLQAGSNK ASQ+GM+MG +
Sbjct:  147 VIGLQAGSNKGASQKGMSIGAVRHIADIKAG-DMTREAQGIIGLQAGSNKGASQSGMSIGAMRHIADLKID-QMSADGKTVIGLQAGSNKGASQSGMNMGGI 246          

HSP 4 Score: 88.1965 bits (217), Expect = 2.806e-18
Identity = 46/81 (56.79%), Postives = 61/81 (75.31%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFI 245
            H+ADI+ D + +S K VIGLQAG+NK ++Q+GM +G  R I D+  G  +SD GK+VIGLQAGSN+GATQAG+  G +R I
Sbjct:  248 HVADIKADSISESGKKVIGLQAGTNKVSNQSGMSMGKIRHIADLKVGA-MSDEGKSVIGLQAGSNEGATQAGIAFGGRRDI 327          
BLAST of SMED30031100 vs. TrEMBL
Match: A0A0B7AJ70 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF119236 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 4.320e-32
Identity = 70/117 (59.83%), Postives = 81/117 (69.23%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGA 353
            HIAD+R  EM    +GVIGLQAGSNKFASQTGM  G+ R I D+ T    S  G+ +IGLQAGSNKGA+Q GM  G  R I D+    + S  G+ VIGLQAGSNK ASQ GM+MGA
Sbjct:  152 HIADVRAAEMSQEGQGVIGLQAGSNKFASQTGMSFGSVRHIADIRTD-NASKEGQGIIGLQAGSNKGASQTGMSFGAVRHIADIKTD-DASKEGQGVIGLQAGSNKGASQKGMTMGA 266          

HSP 2 Score: 120.168 bits (300), Expect = 9.178e-31
Identity = 71/119 (59.66%), Postives = 82/119 (68.91%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            H++DIR DEM    +GVIGLQAGSNKFASQ GM   G+ R I DV    E+S  G+ VIGLQAGSNK A+Q GM  G+ R I D+      S  G+ +IGLQAGSNK ASQTGMS GAV
Sbjct:  112 HVSDIRADEMNPDGQGVIGLQAGSNKFASQAGMTGFGSVRHIADVRA-AEMSQEGQGVIGLQAGSNKFASQTGMSFGSVRHIADIRTD-NASKEGQGIIGLQAGSNKGASQTGMSFGAV 228          

HSP 3 Score: 97.8265 bits (242), Expect = 2.804e-22
Identity = 67/159 (42.14%), Postives = 84/159 (52.83%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGM-RIGTQRFINDVST---------------------------------------GVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            HI+DIR D++    +G++ LQ G+NKF SQ GM   G  R I+D+                                           E++  G+ VIGLQAGSNK A+QAGM   G+ R I DV A  E+S  G+ VIGLQAGSNKFASQTGMS G+V
Sbjct:   32 HISDIRADDLNQEGQGILTLQTGTNKFDSQKGMTSFGAVRHISDIRADQINPESHANIGQQAGSNKYATQKGMTSFGSVRHVSDIRADEMNPDGQGVIGLQAGSNKFASQAGMTGFGSVRHIADVRA-AEMSQEGQGVIGLQAGSNKFASQTGMSFGSV 189          

HSP 4 Score: 91.6633 bits (226), Expect = 6.416e-20
Identity = 50/85 (58.82%), Postives = 58/85 (68.24%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVS 257
            HIADIR D      +G+IGLQAGSNK ASQTGM  G  R I D+ T  + S  G+ VIGLQAGSNKGA+Q GM +G QR I +V 
Sbjct:  191 HIADIRTDNASKEGQGIIGLQAGSNKGASQTGMSFGAVRHIADIKTD-DASKEGQGVIGLQAGSNKGASQKGMTMGAQRHIANVP 274          

