40S ribosomal protein S12

Overview
Name40S ribosomal protein S12
Smed IDSMED30031089
Length (bp)491
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 40S ribosomal protein S12 (SMED30031089) t-SNE clustered cells

Violin plots show distribution of expression levels for 40S ribosomal protein S12 (SMED30031089) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 40S ribosomal protein S12 (SMED30031089) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 40S ribosomal protein S12 (SMED30031089) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031089

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031089SMESG000052688.1 SmedASXL_018690SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30031089SMESG000052688.1 dd_Smed_v4_268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031089SMESG000052688.1 dd_Smed_v4_268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031089SMESG000052688.1 dd_Smed_v4_268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031089SMESG000052688.1 dd_Smed_v4_268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031089SMESG000052688.1 dd_Smed_v4_268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031089SMESG000052688.1 dd_Smed_v4_268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031089SMESG000052688.1 dd_Smed_v4_268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031089SMESG000052688.1 dd_Smed_v4_268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031089SMESG000052688.1 dd_Smed_v4_268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031089SMESG000052688.1 dd_Smed_v4_268_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031089SMESG000052688.1 dd_Smed_v6_268_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30031089SMESG000052688.1 dd_Smed_v6_268_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 40S ribosomal protein S12 vs. Ensembl Human
Match: RPS12 (ribosomal protein S12 [Source:HGNC Symbol;Acc:HGNC:10385])

HSP 1 Score: 111.309 bits (277), Expect = 1.844e-31
Identity = 53/100 (53.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +Q VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VV+ +
Sbjct:   14 VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD 113          
BLAST of 40S ribosomal protein S12 vs. Ensembl Celegans
Match: rps-12 (40S ribosomal protein S12 [Source:UniProtKB/Swiss-Prot;Acc:P49196])

HSP 1 Score: 109.383 bits (272), Expect = 4.313e-31
Identity = 50/103 (48.54%), Postives = 69/103 (66.99%), Query Frame = 2
Query:   89 DSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNN 397
            +  +++VL+ A    GL  G+H+T KAL+ ++A  C+LA+NCD+  Y KL+E LC EH IPL+KV   K +GEY GLCK DK+   RK V CSS V++N  N 
Sbjct:   23 EGALRAVLRAAHHADGLAKGLHETCKALDKREAHFCVLAENCDEPQYVKLVETLCAEHQIPLIKVADKKIIGEYCGLCKYDKEGKARKVVGCSSAVVTNWGNE 125          
BLAST of 40S ribosomal protein S12 vs. Ensembl Celegans
Match: rps-12 (40S ribosomal protein S12 [Source:UniProtKB/Swiss-Prot;Acc:P49196])

HSP 1 Score: 109.383 bits (272), Expect = 4.313e-31
Identity = 50/103 (48.54%), Postives = 69/103 (66.99%), Query Frame = 2
Query:   89 DSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNN 397
            +  +++VL+ A    GL  G+H+T KAL+ ++A  C+LA+NCD+  Y KL+E LC EH IPL+KV   K +GEY GLCK DK+   RK V CSS V++N  N 
Sbjct:   23 EGALRAVLRAAHHADGLAKGLHETCKALDKREAHFCVLAENCDEPQYVKLVETLCAEHQIPLIKVADKKIIGEYCGLCKYDKEGKARKVVGCSSAVVTNWGNE 125          
BLAST of 40S ribosomal protein S12 vs. Ensembl Celegans
Match: rps-12 (40S ribosomal protein S12 [Source:UniProtKB/Swiss-Prot;Acc:P49196])

HSP 1 Score: 109.383 bits (272), Expect = 4.313e-31
Identity = 50/103 (48.54%), Postives = 69/103 (66.99%), Query Frame = 2
Query:   89 DSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNN 397
            +  +++VL+ A    GL  G+H+T KAL+ ++A  C+LA+NCD+  Y KL+E LC EH IPL+KV   K +GEY GLCK DK+   RK V CSS V++N  N 
Sbjct:   23 EGALRAVLRAAHHADGLAKGLHETCKALDKREAHFCVLAENCDEPQYVKLVETLCAEHQIPLIKVADKKIIGEYCGLCKYDKEGKARKVVGCSSAVVTNWGNE 125          
BLAST of 40S ribosomal protein S12 vs. Ensembl Celegans
Match: rps-12 (40S ribosomal protein S12 [Source:UniProtKB/Swiss-Prot;Acc:P49196])

