Innexin

Overview
NameInnexin
Smed IDSMED30031099
Length (bp)1528
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30031099) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30031099) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30031099) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30031099) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031099

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30031099SMESG000080705.1 AY967612smed_ncbi_20200123PMID:17670787
Oviedo et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30031099SMESG000080705.1 NB.29.3gncbi_smed_estsPMID:17670787
Oviedo et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30031099SMESG000080705.1 dd_Smed_v4_1234_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30031099 Contig26721newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30031099SMESG000080705.1 dd_Smed_v6_1234_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 220.705 bits (561), Expect = 7.673e-67
Identity = 120/371 (32.35%), Postives = 208/371 (56.06%), Query Frame = 1
Query:  196 EDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETY 1308
            +D  D+LN+ ++  I+++  ++V+AK Y   P+ C+V  T +    + Y ENYCWV  T     ++ IP    +      +++I YYQWVPF+L L+ +LFY+P ++W ++ +   G ++++L+  A DS  L    R   L  I   +E+ L+       G   K         N  + ++  G  +   Y  +K LY +N++GQ++L+ +FLG  S    +G  +LND+++G+ W E+ +FPRV+ C + ++K LG V+ +  QC L +NM NEKI++FLWFW  L+   TL S+  W+   V  S++  F  K L   + Y+  ++ ++  F+  +LR DG+FL+RM+  ++G++   E+   LW  Y
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTE-PMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKL-------LNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKW--YGLQVLNDLMNGREWEESGHFPRVTLC-DFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 218.394 bits (555), Expect = 8.091e-66
Identity = 121/376 (32.18%), Postives = 212/376 (56.38%), Query Frame = 1
Query:  196 EDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKM---HQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKN 1314
            +DF D+LN+ ++  IL+   ++V+AK Y   P+ C+V  T +    + Y ENYCWV  T      E IP +         +++I YYQWVPFIL ++ +LFY+P +LW  + Y   G NL+ L+  A D+  +    +   +  + R ++D +      RQG        +    N C   +H G ++   Y  IK LY  NV+ Q +L+   LG N    ++G+++L D++    W +T  FPRV+ C + +++ LG ++ +  QC L +NM NEKI++FLWFW L  GI+T+ + + W++ +   S+   F +K L++   H +   ++++T+  F   +LR DG+F++RMI  ++G+++++E++  LW+ + N
Sbjct:   19 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPREIYS----RRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN-C--GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLC-DFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNN 383          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 216.853 bits (551), Expect = 2.024e-65
Identity = 122/375 (32.53%), Postives = 211/375 (56.27%), Query Frame = 1
Query:  196 EDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSM-FAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNK 1317
            +DF D+LN+ ++  I+    +IV+AK Y   P+ C+V    +   ++ Y ENYCWV  T         P +  D       ++I+YYQWVPF+L L+ + FYIP ++W  + +   G N+++L   A D+  +    R + +  I   +ED L            + +R + +    CV  K    ++   Y FIK LY  NV+ Q++++ SFLG ++    +G+ IL D+++G+ W  + NFPRV+ C + +++ LG V+ +  QC L +NM NEKI++FLWFW  +V  ++ +S+  W++ I FL  + M F +K L+   +   ++  +V  F+ ++L YDG+F +RMI  ++GDI+A E++  LW  + ++
Sbjct:   19 DDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDA-WEQYTENYCWVENTYYLPLTSAFPLEYGD----RRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDAL------------EIQREVTDVSGMCV-QKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLF--YGFHILRDLLNGREWEVSGNFPRVTMC-DFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWII-ISFLPGQHMKFIRKYLR--ATDLATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDR 369          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 216.853 bits (551), Expect = 2.024e-65
Identity = 122/375 (32.53%), Postives = 211/375 (56.27%), Query Frame = 1
Query:  196 EDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSM-FAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNK 1317