HSP 5 Score: 71.2478 bits (173), Expect = 2.941e-12
Identity = 57/146 (39.04%), Postives = 72/146 (49.32%), Query Frame = 3
Query:   30 MCDSAKGVIGLQAGSNKFASQTGM-RIGTQRFINDV---------------STGVEISDSGKNV------------------------IGLQAGSNKGATQAGM-RIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            M    +GV+ LQ G+NK+ASQ GM   G  R I+D+                TG    DS K +                        IG QAGSNK ATQ GM   G+ R ++D+ A  E++  G+ VIGLQAGSNKFASQ GM+
Sbjct:    1 MNQEGQGVLSLQTGTNKYASQKGMSSFGAVRHISDIRADDLNQEGQGILTLQTGTNKFDSQKGMTSFGAVRHISDIRADQINPESHANIGQQAGSNKYATQKGMTSFGSVRHVSDIRAD-EMNPDGQGVIGLQAGSNKFASQAGMT 145          
BLAST of SMED30031100 vs. TrEMBL
Match: A0A0R3S938 (Transgelin OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS727 PE=3 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 5.523e-32
Identity = 70/118 (59.32%), Postives = 89/118 (75.42%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            HIADI+ D+M   + G+IGLQAGSNK A+Q+GM +G  R I D + G E+SD+GK  + LQ G+NKGA+Q+GM +G  R I D   G E+SD+GK+ IGLQAGSNK ASQ+GMSMGAV
Sbjct:  193 HIADIKADDMSRESHGIIGLQAGSNKGANQSGMAMGAIRHIADQNIG-EMSDTGKTSLNLQMGTNKGASQSGMAMGAMRHIADQKIG-EMSDAGKSTIGLQAGSNKGASQSGMSMGAV 308          

HSP 2 Score: 122.479 bits (306), Expect = 1.425e-30
Identity = 68/118 (57.63%), Postives = 87/118 (73.73%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            HIAD +  EM D+ K  IGLQAGSNK ASQ+GM +G  R I D+    ++S  G++VIGLQAGSNKGATQ+GM +G  R I D+    EIS  G++VIGLQAG+N++A+Q+GMSMG V
Sbjct:  271 HIADQKIGEMSDAGKSTIGLQAGSNKGASQSGMSMGAVRHIADIRVD-KMSKEGESVIGLQAGSNKGATQSGMAMGAVRHIADIKVD-EISKEGQSVIGLQAGTNQYANQSGMSMGGV 386          

HSP 3 Score: 109.768 bits (273), Expect = 7.727e-26
Identity = 63/117 (53.85%), Postives = 81/117 (69.23%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGA 353
            HIADIR D+M    + VIGLQAGSNK A+Q+GM +G  R I D+    EIS  G++VIGLQAG+N+ A Q+GM +G  R I D+    ++S  G  +IGLQ+GSN+ ASQ GMS GA
Sbjct:  310 HIADIRVDKMSKEGESVIGLQAGSNKGATQSGMAMGAVRHIADIKVD-EISKEGQSVIGLQAGTNQYANQSGMSMGGVRHIADIKVD-DMSKEGAGIIGLQSGSNQGASQAGMSFGA 424          

HSP 4 Score: 99.7525 bits (247), Expect = 3.317e-22
Identity = 58/111 (52.25%), Postives = 78/111 (70.27%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            ++  +++K VIGLQAGSNK ASQ GM +G  R I D+    ++S     +IGLQAGSNKGA Q+GM +G  R I D + G E+SD+GK  + LQ G+NK ASQ+GM+MGA+
Sbjct:  161 EDQLNASKAVIGLQAGSNKGASQKGMSMGAVRHIADIKAD-DMSRESHGIIGLQAGSNKGANQSGMAMGAIRHIADQNIG-EMSDTGKTSLNLQMGTNKGASQSGMAMGAM 269          

HSP 5 Score: 89.7373 bits (221), Expect = 1.564e-18
Identity = 45/87 (51.72%), Postives = 61/87 (70.11%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAG 263
            HIADI+ DE+    + VIGLQAG+N++A+Q+GM +G  R I D+    ++S  G  +IGLQ+GSN+GA+QAGM  G QR I DV  G
Sbjct:  349 HIADIKVDEISKEGQSVIGLQAGTNQYANQSGMSMGGVRHIADIKVD-DMSKEGAGIIGLQSGSNQGASQAGMSFGAQRHITDVQVG 434          
BLAST of SMED30031100 vs. Ensembl Cavefish
Match: cnn1b (calponin 1 [Source:NCBI gene;Acc:103040806])

HSP 1 Score: 77.0258 bits (188), Expect = 9.203e-18
Identity = 48/109 (44.04%), Postives = 67/109 (61.47%), Query Frame = 3
Query:   27 EMCDSAKGVIGLQAGSNKFASQTGM-RIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            E     + +IGLQ G+NKFASQ GM   GT+R + D   G+E +   ++ I LQ G+NKGA Q+GM   GT+R I D    +E  D+    + LQ G+NK ASQ+GM++
Sbjct:  157 EKLKEGRNIIGLQMGTNKFASQKGMTSYGTRRHLYDPKVGME-NPLDQSTISLQMGTNKGANQSGMTAPGTKRQIFDKKLDMESCDTA--TVSLQMGTNKVASQSGMTV 262          
BLAST of SMED30031100 vs. Ensembl Cavefish
Match: cnn3a (calponin 3 [Source:NCBI gene;Acc:103024651])