HSP 1 Score: 109.383 bits (272), Expect = 4.313e-31
Identity = 50/103 (48.54%), Postives = 69/103 (66.99%), Query Frame = 2
Query:   89 DSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNN 397
            +  +++VL+ A    GL  G+H+T KAL+ ++A  C+LA+NCD+  Y KL+E LC EH IPL+KV   K +GEY GLCK DK+   RK V CSS V++N  N 
Sbjct:   23 EGALRAVLRAAHHADGLAKGLHETCKALDKREAHFCVLAENCDEPQYVKLVETLCAEHQIPLIKVADKKIIGEYCGLCKYDKEGKARKVVGCSSAVVTNWGNE 125          
BLAST of 40S ribosomal protein S12 vs. Ensembl Fly
Match: RpS12 (gene:FBgn0286213 transcript:FBtr0075878)

HSP 1 Score: 114.39 bits (285), Expect = 6.067e-33
Identity = 53/101 (52.48%), Postives = 75/101 (74.26%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNI 388
            +++ +Q VLK ++   GL  GIHQ  KAL+ ++A+LCILA++ D+ NY KL+  LC EH IPL++VDS+KKLGE++GLCK+DK+  PRK   CS VVI + 
Sbjct:   21 INTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDF 121          
BLAST of 40S ribosomal protein S12 vs. Ensembl Zebrafish
Match: rps12 (ribosomal protein S12 [Source:ZFIN;Acc:ZDB-GENE-030131-8951])

HSP 1 Score: 109.383 bits (272), Expect = 5.425e-31
Identity = 53/100 (53.00%), Postives = 70/100 (70.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +  VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VVI +
Sbjct:   14 VNTALPEVLKTALIHDGLARGIREAAKALDKRQAHLCVLAANCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVIKD 113          
BLAST of 40S ribosomal protein S12 vs. Ensembl Zebrafish
Match: rps12 (ribosomal protein S12 [Source:ZFIN;Acc:ZDB-GENE-030131-8951])

HSP 1 Score: 109.383 bits (272), Expect = 5.425e-31
Identity = 53/100 (53.00%), Postives = 70/100 (70.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +  VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VVI +
Sbjct:   14 VNTALPEVLKTALIHDGLARGIREAAKALDKRQAHLCVLAANCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVIKD 113          
BLAST of 40S ribosomal protein S12 vs. Ensembl Zebrafish
Match: rps12 (ribosomal protein S12 [Source:ZFIN;Acc:ZDB-GENE-030131-8951])

HSP 1 Score: 109.383 bits (272), Expect = 5.425e-31
Identity = 53/100 (53.00%), Postives = 70/100 (70.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +  VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VVI +
Sbjct:   14 VNTALPEVLKTALIHDGLARGIREAAKALDKRQAHLCVLAANCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVIKD 113          
BLAST of 40S ribosomal protein S12 vs. Ensembl Xenopus
Match: rps12 (ribosomal protein S12 [Source:NCBI gene;Acc:493270])

HSP 1 Score: 111.309 bits (277), Expect = 1.374e-31
Identity = 53/100 (53.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +Q VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VV+ +
Sbjct:   14 VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD 113          
BLAST of 40S ribosomal protein S12 vs. Ensembl Xenopus
Match: rps12 (ribosomal protein S12 [Source:NCBI gene;Acc:493270])

HSP 1 Score: 110.923 bits (276), Expect = 1.767e-31
Identity = 53/98 (54.08%), Postives = 70/98 (71.43%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVI 379
            V++ +Q VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VV+
Sbjct:   14 VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVV 111          
BLAST of 40S ribosomal protein S12 vs. Ensembl Mouse
Match: Rps12 (ribosomal protein S12 [Source:MGI Symbol;Acc:MGI:98105])

HSP 1 Score: 111.309 bits (277), Expect = 1.266e-31
Identity = 53/100 (53.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +Q VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VV+ +
Sbjct:   14 VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD 113          
BLAST of 40S ribosomal protein S12 vs. Ensembl Mouse
Match: Rps12 (ribosomal protein S12 [Source:MGI Symbol;Acc:MGI:98105])