            +DF D+LN+ ++  I+    +IV+AK Y   P+ C+V    +   ++ Y ENYCWV  T         P +  D       ++I+YYQWVPF+L L+ + FYIP ++W  + +   G N+++L   A D+  +    R + +  I   +ED L            + +R + +    CV  K    ++   Y FIK LY  NV+ Q++++ SFLG ++    +G+ IL D+++G+ W  + NFPRV+ C + +++ LG V+ +  QC L +NM NEKI++FLWFW  +V  ++ +S+  W++ I FL  + M F +K L+   +   ++  +V  F+ ++L YDG+F +RMI  ++GDI+A E++  LW  + ++
Sbjct:   19 DDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDA-WEQYTENYCWVENTYYLPLTSAFPLEYGD----RRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDAL------------EIQREVTDVSGMCV-QKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLF--YGFHILRDLLNGREWEVSGNFPRVTMC-DFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWII-ISFLPGQHMKFIRKYLR--ATDLATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDR 369          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 218.394 bits (555), Expect = 3.035e-65
Identity = 121/376 (32.18%), Postives = 212/376 (56.38%), Query Frame = 1
Query:  196 EDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKM---HQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKN 1314
            +DF D+LN+ ++  IL+   ++V+AK Y   P+ C+V  T +    + Y ENYCWV  T      E IP +         +++I YYQWVPFIL ++ +LFY+P +LW  + Y   G NL+ L+  A D+  +    +   +  + R ++D +      RQG        +    N C   +H G ++   Y  IK LY  NV+ Q +L+   LG N    ++G+++L D++    W +T  FPRV+ C + +++ LG ++ +  QC L +NM NEKI++FLWFW L  GI+T+ + + W++ +   S+   F +K L++   H +   ++++T+  F   +LR DG+F++RMI  ++G+++++E++  LW+ + N
Sbjct:   71 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPREIYS----RRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN-C--GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLC-DFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNN 435          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 102.064 bits (253), Expect = 2.621e-23
Identity = 86/320 (26.88%), Postives = 142/320 (44.38%), Query Frame = 1
Query:  265 TAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERI----------PDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLI-----TAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTIL--NDIISGKSWHE-TRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQ 1170
            T++ Y   P+ C V   P G+     M+ YCW++ T  F   ER+          P         D  K   YYQWV F+L  Q ILFY+P+ LW+    +  G  L+ L+         D  K   ++RK +L               DY  G + +         NF  F           +F  + L  +NVIGQ+Y +  FL  +   S++G  +L   ++   +      R FP+V+ C        G+V T+   C LP+N++NEKIY+FLWFW +++ I++ +S++  +  +     R +  +   ++ +S +
Sbjct:   43 TSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYST--FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECK---NDRKKIL--------------VDYFIGNLNRH--------NFYAFR----------FFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAESEE 314          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 102.064 bits (253), Expect = 2.621e-23
Identity = 86/320 (26.88%), Postives = 142/320 (44.38%), Query Frame = 1
Query:  265 TAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERI----------PDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLI-----TAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTIL--NDIISGKSWHE-TRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQ 1170
            T++ Y   P+ C V   P G+     M+ YCW++ T  F   ER+          P         D  K   YYQWV F+L  Q ILFY+P+ LW+    +  G  L+ L+         D  K   ++RK +L               DY  G + +         NF  F           +F  + L  +NVIGQ+Y +  FL  +   S++G  +L   ++   +      R FP+V+ C        G+V T+   C LP+N++NEKIY+FLWFW +++ I++ +S++  +  +     R +  +   ++ +S +
Sbjct:   43 TSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYST--FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECK---NDRKKIL--------------VDYFIGNLNRH--------NFYAFR----------FFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAESEE 314          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 102.064 bits (253), Expect = 2.621e-23
Identity = 86/320 (26.88%), Postives = 142/320 (44.38%), Query Frame = 1