HSP 1 Score: 75.0998 bits (183), Expect = 7.630e-17
Identity = 51/110 (46.36%), Postives = 66/110 (60.00%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            DE   + + VIGLQ G+NK ASQ GM   GT+R + D  T  +     +  I LQ G+NKGA+QAGM   GT+R I D    V+  D+  + I LQ G+NK ASQ GMS+
Sbjct:  155 DEKMKAGQCVIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTD-KPYDQTTISLQMGTNKGASQAGMSAPGTRRDIFDQKVAVQPLDN--STISLQMGTNKVASQKGMSV 261          
BLAST of SMED30031100 vs. Ensembl Cavefish
Match: cnn3a (calponin 3 [Source:NCBI gene;Acc:103024651])

HSP 1 Score: 74.7146 bits (182), Expect = 8.729e-17
Identity = 51/110 (46.36%), Postives = 66/110 (60.00%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            DE   + + VIGLQ G+NK ASQ GM   GT+R + D  T  +     +  I LQ G+NKGA+QAGM   GT+R I D    V+  D+  + I LQ G+NK ASQ GMS+
Sbjct:  154 DEKMKAGQCVIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTD-KPYDQTTISLQMGTNKGASQAGMSAPGTRRDIFDQKVAVQPLDN--STISLQMGTNKVASQKGMSV 260          
BLAST of SMED30031100 vs. Ensembl Cavefish
Match: ENSAMXT00000006562.2 (calponin-3-like [Source:NCBI gene;Acc:103046041])

HSP 1 Score: 72.4034 bits (176), Expect = 6.039e-16
Identity = 50/110 (45.45%), Postives = 64/110 (58.18%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            DE   +   VIGLQ G+NK ASQ GM   GT+R + D  T  +     +  I LQ G+NKGA+QAGM   GT+R I D     +  D+  + I LQ G+NK ASQ GMS+
Sbjct:  151 DEKMKAGHCVIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTD-KPYDQTTISLQMGTNKGASQAGMSAPGTRRDIFDQKVAQQPMDN--STISLQMGTNKTASQKGMSV 257          
BLAST of SMED30031100 vs. Ensembl Cavefish
Match: ENSAMXT00000037688.1 (calponin-3-like [Source:NCBI gene;Acc:103046041])

HSP 1 Score: 72.0182 bits (175), Expect = 9.199e-16
Identity = 50/110 (45.45%), Postives = 64/110 (58.18%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            DE   +   VIGLQ G+NK ASQ GM   GT+R + D  T  +     +  I LQ G+NKGA+QAGM   GT+R I D     +  D+  + I LQ G+NK ASQ GMS+
Sbjct:  154 DEKMKAGHCVIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTD-KPYDQTTISLQMGTNKGASQAGMSAPGTRRDIFDQKVAQQPMDN--STISLQMGTNKTASQKGMSV 260          
BLAST of SMED30031100 vs. Ensembl Medaka
Match: cnn1b (calponin 1 [Source:NCBI gene;Acc:101163085])

HSP 1 Score: 75.8702 bits (185), Expect = 2.474e-17
Identity = 48/108 (44.44%), Postives = 66/108 (61.11%), Query Frame = 3
Query:   27 EMCDSAKGVIGLQAGSNKFASQTGM-RIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            E     + +IGLQ G+N+FASQ GM   GT+R + D   G++ +   ++ I LQ G+NKGATQAGM   GT+R I D    +E+ +     I LQ G+NK ASQ GM+
Sbjct:  156 EKLREGRNIIGLQMGTNQFASQKGMTSYGTRRHLFDAKIGMD-NPIDQSTISLQMGTNKGATQAGMTAPGTRRHIFD--KKLELENCDTTTISLQMGTNKVASQQGMT 260          
BLAST of SMED30031100 vs. Ensembl Medaka
Match: cnn3b (calponin 3 [Source:NCBI gene;Acc:101163038])