HSP 1 Score: 111.309 bits (277), Expect = 1.266e-31
Identity = 53/100 (53.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +Q VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VV+ +
Sbjct:   14 VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD 113          
BLAST of 40S ribosomal protein S12 vs. Ensembl Mouse
Match: Rps12 (ribosomal protein S12 [Source:MGI Symbol;Acc:MGI:98105])

HSP 1 Score: 110.923 bits (276), Expect = 2.792e-31
Identity = 53/100 (53.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +Q VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VV+ +
Sbjct:   30 VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD 129          
BLAST of 40S ribosomal protein S12 vs. Ensembl Mouse
Match: Rps12 (ribosomal protein S12 [Source:MGI Symbol;Acc:MGI:98105])

HSP 1 Score: 105.145 bits (261), Expect = 3.820e-29
Identity = 53/105 (50.48%), Postives = 71/105 (67.62%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALE-----SQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +Q VLK A+   GL  GI +  KAL+      ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VV+ +
Sbjct:   14 VNTALQEVLKTALIHDGLARGIREAAKALDKKPRKRRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD 118          
BLAST of 40S ribosomal protein S12 vs. UniProt/SwissProt
Match: sp|Q54PX9|RS12_DICDI (40S ribosomal protein S12 OS=Dictyostelium discoideum OX=44689 GN=rps12 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.345e-37
Identity = 59/123 (47.97%), Postives = 88/123 (71.54%), Query Frame = 2
Query:   77 EKSVDSLV--QSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNNCTNWEALMSEVKKQ 439
            EK+ D +V  Q V+K++++V+G+  G+H+T KAL+ + A LC+LA NCD+ N+ +L++ L  EHNIPL++V  NK LGE+AGLCKLDKDL  RK V+CS++VI        +++ LM  + KQ
Sbjct:   14 EKNTDPMVALQKVIKESLAVQGVARGLHETVKALDKRTARLCVLASNCDEPNFVRLVKALATEHNIPLIEVPDNKALGEWAGLCKLDKDLAARKVVACSTLVIKTFGKESDDYKFLMEYISKQ 136          
BLAST of 40S ribosomal protein S12 vs. UniProt/SwissProt
Match: sp|P80455|RS12_DROME (40S ribosomal protein S12 OS=Drosophila melanogaster OX=7227 GN=RpS12 PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 6.081e-32
Identity = 53/101 (52.48%), Postives = 75/101 (74.26%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNI 388
            +++ +Q VLK ++   GL  GIHQ  KAL+ ++A+LCILA++ D+ NY KL+  LC EH IPL++VDS+KKLGE++GLCK+DK+  PRK   CS VVI + 
Sbjct:   21 INTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLCILAESFDEPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDF 121          
BLAST of 40S ribosomal protein S12 vs. UniProt/SwissProt
Match: sp|P46405|RS12_PIG (40S ribosomal protein S12 OS=Sus scrofa OX=9823 GN=RPS12 PE=1 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 8.853e-31
Identity = 53/100 (53.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +Q VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VV+ +
Sbjct:   14 VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD 113          
BLAST of 40S ribosomal protein S12 vs. UniProt/SwissProt
Match: sp|P25398|RS12_HUMAN (40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3)