Query:  265 TAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERI----------PDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLI-----TAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTIL--NDIISGKSWHE-TRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQ 1170
            T++ Y   P+ C V   P G+     M+ YCW++ T  F   ER+          P         D  K   YYQWV F+L  Q ILFY+P+ LW+    +  G  L+ L+         D  K   ++RK +L               DY  G + +         NF  F           +F  + L  +NVIGQ+Y +  FL  +   S++G  +L   ++   +      R FP+V+ C        G+V T+   C LP+N++NEKIY+FLWFW +++ I++ +S++  +  +     R +  +   ++ +S +
Sbjct:   43 TSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYST--FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECK---NDRKKIL--------------VDYFIGNLNRH--------NFYAFR----------FFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAESEE 314          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 102.064 bits (253), Expect = 2.621e-23
Identity = 86/320 (26.88%), Postives = 142/320 (44.38%), Query Frame = 1
Query:  265 TAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERI----------PDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLI-----TAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTIL--NDIISGKSWHE-TRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQ 1170
            T++ Y   P+ C V   P G+     M+ YCW++ T  F   ER+          P         D  K   YYQWV F+L  Q ILFY+P+ LW+    +  G  L+ L+         D  K   ++RK +L               DY  G + +         NF  F           +F  + L  +NVIGQ+Y +  FL  +   S++G  +L   ++   +      R FP+V+ C        G+V T+   C LP+N++NEKIY+FLWFW +++ I++ +S++  +  +     R +  +   ++ +S +
Sbjct:   43 TSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYST--FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVNDECK---NDRKKIL--------------VDYFIGNLNRH--------NFYAFR----------FFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAESEE 314          
BLAST of Innexin vs. Ensembl Fly
Match: ogre (gene:FBgn0004646 transcript:FBtr0071037)

HSP 1 Score: 93.5893 bits (231), Expect = 2.008e-20
Identity = 88/308 (28.57%), Postives = 134/308 (43.51%), Query Frame = 1
Query:  175 LSSYAGLEDFAD-----RLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERI--------PDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTI--LNDIISGKSWHE-TRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFW 1050
            L SY   +D        RL+  F+ V+L    +I+TA  Y  +P+SC V   P  +     +  +CW+H T    +  R         P    D+   DA K  TYYQWV F+L  Q +  Y PK LW     NK    L  +I    + +     E+++  + ++    D L +H   ++ K+   R   Y  C F                    L  IN+I Q+YLM  F  F+    S+G  I  L+D+   +        FPRV+ C        G++  + + C LP+N++NEK Y+F+WFW
Sbjct:    8 LKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISCIVNGVPPHV-----VNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLW-----NKFEGGLMRMIVMGLNITICTREEKEAKRDALL----DYLIKH--VKRHKLYAIR---YWACEF--------------------LCCINIIVQMYLMNRF--FDGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 9.761e-66
Identity = 120/371 (32.35%), Postives = 208/371 (56.06%), Query Frame = 1
Query:  196 EDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETY 1308
            +D  D+LN+ ++  I+++  ++V+AK Y   P+ C+V  T +    + Y ENYCWV  T     ++ IP    +      +++I YYQWVPF+L L+ +LFY+P ++W ++ +   G ++++L+  A DS  L    R   L  I   +E+ L+       G   K         N  + ++  G  +   Y  +K LY +N++GQ++L+ +FLG  S    +G  +LND+++G+ W E+ +FPRV+ C + ++K LG V+ +  QC L +NM NEKI++FLWFW  L+   TL S+  W+   V  S++  F  K L   + Y+  ++ ++  F+  +LR DG+FL+RM+  ++G++   E+   LW  Y
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTE-PMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKL-------LNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKW--YGLQVLNDLMNGREWEESGHFPRVTLC-DFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 7.305e-63
Identity = 124/378 (32.80%), Postives = 217/378 (57.41%), Query Frame = 1
Query:  196 EDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDA-DKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSM-FAKKLLKM---HQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKN 1314