HSP 1 Score: 70.0922 bits (170), Expect = 5.746e-15
Identity = 49/109 (44.95%), Postives = 65/109 (59.63%), Query Frame = 3
Query:   27 EMCDSAKGVIGLQAGSNKFASQTGMRI-GTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRI-GTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSM 347
            E   + + VIGLQ G+NK ASQ GM   GT+R + D  T  +     +  I LQ G+NKGA+QAGM   GT+R I D    ++  D+  + I LQ G+NK ASQ GMS+
Sbjct:  194 EKIKAGQCVIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTD-KPHDQTTISLQMGTNKGASQAGMAAPGTRRDIFDQKVALQPLDN--STISLQMGTNKVASQRGMSV 299          

HSP 2 Score: 47.7506 bits (112), Expect = 3.380e-7
Identity = 31/68 (45.59%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  144 VEISDSGKNVIGLQAGSNKGATQAGMRI-GTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMS 344
            VE   +G+ VIGLQ G+NK A+QAGM   GT+R + D     +     +  I LQ G+NK ASQ GM+
Sbjct:  193 VEKIKAGQCVIGLQMGTNKCASQAGMTAYGTRRHLYDPKTQTD-KPHDQTTISLQMGTNKGASQAGMA 259          
BLAST of SMED30031100 vs. Ensembl Medaka
Match: ENSORLT00000007021.2 (calponin 2 [Source:NCBI gene;Acc:101165178])

HSP 1 Score: 62.7734 bits (151), Expect = 1.572e-12
Identity = 44/111 (39.64%), Postives = 64/111 (57.66%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMR-IGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMR-IGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMG 350
            +E   + + VIGLQ G+NK ASQ GM   GT+R + D    ++        I LQ G+NKGA+QAGM   GT+R I D   G +  D+  + + LQ G ++ A+Q+G + G
Sbjct:  153 EEKLKAGQCVIGLQMGTNKCASQAGMNAYGTRRHLYDPKAHIQ-PPMDNTTISLQMGTNKGASQAGMTAPGTRRAIYDQKLGTDKCDN--STMSLQMGFSQGANQSGQNFG 260          
BLAST of SMED30031100 vs. Planmine SMEST
Match: SMESG000057600.1 (SMESG000057600.1)

HSP 1 Score: 234.187 bits (596), Expect = 4.421e-75
Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV
Sbjct:  231 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 348          

HSP 2 Score: 223.402 bits (568), Expect = 5.075e-71
Identity = 113/118 (95.76%), Postives = 114/118 (96.61%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            HIADIRCDEMCD AKGVIGLQAGSNK A+Q GMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVS GVEISDSGKNVIGLQAGSNKFASQTGMSMGAV
Sbjct:  350 HIADIRCDEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 467          

HSP 3 Score: 204.527 bits (519), Expect = 9.992e-64
Identity = 103/116 (88.79%), Postives = 107/116 (92.24%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMG 350
            HIADIRCDEMCD AKGVIGLQAGSNK A+Q GMRIGTQRFINDVSTGVEISDSGK VIGLQAGSNKGATQAGMRIGTQRFINDVS G+EISD GKNVIGLQAGSNK A+Q GM +G
Sbjct:  469 HIADIRCDEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIGLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVIGLQAGSNKGATQAGMRIG 584          

HSP 4 Score: 150.984 bits (380), Expect = 9.767e-44
Identity = 89/148 (60.14%), Postives = 97/148 (65.54%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKN---------------------------------------VIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMG 350
            +E   S +G+IGLQAGSNK ASQ+GMRIGTQRFINDVSTGVEISD GK+                                       VIGLQAGSNK A+Q GMRIGTQRFINDVS GVEISDSGKNVIGLQAGSNK A+Q GM +G
Sbjct:  159 EEQLRSGQGIIGLQAGSNKGASQSGMRIGTQRFINDVSTGVEISDEGKSVIGLQAGSNKFASQTGMSMGAVRHIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIG 306          

HSP 5 Score: 114.775 bits (286), Expect = 9.027e-31
Identity = 58/66 (87.88%), Postives = 63/66 (95.45%), Query Frame = 3
Query:  159 SGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            SG+ +IGLQAGSNKGA+Q+GMRIGTQRFINDVS GVEISD GK+VIGLQAGSNKFASQTGMSMGAV
Sbjct:  164 SGQGIIGLQAGSNKGASQSGMRIGTQRFINDVSTGVEISDEGKSVIGLQAGSNKFASQTGMSMGAV 229          
BLAST of SMED30031100 vs. Planmine SMEST
Match: SMESG000057600.1 (SMESG000057600.1)

HSP 1 Score: 234.187 bits (596), Expect = 5.454e-75
Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV
Sbjct:  238 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 355          