HSP 1 Score: 111.309 bits (277), Expect = 8.853e-31
Identity = 53/100 (53.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +Q VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VV+ +
Sbjct:   14 VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD 113          
BLAST of 40S ribosomal protein S12 vs. UniProt/SwissProt
Match: sp|Q76I81|RS12_BOVIN (40S ribosomal protein S12 OS=Bos taurus OX=9913 GN=RPS12 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 8.853e-31
Identity = 53/100 (53.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +Q VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VV+ +
Sbjct:   14 VNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD 113          
BLAST of 40S ribosomal protein S12 vs. TrEMBL
Match: C1C384 (40S ribosomal protein S12 OS=Caligus clemensi OX=344056 GN=RS12 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 8.082e-35
Identity = 58/96 (60.42%), Postives = 76/96 (79.17%), Query Frame = 2
Query:   98 VQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            +Q VLK+A+   GL+ G+H+TTKAL+ ++AL C+LA+NCD+  Y KLI+ LC +H IPL+KVDSN KLGE+AGLCKLD D NPRK   CSSVV+ +
Sbjct:   31 IQEVLKEALIHNGLSRGLHETTKALDKRQALFCVLAENCDEPMYVKLIQALCAQHQIPLIKVDSNMKLGEWAGLCKLDSDGNPRKVTRCSSVVVRD 126          
BLAST of 40S ribosomal protein S12 vs. TrEMBL
Match: D3PFR6 (40S ribosomal protein S12 OS=Lepeophtheirus salmonis OX=72036 GN=RS12 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 2.427e-33
Identity = 55/96 (57.29%), Postives = 75/96 (78.12%), Query Frame = 2
Query:   98 VQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            +Q VL++A+   GL+ G+ +TTKAL+ ++AL C+LA+NCD+  Y KL++ LC +H IPL+KVDSN KLGE+AGLCKLD D NPRK   CSSVV+ +
Sbjct:   29 IQEVLREALIHNGLSRGLRETTKALDKRQALFCVLAENCDEPMYVKLVQALCAQHQIPLIKVDSNMKLGEWAGLCKLDSDGNPRKVTRCSSVVVRD 124          
BLAST of 40S ribosomal protein S12 vs. TrEMBL
Match: D1LYL9 (40S ribosomal protein S12 OS=Manduca sexta OX=7130 GN=rps12 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 3.239e-33
Identity = 60/116 (51.72%), Postives = 82/116 (70.69%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNNCTNWEALMSEVK 433
            V++ +Q VLK A+   GL  G+H+  KAL+ ++A+LC+LA+NCD+A Y KL++ LC EH IPL+KVD+NKKLGE+AGLCK+DKD  PRK V CS VVI +        + L   +K
Sbjct:   21 VNTALQEVLKTALIHGGLVHGLHEAAKALDKRQAVLCVLAENCDEAAYKKLVQALCNEHQIPLVKVDNNKKLGEWAGLCKIDKDGKPRKIVGCSCVVIKDFGEETPALDVLKDYLK 136          
BLAST of 40S ribosomal protein S12 vs. TrEMBL
Match: A0A4S2LVC3 (40S ribosomal protein S12 OS=Opisthorchis felineus OX=147828 GN=CRM22_004608 PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 4.267e-33
Identity = 60/123 (48.78%), Postives = 82/123 (66.67%), Query Frame = 2
Query:   65 MMTEEKSVDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNNCTNWEALMSEVK 433
            M   E  +DS VQ VLK+A   RG+  G+H+ +KA+E +KA+ C LA+NC+D  Y+ LIE LC+EH IPL+KV  NKKLGE AGLCK DK+   RK VS S +V+ +I      W+ L+ + +
Sbjct:    1 MNLNELDLDSAVQQVLKNAAKCRGIFRGLHECSKAIEQRKAVCCFLAENCNDKAYSCLIEALCREHEIPLIKVADNKKLGELAGLCKYDKEGKARKVVSASCIVVRDIGEESYGWKYLVEKYR 123          
BLAST of 40S ribosomal protein S12 vs. TrEMBL
Match: A0A1S8WP26 (40S ribosomal protein S12 OS=Opisthorchis viverrini OX=6198 GN=X801_08036 PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 4.267e-33
Identity = 60/123 (48.78%), Postives = 82/123 (66.67%), Query Frame = 2
Query:   65 MMTEEKSVDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNNCTNWEALMSEVK 433
            M   E  +DS VQ VLK+A   RG+  G+H+ +KA+E +KA+ C LA+NC+D  Y+ LIE LC+EH IPL+KV  NKKLGE AGLCK DK+   RK VS S +V+ +I      W+ L+ + +
Sbjct:    1 MNLNELDLDSAVQQVLKNAAKCRGIFRGLHECSKAIEQRKAVCCFLAENCNDKAYSCLIEALCREHEIPLIKVADNKKLGELAGLCKYDKEGKARKVVSASCIVVRDIGEESYGWKYLVEKYR 123          
BLAST of 40S ribosomal protein S12 vs. Ensembl Cavefish
Match: rps12 (ribosomal protein S12 [Source:NCBI gene;Acc:103033124])