            +DF D+LN+ ++  IL+   ++V+AK Y   P+ C+V  T +    + Y ENYCWV  T      E IP +     I+   +++I YYQWVPFIL ++ +LFY+P +LW  + Y   G NL+ L+  A D+  +    +   +  + R ++D +      RQG        +    N C   +H G ++   Y  IK LY  NV+ Q +L+   LG N    ++G+++L D++    W +T  FPRV+ C + +++ LG ++ +  QC L +NM NEKI++FLWFW L  GI+T+ + + W++ I+F+  + M F +K L++   H +   ++++T+  F   +LR DG+F++RMI  ++G+++++E++  LW+ + N
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPRE-----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN-C--GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLC-DFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWIL-IMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNN 503          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|A8WVX4|INX19_CAEBR (Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=inx-19 PE=3 SV=3)

HSP 1 Score: 199.134 bits (505), Expect = 6.270e-57
Identity = 126/422 (29.86%), Postives = 233/422 (55.21%), Query Frame = 1
Query:  136 VAQEFLSLIDQFKLSSYAGLEDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGT--IPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPP-SERKSVLNNIV-RIIEDLLYQHRDYR---QGKMAKARRRIYEYCNFCVFSKHLGTWLVS-TYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQS--YQRSENLT------------------VNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNK 1317
            +A+ F+S +      S  G +D  DRLN+ ++ +IL++  ++++AK Y   P+ C+V    S  + + Y+E+YCW+  T  IP  EN  +PD          +K+I YYQWVPFIL  + ++F +P + W + C  + G N++TLI AA D+  L   S+R+  +  I    +++L  Q  + R   +G +A+ +           FS+ L    +S  Y F K LY +NV+ Q +++ + L  +S    FG+ +L+DI +G+ W ET +FPRV+ C + ++++L  +N Y  QC L +N++NEK++ FLW W +++ IIT  S + W+      S++  +  K +++ +S  Y++ +                     ++ F+ ++L+ DG+ ++RMI  ++GD++  +++  LW+ Y+ +
Sbjct:    7 LARSFISAL------SVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYEN--VPDDHTA----REEKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLC-DFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRER 401          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O61715|INX19_CAEEL (Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=inx-19 PE=1 SV=2)

HSP 1 Score: 194.126 bits (492), Expect = 7.325e-55
Identity = 128/408 (31.37%), Postives = 224/408 (54.90%), Query Frame = 1
Query:  181 SYAGLEDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGT--IPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKL-PPSERKSVLNNIV-RIIEDLLYQHRDYR---QGKMAKARRRIYEYCNFCVFSKHL-GTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQW-------------VVRIVFLSKRSMFAKKLLKMHQSYQRSENLTV--------NHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNK 1317
            S  G +D  DRLN+ ++ +IL++  ++++AK Y   P+ C+V    S  + + Y+E+YCW+  T  IP  EN  +PD          +K+I YYQWVPFIL  + ++F +P + W + C  + G N++TLI AA D   L   S+R+  +  I    +++L  Q  + R   +G +A+ +           FS+ L G  L   + F K LY +NV+ Q  ++ + L  +S    FG+ +LNDI +G+ W ET +FPRV+ C + ++++L  +N Y  QC L +N++NEK++ FLW W +++ IIT  S + W             V++ + +++ S F KKL K  +        TV        + F+ ++L+ DG+ ++RMI  ++GD++  +++  LW+ ++ +
Sbjct:   32 SVRGDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYEN--VPDDHTA----REEKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLC-DFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEF-KKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRER 417          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 9.153e-54
Identity = 118/387 (30.49%), Postives = 205/387 (52.97%), Query Frame = 1
Query:  196 EDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLG--TWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKM------HQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD 1332
            +D++DRLN++ +  IL    V+++ K +  +P+ C       G +++ Y ENYCW   T  F+E  +     +    +  D++++YYQWVPF L LQ   F  P  LW+    N  G  +  ++  A DS+ +    R+    NI+ +   L    R   Q  M + + ++++   F  F    G  +W+   Y F K LY +NV  QLYLM  FLG N     +G+ ++ DI+ G+ W  +  FPR + C + +++ +  +  Y  QC L +N+ NEKI++ LWFW +++ + + +S++QW + +VF      F K+ L +      +Q   R E+  V+ F+ +YL  DG+F++RM+  ++G I A +++  L+E Y  +  N D