HSP 2 Score: 223.402 bits (568), Expect = 6.212e-71
Identity = 113/118 (95.76%), Postives = 114/118 (96.61%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            HIADIRCDEMCD AKGVIGLQAGSNK A+Q GMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVS GVEISDSGKNVIGLQAGSNKFASQTGMSMGAV
Sbjct:  357 HIADIRCDEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 474          

HSP 3 Score: 204.142 bits (518), Expect = 1.229e-63
Identity = 103/116 (88.79%), Postives = 107/116 (92.24%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMG 350
            HIADIRCDEMCD AKGVIGLQAGSNK A+Q GMRIGTQRFINDVSTGVEISDSGK VIGLQAGSNKGATQAGMRIGTQRFINDVS G+EISD GKNVIGLQAGSNK A+Q GM +G
Sbjct:  476 HIADIRCDEMCDDAKGVIGLQAGSNKGATQAGMRIGTQRFINDVSTGVEISDSGKTVIGLQAGSNKGATQAGMRIGTQRFINDVSNGIEISDEGKNVIGLQAGSNKGATQAGMRIG 591          

HSP 4 Score: 150.984 bits (380), Expect = 1.063e-43
Identity = 89/148 (60.14%), Postives = 97/148 (65.54%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKN---------------------------------------VIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMG 350
            +E   S +G+IGLQAGSNK ASQ+GMRIGTQRFINDVSTGVEISD GK+                                       VIGLQAGSNK A+Q GMRIGTQRFINDVS GVEISDSGKNVIGLQAGSNK A+Q GM +G
Sbjct:  166 EEQLRSGQGIIGLQAGSNKGASQSGMRIGTQRFINDVSTGVEISDEGKSVIGLQAGSNKFASQTGMSMGAVRHIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIG 313          

HSP 5 Score: 114.775 bits (286), Expect = 9.230e-31
Identity = 58/66 (87.88%), Postives = 63/66 (95.45%), Query Frame = 3
Query:  159 SGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            SG+ +IGLQAGSNKGA+Q+GMRIGTQRFINDVS GVEISD GK+VIGLQAGSNKFASQTGMSMGAV
Sbjct:  171 SGQGIIGLQAGSNKGASQSGMRIGTQRFINDVSTGVEISDEGKSVIGLQAGSNKFASQTGMSMGAV 236          
BLAST of SMED30031100 vs. Planmine SMEST
Match: SMESG000057599.1 (SMESG000057599.1)

HSP 1 Score: 162.155 bits (409), Expect = 8.707e-50
Identity = 92/158 (58.23%), Postives = 101/158 (63.92%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKN---------------------------------------VIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSN--KFASQTGMSMGA 353
            HIADIRCDEM D AKGVIGLQAGSNK A+Q GMRIG QRFINDVS+G+E+SD GK                                        VIGLQAGSNKGA+QAGMRIGTQRFINDV+ GVE+SD GK  IGLQ G +  K  SQ+GMS GA
Sbjct:  198 HIADIRCDEMSDEAKGVIGLQAGSNKGATQAGMRIGGQRFINDVSSGLEMSDEGKTCIGLQAGSNKGASQTGMSMGAVRHIADIRCDEMSDEAKGVIGLQAGSNKGASQAGMRIGTQRFINDVTTGVEMSDEGKTTIGLQMGPDKSKVDSQSGMSFGA 355          

HSP 2 Score: 145.206 bits (365), Expect = 2.652e-43
Identity = 79/111 (71.17%), Postives = 90/111 (81.08%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            +E   S++G+IGLQAGSNK ASQ+GM +G  R I D+    E+SD  K VIGLQAGSNKGATQAGMRIG QRFINDVS+G+E+SD GK  IGLQAGSNK ASQTGMSMGAV
Sbjct:  166 EEQLRSSQGIIGLQAGSNKGASQSGMSMGAVRHIADIRCD-EMSDEAKGVIGLQAGSNKGATQAGMRIGGQRFINDVSSGLEMSDEGKTCIGLQAGSNKGASQTGMSMGAV 275          

HSP 3 Score: 123.635 bits (309), Expect = 5.170e-35
Identity = 62/85 (72.94%), Postives = 67/85 (78.82%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGA--TQAGMRIGTQRFIND 251
            HIADIRCDEM D AKGVIGLQAGSNK ASQ GMRIGTQRFINDV+TGVE+SD GK  IGLQ G +K    +Q+GM  G QR I D
Sbjct:  277 HIADIRCDEMSDEAKGVIGLQAGSNKGASQAGMRIGTQRFINDVTTGVEMSDEGKTTIGLQMGPDKSKVDSQSGMSFGAQRHITD 361          
BLAST of SMED30031100 vs. Planmine SMEST
Match: SMESG000057599.1 (SMESG000057599.1)