HSP 1 Score: 109.383 bits (272), Expect = 4.597e-31
Identity = 53/100 (53.00%), Postives = 70/100 (70.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +  VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VVI +
Sbjct:   14 VNTALPEVLKTALIHDGLARGIREAAKALDKRQAHLCVLAANCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVIKD 113          
BLAST of 40S ribosomal protein S12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005589.1 (pep scaffold:Pmarinus_7.0:GL480041:19082:24249:-1 gene:ENSPMAG00000005068.1 transcript:ENSPMAT00000005589.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 6.908e-32
Identity = 52/100 (52.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +Q VLK A+   GL  G+ +  KAL+ + A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE++GLCK+D++  PRK V CS VV+ +
Sbjct:   14 VNTALQEVLKTALIHDGLARGLREAAKALDKRHAHLCVLASNCDEPMYVKLVEALCNEHQINLIKVDDNKKLGEWSGLCKIDREGKPRKVVGCSCVVVKD 113          
BLAST of 40S ribosomal protein S12 vs. Ensembl Yeast
Match: RPS12 (Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S12, no bacterial homolog [Source:SGD;Acc:S000005896])

HSP 1 Score: 72.0182 bits (175), Expect = 3.115e-17
Identity = 38/94 (40.43%), Postives = 61/94 (64.89%), Query Frame = 2
Query:   77 EKSVDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCK--EHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRK 352
            E +++  ++ VL+ A+   GL  G+ ++TKAL   +ALL +L  +  +AN  KL+E L    E+ +PL+KV   K+LGE+AGL K+D++ N RK
Sbjct:   21 EVTIEDALKVVLRTALVHDGLARGLRESTKALTRGEALLVVLVSSVTEANIIKLVEGLANDPENKVPLIKVADAKQLGEWAGLGKIDREGNARK 114          
BLAST of 40S ribosomal protein S12 vs. Ensembl Nematostella
Match: EDO35867 (40S ribosomal protein S12 [Source:UniProtKB/TrEMBL;Acc:A7SK96])

HSP 1 Score: 120.553 bits (301), Expect = 1.189e-35
Identity = 58/118 (49.15%), Postives = 83/118 (70.34%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNNCTNWEALMSEVKKQ 439
            +++ +Q VLK A+   GL+ G+H+  K+L+ ++A LCIL+ NCD+A Y KL+E LC EH IPLLKVD +KKLGE+AGLCK+DK+   RK V CS VV+ +I  +    + LM  +K +
Sbjct:   21 INTALQEVLKTALIHDGLSRGLHEAAKSLDKREAHLCILSNNCDEAMYVKLVEALCAEHGIPLLKVDDSKKLGEWAGLCKIDKEGKARKVVGCSCVVVKDIGKDSQAHDVLMQYLKSK 138          
BLAST of 40S ribosomal protein S12 vs. Ensembl Medaka
Match: rps12 (ribosomal protein S12 [Source:NCBI gene;Acc:101172123])

HSP 1 Score: 108.997 bits (271), Expect = 8.766e-31
Identity = 52/100 (52.00%), Postives = 70/100 (70.00%), Query Frame = 2
Query:   86 VDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISN 385
            V++ +  VLK A+   GL  GI +  KAL+ ++A LC+LA NCD+  Y KL+E LC EH I L+KVD NKKLGE+ GLCK+D++  PRK V CS VV+ +
Sbjct:   14 VNTALPEVLKTALIHDGLARGIREAAKALDKRQAHLCVLAANCDEPMYVKLVEALCAEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVKD 113          
BLAST of 40S ribosomal protein S12 vs. Planmine SMEST
Match: SMESG000052688.1 (SMESG000052688.1)

HSP 1 Score: 252.292 bits (643), Expect = 1.469e-87
Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 2
Query:   65 MMTEEKSVDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNNCTNWEALMSEVKKQ 439
            MMTEEKSVDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNNCTNWEALMSEVKKQ
Sbjct:    1 MMTEEKSVDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNNCTNWEALMSEVKKQ 125          
BLAST of 40S ribosomal protein S12 vs. Planmine SMEST
Match: SMESG000052688.1 (SMESG000052688.1)