Sbjct:   20 DDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPG-SWEQYAENYCWSQDTY-FVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFS-NHSGIRIHEVVEKAKDSANVEEEVRE---KNILILKRHLSSALR--FQANMERKKVQVHKTVTFLNFQYSSGFISWI---YLFTKVLYFLNVFAQLYLMNYFLGTNRH-HWYGFGVVQDIVQGEPWERSGYFPRAAVC-DFEVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYDFQDKNKD 393          
BLAST of Innexin vs. TrEMBL
Match: Q2L6M7 (Innexin OS=Dugesia japonica OX=6161 GN=inx8 PE=2 SV=1)

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 301/429 (70.16%), Postives = 368/429 (85.78%), Query Frame = 1
Query:  133 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQD-DKSFDNTLKNDS 1416
            MVA+EF SL+ +FK+SSY G+EDFAD++NF+FSVV++ LSM++VT K+YFFKPLSCY+ATTPSG  FD Y+ENYCWVHGTIP L  E IP K  +WA WDA+KRITYYQWVPFILGLQCI+FY PK++W+IICYNK+GTNLE L+  A ++SK PP +RK++L+ I R IED+LYQHRDYRQGK+A  RR +Y  CNF VFSKHLGTWLV +YFFIK LYGINVIGQLYLMKSFLGF++S++ FGYTIL ++++GK WH+T  FPRVSYCYNADI+HLG+ N YV+QCTLP+NMLNEKIY+FLWFWVLLVGIITL+SI+ W++++VFLSKRS F KKLLKMHQSY+R++ L VN FIKEYLR+DG+FLIRMI IN+GDIV AEIL  LWE YK KYI+ DF N+NNY+KL +   + D+S +NTLKN+S
Sbjct:    1 MVAEEFFSLLSEFKVSSYVGVEDFADKMNFMFSVVLIILSMMVVTVKSYFFKPLSCYIATTPSGSGFDNYIENYCWVHGTIPILPGENIPQKTNEWAEWDANKRITYYQWVPFILGLQCIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKSPPEDRKALLDRISRTIEDMLYQHRDYRQGKIANTRRALYSRCNFLVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFDNSLTYFGYTILENMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNAYVSQCTLPINMLNEKIYVFLWFWVLLVGIITLISIISWLIKMVFLSKRSSFIKKLLKMHQSYKRTDQLLVNQFIKEYLRHDGVFLIRMICINAGDIVTAEILGTLWEIYKEKYIDSDFRNFNNYKKLNNSESNPDESCNNTLKNNS 429          
BLAST of Innexin vs. TrEMBL
Match: Q2L6M6 (Innexin OS=Dugesia japonica OX=6161 GN=inx9 PE=2 SV=1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 284/434 (65.44%), Postives = 343/434 (79.03%), Query Frame = 1
Query:  133 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEK---LISG---RQDDKSFDNTLKNDS 1416
            MVAQEFLSL+ QFKL+SY G+EDFAD+LNF+FSVVIL +SM++VT K+YFFKPL+CY+ATTPSG NFD Y+ENYCWVHGTI  L  E IP    DWAI D  KRITYYQWVPFILGLQCI+FY+P+++W++ICYNK+GTNLE+L   A  +S  PPSERK  +  IVR IED+L+QHRDYRQGKMA  RR IY+ CNFCVFSKH+GTWLV +Y  +K +YGINVIGQL+LMK FLGFNSSMSSFGYTIL++I  GK WH+T  FPRV+YCY  +IKHLGA N YV QC LP+NMLNEKIY+FLWFWV LVGIIT +SI  W  RI  LS+RS F KK L MHQ+Y RS+   +N FI+E+LR+DG+FLIRMI IN+GDIV A+I+N LWE YK  Y N DF N++ Y K   + +G    Q+  S D ++K ++
Sbjct:    1 MVAQEFLSLVGQFKLTSYVGVEDFADKLNFLFSVVILIISMMVVTVKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDADWAIVDQTKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPSERKDKIERIVRTIEDMLFQHRDYRQGKMADMRRNIYKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYVGQCALPINMLNEKIYVFLWFWVFLVGIITAISIPMWFFRIAILSRRSSFIKKFLMMHQAYNRSDKQLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKNMDFLNFSAYPKPMDMTTGLRRNQNISSSDESIKKEN 434          
BLAST of Innexin vs. TrEMBL
Match: H2KV19 (Innexin OS=Clonorchis sinensis OX=79923 GN=inx PE=3 SV=1)

HSP 1 Score: 439.113 bits (1128), Expect = 1.328e-147
Identity = 195/431 (45.24%), Postives = 302/431 (70.07%), Query Frame = 1
Query:  133 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKSFDNTLKNDSNSQ 1425
            MVA EFL  +++  +  Y G+EDFAD+L+F++SV++L L   IVT K Y    ++CY+ T PSG +FD ++EN+CWVHGTIP L NE IP   ++WA +D   RI YYQWVPF+LGLQC+LFYIP+++W++IC N+ GT++E L+  A  +S   P++R  +++++   ++ +LYQHR+YR G++ +A++R+++ C   V SK LGTWL  TYF IK LY  N +GQLYLM+ FLGFN+++++FG  + + ++SG++W +TR FPR+S+CY AD++ LG+ N YVAQC LPVNMLNEK+YIFLW+W  +V I+T  SI  W++R+ F   R  F KK L++++ + RS+   V  F + +LR+DG+F++RMI +N+GD++ +E+++ LW+ +   Y  H  T  +  E        + + D  L+ + N++
Sbjct:    1 MVAAEFLDFLNKLHVPDYIGVEDFADKLSFLYSVLVLMLCTTIVTVKQYLMSAIACYIPTVPSGSDFDKFLENFCWVHGTIPLLSNELIPQTMDEWAYFDDKYRINYYQWVPFMLGLQCMLFYIPRIVWQLICCNRTGTDIEHLVVVAHQASNASPTDRSKLVSHVTASLKGMLYQHREYRHGRVLEAKKRLFDACGLLVVSKRLGTWLAFTYFVIKLLYLTNSVGQLYLMQRFLGFNATLTNFGAKLADYMLSGRNWEQTRIFPRISFCYFADLRQLGSTNRYVAQCVLPVNMLNEKLYIFLWYWTAMVAILTAFSIPLWLMRLTFAKSRVRFIKKFLRINEQFHRSDKQLVKDFTENFLRHDGIFILRMISMNAGDVITSEVVSELWKGF---YAQHRSTEPDGPEPSAPLPMAEHNEDKALEKNRNAR 428          
BLAST of Innexin vs. TrEMBL
Match: A0A564YPR7 (Innexin OS=Hymenolepis diminuta OX=6216 GN=inx PE=3 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 2.172e-147