HSP 1 Score: 135.961 bits (341), Expect = 4.752e-40
Identity = 80/151 (52.98%), Postives = 93/151 (61.59%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKN---------------------------------------VIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSN--KFASQTGMSMGA 353
            +E   S++G+IGLQAGSNK A+Q GMRIG QRFINDVS+G+E+SD GK                                        VIGLQAGSNKGA+QAGMRIGTQRFINDV+ GVE+SD GK  IGLQ G +  K  SQ+GMS GA
Sbjct:  166 EEQLRSSQGIIGLQAGSNKGATQAGMRIGGQRFINDVSSGLEMSDEGKTCIGLQAGSNKGASQTGMSMGAVRHIADIRCDEMSDEAKGVIGLQAGSNKGASQAGMRIGTQRFINDVTTGVEMSDEGKTTIGLQMGPDKSKVDSQSGMSFGA 316          

HSP 2 Score: 123.635 bits (309), Expect = 2.104e-35
Identity = 62/85 (72.94%), Postives = 67/85 (78.82%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGA--TQAGMRIGTQRFIND 251
            HIADIRCDEM D AKGVIGLQAGSNK ASQ GMRIGTQRFINDV+TGVE+SD GK  IGLQ G +K    +Q+GM  G QR I D
Sbjct:  238 HIADIRCDEMSDEAKGVIGLQAGSNKGASQAGMRIGTQRFINDVTTGVEMSDEGKTTIGLQMGPDKSKVDSQSGMSFGAQRHITD 322          

HSP 3 Score: 105.531 bits (262), Expect = 2.162e-28
Identity = 54/66 (81.82%), Postives = 59/66 (89.39%), Query Frame = 3
Query:  159 SGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            S + +IGLQAGSNKGATQAGMRIG QRFINDVS+G+E+SD GK  IGLQAGSNK ASQTGMSMGAV
Sbjct:  171 SSQGIIGLQAGSNKGATQAGMRIGGQRFINDVSSGLEMSDEGKTCIGLQAGSNKGASQTGMSMGAV 236          
BLAST of SMED30031100 vs. Planmine SMEST
Match: SMESG000067773.1 (SMESG000067773.1)

HSP 1 Score: 107.457 bits (267), Expect = 7.118e-29
Identity = 58/119 (48.74%), Postives = 77/119 (64.71%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSN--KFASQTGMSMGA 353
            HIADIRC+  C  A  +I LQ GSN+ ASQ GM IG  R ++D+    E +   ++VI LQ G+N GA Q GMRIGTQR I D+S G+E +    N++ LQ G +  + A+Q+GMS GA
Sbjct:  237 HIADIRCESNCPEAASIINLQYGSNQGASQKGMVIGGVRHVSDIKCA-ESNKEAQSVISLQYGTNLGANQTGMRIGTQRHITDISCGIEPNKMSSNMVSLQMGPSMKEVANQSGMSFGA 354          

HSP 2 Score: 89.3521 bits (220), Expect = 4.047e-22
Identity = 52/111 (46.85%), Postives = 71/111 (63.96%), Query Frame = 3
Query:   24 DEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGLQAGSNKFASQTGMSMGAV 356
            DE     +G+I LQ+G+NKFASQ+GM  G  R I D+    +++DSGK +IGLQ G+NK A+Q GM IG  R I D+       ++  ++I LQ GSN+ ASQ GM +G V
Sbjct:  166 DEQLRMGEGIINLQSGTNKFASQSGMSFGGVRHIADIRCD-DLNDSGKGIIGLQMGTNKYASQKGMSIGAVRHIADIRCESNCPEAA-SIINLQYGSNQGASQKGMVIGGV 274          