HSP 1 Score: 249.595 bits (636), Expect = 1.346e-86
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 2
Query:   68 MTEEKSVDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNNCTNWEALMSEVKKQ 439
            MTEEKSVDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNNCTNWEALMSEVKKQ
Sbjct:    1 MTEEKSVDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNNCTNWEALMSEVKKQ 124          
BLAST of 40S ribosomal protein S12 vs. Planmine SMEST
Match: SMESG000069457.1 (SMESG000069457.1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.048e-18
Identity = 40/116 (34.48%), Postives = 67/116 (57.76%), Query Frame = 2
Query:   83 SVDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNCDDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSCSSVVISNIPNNCTNWEALMSEV 430
            ++DS +  V   A ++  L  G+ +  K+LE Q A+LC+ A + ++     LI+ LC  +N+P +   S  +LGE +GL +LD+D N RK VS S V++ +   +C  W+ + S V
Sbjct:    2 NLDSALSDVFHRAFALNILCRGLKECVKSLERQTAVLCVGADDTEERAIISLIQSLCVNNNVPFIHFPSKYRLGEISGLRRLDEDGNSRKVVSTSVVIVKDQIIDCEGWQYINSNV 117          
The following BLAST results are available for this feature:
BLAST of 40S ribosomal protein S12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RPS121.844e-3153.00ribosomal protein S12 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 40S ribosomal protein S12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rps-124.313e-3148.5440S ribosomal protein S12 [Source:UniProtKB/Swiss... [more]
rps-124.313e-3148.5440S ribosomal protein S12 [Source:UniProtKB/Swiss... [more]
rps-124.313e-3148.5440S ribosomal protein S12 [Source:UniProtKB/Swiss... [more]
rps-124.313e-3148.5440S ribosomal protein S12 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of 40S ribosomal protein S12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RpS126.067e-3352.48gene:FBgn0286213 transcript:FBtr0075878[more]
back to top
BLAST of 40S ribosomal protein S12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rps125.425e-3153.00ribosomal protein S12 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rps125.425e-3153.00ribosomal protein S12 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
rps125.425e-3153.00ribosomal protein S12 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of 40S ribosomal protein S12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps121.374e-3153.00ribosomal protein S12 [Source:NCBI gene;Acc:493270... [more]
rps121.767e-3154.08ribosomal protein S12 [Source:NCBI gene;Acc:493270... [more]
back to top
BLAST of 40S ribosomal protein S12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rps121.266e-3153.00ribosomal protein S12 [Source:MGI Symbol;Acc:MGI:9... [more]
Rps121.266e-3153.00ribosomal protein S12 [Source:MGI Symbol;Acc:MGI:9... [more]
Rps122.792e-3153.00ribosomal protein S12 [Source:MGI Symbol;Acc:MGI:9... [more]
Rps123.820e-2950.48ribosomal protein S12 [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of 40S ribosomal protein S12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54PX9|RS12_DICDI3.345e-3747.9740S ribosomal protein S12 OS=Dictyostelium discoid... [more]
sp|P80455|RS12_DROME6.081e-3252.4840S ribosomal protein S12 OS=Drosophila melanogast... [more]
sp|P46405|RS12_PIG8.853e-3153.0040S ribosomal protein S12 OS=Sus scrofa OX=9823 GN... [more]
sp|P25398|RS12_HUMAN8.853e-3153.0040S ribosomal protein S12 OS=Homo sapiens OX=9606 ... [more]
sp|Q76I81|RS12_BOVIN8.853e-3153.0040S ribosomal protein S12 OS=Bos taurus OX=9913 GN... [more]
back to top
BLAST of 40S ribosomal protein S12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1C3848.082e-3560.4240S ribosomal protein S12 OS=Caligus clemensi OX=3... [more]
D3PFR62.427e-3357.2940S ribosomal protein S12 OS=Lepeophtheirus salmon... [more]
D1LYL93.239e-3351.7240S ribosomal protein S12 OS=Manduca sexta OX=7130... [more]
A0A4S2LVC34.267e-3348.7840S ribosomal protein S12 OS=Opisthorchis felineus... [more]
A0A1S8WP264.267e-3348.7840S ribosomal protein S12 OS=Opisthorchis viverrin... [more]
back to top
BLAST of 40S ribosomal protein S12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps124.597e-3153.00ribosomal protein S12 [Source:NCBI gene;Acc:103033... [more]
back to top
BLAST of 40S ribosomal protein S12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005589.16.908e-3252.00pep scaffold:Pmarinus_7.0:GL480041:19082:24249:-1 ... [more]
back to top
BLAST of 40S ribosomal protein S12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RPS123.115e-1740.43Protein component of the small (40S) ribosomal sub... [more]
back to top
BLAST of 40S ribosomal protein S12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO358671.189e-3549.1540S ribosomal protein S12 [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of 40S ribosomal protein S12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps128.766e-3152.00ribosomal protein S12 [Source:NCBI gene;Acc:101172... [more]
back to top
BLAST of 40S ribosomal protein S12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000052688.11.469e-87100.00SMESG000052688.1[more]
SMESG000052688.11.346e-86100.00SMESG000052688.1[more]
SMESG000069457.12.048e-1834.48SMESG000069457.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031089 ID=SMED30031089|Name=40S ribosomal protein S12|organism=Schmidtea mediterranea sexual|type=transcript|length=491bp
TTAAAATACATTTGTTATAAGATTTTGTTTATATTTCAAAATACAAATTT
AAAATTTTATAAAAATGATGACCGAAGAGAAAAGTGTTGATTCATTAGTT
CAATCTGTTTTAAAGGATGCAGTTTCCGTTCGTGGTTTAACTTGTGGAAT
TCATCAAACTACAAAGGCTCTTGAAAGTCAAAAAGCTTTATTATGCATTT
TAGCTAAAAATTGCGATGATGCTAATTATACCAAGCTTATTGAAGTTCTC
TGCAAAGAACACAATATTCCACTTTTAAAAGTTGACAGCAATAAGAAACT
TGGAGAATATGCAGGCTTATGCAAACTCGACAAGGATTTAAACCCAAGAA
AGACTGTTTCATGCTCTTCAGTAGTTATATCTAACATCCCAAATAACTGC
ACAAACTGGGAAGCTTTGATGTCAGAAGTAAAAAAACAATAATTTGATTA
ATAAAAATTATTTGGAGTTTAAAAAAAAAAGATCGGAAGAG
back to top