Identity = 197/403 (48.88%), Postives = 286/403 (70.97%), Query Frame = 1
Query:  133 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTN 1341
            MV  EF+  + + +++ + GLEDFAD+++F++SV+IL L   I+  K Y    ++CY+ T PSG +FD +++N+CWVHGTIP LE E IP    +W   D + RI YYQWVPF+LGLQCILFYIP+++W+IICYN+ GT+LE LI+ A  +S     +R+S++ ++   + ++L+QHRDYR G++A ARR+ +++C   V SK LGTWL+ TY FIKC+Y  N IGQLYLM++FLGFN SM++FGY +   +I+GK W ETR FPRVS+CY   ++HLG  N YVAQC LPVNMLNEK+YIFLWFW  +V   T +SI  W++R+     +  F KK L++ + Y   +   +++F  ++LR+DG+FL+RMI +N+GD+V A+++  +W+ YK K+ N    N
Sbjct:    1 MVGVEFIDYLTKLRVNDFLGLEDFADKMSFMYSVLILLLCTTIIAVKQYLLASIACYIPTVPSGKDFDKFLQNFCWVHGTIPLLEGEHIPQNFSEWDEADKNLRINYYQWVPFMLGLQCILFYIPRVIWQIICYNRTGTDLENLISIANKASNTIEGDRQSLVKHVAGTMAEMLFQHRDYRVGRVADARRKAFKFCGVFVASKRLGTWLIFTYLFIKCIYLANAIGQLYLMQTFLGFNKSMTNFGYEVAKYMINGKDWDETRIFPRVSFCYVEHVRHLGTTNRYVAQCVLPVNMLNEKLYIFLWFWTAIVAFCTAVSIPLWIMRLGRQKNKEHFIKKFLRLQEIYNTKDREILHNFTSDFLRHDGVFLLRMISMNAGDVVTADVIVKMWDIYKTKFKNRIMLN 403          
BLAST of Innexin vs. TrEMBL
Match: A0A4E0RLV9 (Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 2.639e-147
Identity = 193/396 (48.74%), Postives = 288/396 (72.73%), Query Frame = 1
Query:  133 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKY 1320
            MVA EF   + +F +  Y G+EDFAD+L+F++SV+I+ +  ++VT K Y F P++CY+ T PSG +FD ++E++CWV GTIP L  ++IP   ++WA +D   RI YYQW+PF+LGLQ ++FYIP+++W++IC ++ GT+LE L+T A  +S+  P ERK ++ ++   +E +LYQHR+YR GK    ++R+Y+ C   V SK LGTWL  +YF IK  Y  N +GQLY+M+ FLGFN +M +FG  + + ++ G++W +TR FPR+S+CY ADI+ LG+VN YVAQC LPVNMLNEK+YIFLW+W  LV I T +SI  WV+R+  L  R  F KK L++H+ +Q+++ L +  F +EYLR+DG+FL+RMI +NSGD++ +E+++ LW+ Y  K+
Sbjct:    1 MVAAEFFDYVFKFHIPDYVGVEDFADKLSFLYSVLIMFICTLVVTVKQYLFSPIACYIPTVPSGTDFDKFLESFCWVQGTIPILAGDKIPQTFDEWAYFDRKYRINYYQWIPFMLGLQGMMFYIPRIMWQMICSHRTGTDLEHLVTVANQASQSGPDERKKLVTHVASSMEAMLYQHREYRTGKCTNIKQRVYKVCGLLVVSKRLGTWLAFSYFIIKLCYLANSVGQLYMMQRFLGFNETMGNFGAQLASYMLEGRNWEQTRIFPRISFCYLADIRQLGSVNRYVAQCVLPVNMLNEKLYIFLWYWTSLVAICTAVSIPLWVIRLGILRNRVYFIKKFLRIHEQFQKADKLLLKSFTREYLRHDGIFLLRMISMNSGDVITSEVVSELWKMYCAKH 396          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000080788.1 (SMESG000080788.1)

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 257/416 (61.78%), Postives = 327/416 (78.61%), Query Frame = 1
Query:  133 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQD 1380
            MVA+EFL+LI QFK+S+Y G+EDFAD+L+F+FSV +L LSM++VT K+Y FKPL+CY AT P G NF+ Y+ENYCWVHGTI FL  E IP    DWA  D  +RI YYQWVPFILGLQC +FYIPK++W+IICYNK GTNLE+++  A  ++  PP ERK  +  I R IED+L+QHRDYRQG  AK RR+IY  CNFCVFSKH+GTWL+ +Y  IK LYG+NVIGQL++MK FLGFN+S SSFGYT+L+++ISGK WH+T  FPRV+YCY  +IKH+G  N YVAQC LPVNMLNEKIY+FLWFW++LVGI+T +SI  W  R+ FLS+RS F K+ L MHQ+Y+RS+   +N+FI+E+LR+DG+FL+RM++IN+GDI+ A+I+N L E YK  Y + DF NY  Y K +    D
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCFMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKIYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNSTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGD 416          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000080705.1 (SMESG000080705.1)

HSP 1 Score: 511.146 bits (1315), Expect = 0.000e+0
Identity = 249/249 (100.00%), Postives = 249/249 (100.00%), Query Frame = 1
Query:  685 MAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL 1431
            MAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL
Sbjct:    1 MAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL 249          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000053975.1 (SMESG000053975.1)

HSP 1 Score: 391.349 bits (1004), Expect = 2.367e-132
Identity = 204/437 (46.68%), Postives = 279/437 (63.84%), Query Frame = 1
Query:  133 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKSFDNTLKND------SNSQ 1425
            MVA EF SLI++       GLED AD+++ IFSV+ILS+ + IVT K+Y  KP+SCY++  PSG NF  Y+ENYCW+HGTIP   N+++ D    W   +  ++I YYQWVPFILGLQCI+FYIPKL+W+I C+N+ GTNL+T+I  +   +++P SER+    NI +IIE++L  HRD+R  K+A  RR +Y  C+  + SK LGT +V +YF  K LY  N IGQL++++S LGF + + +FG  +   I+SG        FPRV +CY   I+H+G  N YVAQC LPVNMLNEKIY FLW W+LLV   T +SI  W+ R+     R  +    L+M  SY   +   ++ FI ++LR+DGLFL+RMI  N+GD++AA ++N LW+ Y  KY N +             R+D  S  N LK D      SNSQ