HSP 3 Score: 82.0333 bits (201), Expect = 1.779e-19
Identity = 42/85 (49.41%), Postives = 56/85 (65.88%), Query Frame = 3
Query:    3 HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEISDSGKNVIGLQAGSN--KGATQAGMRIGTQRFIND 251
            H++DI+C E    A+ VI LQ G+N  A+QTGMRIGTQR I D+S G+E +    N++ LQ G +  + A Q+GM  G QR IND
Sbjct:  276 HVSDIKCAESNKEAQSVISLQYGTNLGANQTGMRIGTQRHITDISCGIEPNKMSSNMVSLQMGPSMKEVANQSGMSFGAQRHIND 360          
The following BLAST results are available for this feature:
BLAST of SMED30031100 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNN12.270e-1646.60calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155][more]
CNN13.899e-1646.60calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155][more]
CNN13.899e-1646.60calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155][more]
CNN18.514e-1646.60calponin 1 [Source:HGNC Symbol;Acc:HGNC:2155][more]
CNN38.799e-1544.25calponin 3 [Source:HGNC Symbol;Acc:HGNC:2157][more]
back to top
BLAST of SMED30031100 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clik-16.355e-1236.29CaLponIn-liKe proteins [Source:UniProtKB/TrEMBL;A... [more]
clik-16.355e-1236.29CaLponIn-liKe proteins [Source:UniProtKB/TrEMBL;A... [more]
unc-872.041e-931.71pep chromosome:WBcel235:I:6761228:6767797:-1 gene:... [more]
unc-879.398e-828.91pep chromosome:WBcel235:I:6761228:6765611:-1 gene:... [more]
unc-879.398e-828.91pep chromosome:WBcel235:I:6761567:6765734:-1 gene:... [more]
back to top
BLAST of SMED30031100 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031100 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnn1b3.415e-2045.87calponin 1, basic, smooth muscle, b [Source:ZFIN;A... [more]
cnn3a5.284e-1847.27calponin 3, acidic a [Source:ZFIN;Acc:ZDB-GENE-030... [more]
cnn3b1.264e-1646.36calponin 3, acidic b [Source:ZFIN;Acc:ZDB-GENE-050... [more]
cnn3b1.628e-1646.36calponin 3, acidic b [Source:ZFIN;Acc:ZDB-GENE-050... [more]
cnn21.066e-1340.54calponin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-542][more]
back to top
BLAST of SMED30031100 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tfdp12.530e-1645.45transcription factor Dp-1 [Source:Xenbase;Acc:XB-G... [more]
tfdp16.420e-1645.45transcription factor Dp-1 [Source:Xenbase;Acc:XB-G... [more]
slc5a8.13.050e-1545.63solute carrier family 5 member 8, gene 1 [Source:X... [more]
cnn17.775e-1343.14calponin 1, basic, smooth muscle [Source:NCBI gene... [more]
back to top
BLAST of SMED30031100 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnn11.903e-1644.55calponin 1 [Source:MGI Symbol;Acc:MGI:104979][more]
Cnn12.692e-1644.55calponin 1 [Source:MGI Symbol;Acc:MGI:104979][more]
Cnn37.396e-1544.25calponin 3, acidic [Source:MGI Symbol;Acc:MGI:1919... [more]
Cnn31.012e-1444.25calponin 3, acidic [Source:MGI Symbol;Acc:MGI:1919... [more]
Cnn27.641e-1140.20calponin 2 [Source:MGI Symbol;Acc:MGI:105093][more]
back to top
BLAST of SMED30031100 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26932|CNN1_CHICK7.367e-1948.62Calponin-1 OS=Gallus gallus OX=9031 GN=CNN1 PE=1 S... [more]
sp|Q08290|CNN1_RAT1.864e-1544.55Calponin-1 OS=Rattus norvegicus OX=10116 GN=Cnn1 P... [more]
sp|Q7YRL2|CNN1_SHEEP1.883e-1544.55Calponin-1 OS=Ovis aries OX=9940 GN=CNN1 PE=2 SV=1[more]
sp|Q08091|CNN1_MOUSE1.883e-1544.55Calponin-1 OS=Mus musculus OX=10090 GN=Cnn1 PE=1 S... [more]
sp|Q08092|CNN1_PIG1.941e-1544.55Calponin-1 OS=Sus scrofa OX=9823 GN=CNN1 PE=2 SV=1[more]
back to top
BLAST of SMED30031100 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6USP87.481e-3458.47Calponin OV9M OS=Echinococcus granulosus OX=6210 G... [more]
A0A2C9K5U73.449e-3355.08Transgelin OS=Biomphalaria glabrata OX=6526 GN=106... [more]
A0A068WI794.207e-3258.47Transgelin OS=Echinococcus granulosus OX=6210 GN=E... [more]
A0A0B7AJ704.320e-3259.83Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A0R3S9385.523e-3259.32Transgelin OS=Hymenolepis diminuta OX=6216 GN=HDID... [more]
back to top
BLAST of SMED30031100 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnn1b9.203e-1844.04calponin 1 [Source:NCBI gene;Acc:103040806][more]
cnn3a7.630e-1746.36calponin 3 [Source:NCBI gene;Acc:103024651][more]
cnn3a8.729e-1746.36calponin 3 [Source:NCBI gene;Acc:103024651][more]
ENSAMXT00000006562.26.039e-1645.45calponin-3-like [Source:NCBI gene;Acc:103046041][more]
ENSAMXT00000037688.19.199e-1645.45calponin-3-like [Source:NCBI gene;Acc:103046041][more]
back to top
BLAST of SMED30031100 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031100 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031100 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031100 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cnn1b2.474e-1744.44calponin 1 [Source:NCBI gene;Acc:101163085][more]
cnn3b5.746e-1544.95calponin 3 [Source:NCBI gene;Acc:101163038][more]
ENSORLT00000007021.21.572e-1239.64calponin 2 [Source:NCBI gene;Acc:101165178][more]
back to top
BLAST of SMED30031100 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057600.14.421e-75100.00SMESG000057600.1[more]
SMESG000057600.15.454e-75100.00SMESG000057600.1[more]
SMESG000057599.18.707e-5058.23SMESG000057599.1[more]
SMESG000057599.14.752e-4052.98SMESG000057599.1[more]
SMESG000067773.17.118e-2948.74SMESG000067773.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031100 ID=SMED30031100|Name=SMED30031100|organism=Schmidtea mediterranea sexual|type=transcript|length=357bp
GACATATTGCTGACATAAGATGCGACGAAATGTGTGATAGTGCGAAAGGA
GTCATTGGTTTGCAAGCCGGTTCAAACAAATTTGCAAGTCAAACTGGAAT
GCGAATCGGAACCCAGAGATTCATCAATGACGTCTCAACTGGAGTGGAAA
TAAGTGATTCAGGAAAAAATGTTATTGGCTTACAAGCTGGATCAAATAAA
GGAGCGACACAAGCCGGAATGAGAATTGGAACTCAGAGATTCATCAATGA
TGTTTCAGCTGGAGTTGAGATCAGTGATTCAGGTAAAAATGTTATTGGTC
TTCAAGCGGGTTCAAACAAATTTGCAAGTCAGACTGGAATGAGCATGGGA
GCAGTCA
back to top