protein sequence of SMED30031089-orf-1

>SMED30031089-orf-1 ID=SMED30031089-orf-1|Name=SMED30031089-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=126bp
MMTEEKSVDSLVQSVLKDAVSVRGLTCGIHQTTKALESQKALLCILAKNC
DDANYTKLIEVLCKEHNIPLLKVDSNKKLGEYAGLCKLDKDLNPRKTVSC
SSVVISNIPNNCTNWEALMSEVKKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000110pharynx progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000530Ribosomal_S12e
IPR004038Ribosomal_L7Ae/L30e/S12e/Gad45
IPR029064L30e-like
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
GO:0022627cytosolic small ribosomal subunit
GO:0030529intracellular ribonucleoprotein complex
GO:0045335phagocytic vesicle
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0009617response to bacterium
GO:0046689response to mercury ion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000530Ribosomal protein S12ePRINTSPR00972RIBSOMALS12Ecoord: 15..28
score: 47.4
coord: 29..45
score: 39.57
coord: 95..108
score: 48.7
coord: 70..91
score: 61.57
IPR000530Ribosomal protein S12ePANTHERPTHR1184340S RIBOSOMAL PROTEIN S12coord: 4..119
IPR004038Ribosomal protein L7Ae/L30e/S12e/Gadd45PFAMPF01248Ribosomal_L7Aecoord: 12..104
e-value: 7.3E-26
score: 89.7
IPR02906450S ribosomal protein L30e-likeGENE3DG3DSA:3.30.1330.30coord: 1..125
e-value: 2.0E-43
score: 148.8
IPR02906450S ribosomal protein L30e-likeSUPERFAMILYSSF55315L30e-likecoord: 9..124
NoneNo IPR availablePANTHERPTHR11843:SF040S RIBOSOMAL PROTEIN S12coord: 4..119