Sbjct:    1 MVANEFFSLINRLNAVHNYGLEDLADKMSSIFSVLILSVCVSIVTIKSYVIKPISCYLSIGPSGGNFQDYIENYCWIHGTIPLYPNQKLSDNHVGWDELERTQKINYYQWVPFILGLQCIMFYIPKLIWQIFCFNQAGTNLDTIIKLSMKMAEIPISERRVENENIAKIIENMLVLHRDFRDSKIANIRRSVYSKCSLFMSSKRLGTMIVFSYFVTKLLYLTNGIGQLFMIQSVLGFYNYLPTFGSHLFWYIVSGTELETQHYFPRVVFCYLKRIRHVGVQNNYVAQCVLPVNMLNEKIYTFLWCWILLVSFATFISIPLWINRLYRADVREHYIGNFLQMLNSYDEHKKPLIHKFINDFLRHDGLFLLRMISNNAGDLIAAYLVNNLWDIYLKKYQNRNL------------RKDIFSVSNHLKEDEANNSTSNSQ 425          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000065083.1 (SMESG000065083.1)

HSP 1 Score: 375.941 bits (964), Expect = 3.534e-126
Identity = 190/422 (45.02%), Postives = 274/422 (64.93%), Query Frame = 1
Query:  133 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNS-SMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQ--SYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKS 1389
            MVA EFL  + + ++S+  GLED  DRLNF FSV++L + ++IVT K Y FKP+SCY+     G N   Y+EN CWV GTI      + P   E+W   +  K + YYQWVPF+LGLQCI+FY+PKL+W+IICYN+ GT+++ L+ +A  +       R  +++ + + +E LLYQHRD+R GK+AK RR+I+    F + SK +GTWLVS+Y  +K  Y  N   QL +M+ FLGF+  ++ +FG  + N+I SG  W  T  FPRVSYC+   + HLG +N+ VAQC LPVNMLNE+IY FLW W+L+V  +T+LSI  W++RI+ +  R  F ++ L + +  +  + EN  +  F  ++LR+DG+FL++MI +N+GDI+ +EI+  LW  YK  Y+N +F N        S   DDKS
Sbjct:    1 MVASEFLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEKHKML-YYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCF-VKVTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYRRHFIRQFLIISEEITKDQKENYLLAKFESQFLRHDGIFLLKMISLNAGDIITSEIVCQLWNIYKTNYVNRNFLNDG------SDEDDDKS 414          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000066858.1 (SMESG000066858.1)

HSP 1 Score: 369.007 bits (946), Expect = 1.104e-123
Identity = 176/427 (41.22%), Postives = 278/427 (65.11%), Query Frame = 1
Query:  133 MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFXXXXXXXXXXXXTAKAYFFKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWDADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATDSSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCVFSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFN-SSMSSFGYTILNDIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIYIFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSENLTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHDFTNYNNYEKLISGRQDDKSFDNTLKN 1410
            MVA   L LI   K++ Y GLED  D+++F  SV+I  +   IVT+K Y  KPLSCY A +P+G NFDGY+ NYCW+ GT+P++  ++ P   +D  + D+ K+I YYQWVPF+L LQCI+FY+P+L W+++ YNK+G +LE +   A+ +S    + RK     I + + ++ + HRDY+ G  A  RR+I+++ +F + SK LGTWL   YF +K ++  N +GQLYL++ FLGF+ +++        + +++G  W  +R FPRV+ C   +IK LG  N Y+ QC L  NMLNEKIY+FLWFW+ +V ++TL++I  W  +I+FL  R+ F KK LK H+ Y++S+  ++++FI+ +LR+DG F+I M+ +N GD++ + +++ LWE Y+++Y N D ++  + + L         F   +KN
Sbjct:    1 MVANTLLDLIKSHKVTDYQGLEDIGDKISFQISVIIYIICGFIVTSKTYILKPLSCYTAISPTGSNFDGYLRNYCWITGTVPWVPGDKFPQVGDDMKLDDSLKKINYYQWVPFVLALQCIMFYLPRLFWQLMSYNKIGIDLELIFKDASSASNDDEAARKKKAKGIAKNLANVFFFHRDYKYGTWANFRRKIFKFASFFMMSKRLGTWLTYWYFVMKLMFLANAVGQLYLIQRFLGFHGNNIFETSRVFFDSLVNGVQWTTSRLFPRVTVCSIDNIKLLGVENNYITQCVLSQNMLNEKIYMFLWFWLHIVIVVTLITIGLWCKKIIFLGSRAEFIKKFLKNHEVYRKSKRDSLDNFIQTFLRHDGSFIIMMMTMNCGDLITSHVVSELWEIYQSEYANSDTSSEKDPQLLKIYPNISSDFSEPMKN 427          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-97.673e-6732.35Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
unc-78.091e-6632.18Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
inx-12.024e-6532.53Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-12.024e-6532.53Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-73.035e-6532.18Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx22.621e-2326.88gene:FBgn0027108 transcript:FBtr0301860[more]
Inx22.621e-2326.88gene:FBgn0027108 transcript:FBtr0071005[more]
Inx22.621e-2326.88gene:FBgn0027108 transcript:FBtr0332314[more]
Inx22.621e-2326.88gene:FBgn0027108 transcript:FBtr0071006[more]