protein sequence of SMED30031100-orf-1

>SMED30031100-orf-1 ID=SMED30031100-orf-1|Name=SMED30031100-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=118bp
HIADIRCDEMCDSAKGVIGLQAGSNKFASQTGMRIGTQRFINDVSTGVEI
SDSGKNVIGLQAGSNKGATQAGMRIGTQRFINDVSAGVEISDSGKNVIGL
QAGSNKFASQTGMSMGAV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR003096SM22_calponin
IPR000557Calponin_repeat
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0005516calmodulin binding
Vocabulary: biological process
TermDefinition
GO:0031032actomyosin structure organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003096Smooth muscle protein/calponinPRINTSPR00888SM22CALPONINcoord: 99..114
score: 70.59
coord: 46..59
score: 33.19
IPR000557Calponin repeatPFAMPF00402Calponincoord: 58..81
e-value: 4.6E-11
score: 42.2
coord: 18..41
e-value: 6.9E-11
score: 41.6
coord: 98..117
e-value: 4.5E-9
score: 35.8
IPR000557Calponin repeatPROSITEPS01052CALPONIN_1coord: 98..116
IPR000557Calponin repeatPROSITEPS01052CALPONIN_1coord: 58..76
IPR000557Calponin repeatPROSITEPS51122CALPONIN_2coord: 18..42
score: 10.4
IPR000557Calponin repeatPROSITEPS51122CALPONIN_2coord: 58..82
score: 10.222
IPR000557Calponin repeatPROSITEPS51122CALPONIN_2coord: 98..118
score: 8.958
NoneNo IPR availablePANTHERPTHR47385:SF3coord: 8..43
NoneNo IPR availablePANTHERPTHR47385FAMILY NOT NAMEDcoord: 53..83
coord: 8..43
NoneNo IPR availablePANTHERPTHR47385FAMILY NOT NAMEDcoord: 93..117
NoneNo IPR availablePANTHERPTHR47385:SF3coord: 53..83
NoneNo IPR availablePANTHERPTHR47385:SF3coord: 93..117