ogre2.008e-2028.57gene:FBgn0004646 transcript:FBtr0071037[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL9.761e-6632.35Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL7.305e-6332.80Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|A8WVX4|INX19_CAEBR6.270e-5729.86Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=i... [more]
sp|O61715|INX19_CAEEL7.325e-5531.37Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|Q23157|INX11_CAEEL9.153e-5430.49Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q2L6M70.000e+070.16Innexin OS=Dugesia japonica OX=6161 GN=inx8 PE=2 S... [more]
Q2L6M60.000e+065.44Innexin OS=Dugesia japonica OX=6161 GN=inx9 PE=2 S... [more]
H2KV191.328e-14745.24Innexin OS=Clonorchis sinensis OX=79923 GN=inx PE=... [more]
A0A564YPR72.172e-14748.88Innexin OS=Hymenolepis diminuta OX=6216 GN=inx PE=... [more]
A0A4E0RLV92.639e-14748.74Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 S... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080788.10.000e+061.78SMESG000080788.1[more]
SMESG000080705.10.000e+0100.00SMESG000080705.1[more]
SMESG000053975.12.367e-13246.68SMESG000053975.1[more]
SMESG000065083.13.534e-12645.02SMESG000065083.1[more]
SMESG000066858.11.104e-12341.22SMESG000066858.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031099 ID=SMED30031099|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1528bp
CTTACAGTTAATCACCGTGTCAGTCATTGTTTATATTGTGTTTATATTCA
TTGTGAATATTTCGGAAGTCGTCTTAAATACAAAACTCTAAAGTTTAGTT
AAGAATTATAATTATTTGGCATTAACAGAATAATGGTGGCACAAGAATTC
TTGTCTCTAATTGATCAGTTCAAACTTTCTTCGTATGCAGGCCTTGAAGA
CTTTGCAGATAGGCTGAACTTCATTTTCAGTGTCGTCATCCTGTCATTGT
CAATGGTAATTGTTACAGCAAAAGCTTACTTTTTCAAGCCATTGTCATGT
TATGTGGCAACGACACCGTCAGGTATGAATTTCGACGGTTACATGGAAAA
TTATTGCTGGGTTCATGGAACTATTCCGTTTTTGGAAAATGAAAGAATAC
CTGATAAACCCGAAGATTGGGCAATTTGGGATGCAGACAAACGAATAACA
TACTATCAATGGGTTCCATTCATTTTGGGATTGCAATGCATATTATTCTA
CATTCCGAAACTGCTATGGGAAATAATATGTTATAATAAACTCGGAACAA
ATCTTGAAACTTTAATCACAGCTGCAACTGACTCCTCCAAGTTACCACCA
TCAGAACGAAAATCTGTTTTAAATAATATAGTTCGAATAATTGAGGATTT
GCTCTATCAACACAGAGATTACCGCCAAGGAAAAATGGCTAAAGCTCGTC
GAAGGATCTACGAATATTGTAATTTCTGTGTATTTTCCAAACATCTTGGA
ACTTGGTTGGTTTCAACTTATTTCTTTATCAAGTGTCTTTATGGAATCAA
TGTGATTGGGCAACTCTATTTAATGAAATCATTTTTGGGATTTAACAGCT
CAATGTCGTCTTTTGGCTATACGATTCTTAATGACATCATAAGTGGTAAA
TCTTGGCATGAGACTCGAAACTTTCCTCGAGTTAGTTATTGTTACAATGC
CGATATCAAGCACCTTGGAGCAGTAAACACTTACGTTGCGCAATGCACGC
TTCCCGTAAATATGTTGAATGAAAAGATTTATATCTTTCTATGGTTTTGG
GTATTGCTAGTCGGCATTATAACGTTACTCAGTATTCTCCAGTGGGTTGT
AAGAATTGTTTTCTTGTCAAAGAGAAGCATGTTTGCTAAAAAACTTCTAA
AAATGCACCAGTCTTATCAAAGATCTGAAAATTTGACTGTCAATCATTTC
ATTAAAGAATATCTGAGATATGATGGACTGTTTTTGATAAGAATGATTTA
TATAAATTCCGGAGATATTGTTGCCGCGGAAATTCTCAATGGACTGTGGG
AAACATATAAAAACAAGTACATTAATCACGATTTTACTAATTACAACAAC
TACGAAAAATTAATTTCTGGTCGACAGGACGACAAATCTTTCGACAACAC
TTTGAAAAATGACTCAAATTCACAATTACTATGATTTGGAAACTCATTTT
CATTCACAATTGATTGTTAACATTTTTTTATTTCATAAAATTCTCTGCTA
AATAAAACATGAAAATGTTAAAAAAAAA
back to top

protein sequence of SMED30031099-orf-1

>SMED30031099-orf-1 ID=SMED30031099-orf-1|Name=SMED30031099-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=434bp
MVAQEFLSLIDQFKLSSYAGLEDFADRLNFIFSVVILSLSMVIVTAKAYF
FKPLSCYVATTPSGMNFDGYMENYCWVHGTIPFLENERIPDKPEDWAIWD
ADKRITYYQWVPFILGLQCILFYIPKLLWEIICYNKLGTNLETLITAATD
SSKLPPSERKSVLNNIVRIIEDLLYQHRDYRQGKMAKARRRIYEYCNFCV
FSKHLGTWLVSTYFFIKCLYGINVIGQLYLMKSFLGFNSSMSSFGYTILN
DIISGKSWHETRNFPRVSYCYNADIKHLGAVNTYVAQCTLPVNMLNEKIY
IFLWFWVLLVGIITLLSILQWVVRIVFLSKRSMFAKKLLKMHQSYQRSEN
LTVNHFIKEYLRYDGLFLIRMIYINSGDIVAAEILNGLWETYKNKYINHD
FTNYNNYEKLISGRQDDKSFDNTLKNDSNSQLL*
back to top
Aliases
The feature 'Innexin' has the following synonyms
Synonym
Dj-inx8
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005921gap junction
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 104..120
score: 59.53
coord: 29..43
score: 44.8
coord: 79..88
score: 49.2
IPR000990InnexinPFAMPF00876Innexincoord: 14..208
e-value: 8.2E-61
score: 206.2
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 8..231
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 1..214
score: 19.045
NoneNo IPR availablePANTHERPTHR11893:SF36INNEXIN-5coord: 8..231
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 117..139