Leishmanolysin-like peptidase

Overview
NameLeishmanolysin-like peptidase
Smed IDSMED30031079
Length (bp)1895
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leishmanolysin-like peptidase (SMED30031079) t-SNE clustered cells

Violin plots show distribution of expression levels for Leishmanolysin-like peptidase (SMED30031079) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leishmanolysin-like peptidase (SMED30031079) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leishmanolysin-like peptidase (SMED30031079) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031079

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30031079h1SMcG0003374 dd_Smed_v4_7495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031079h1SMcG0003374 dd_Smed_v4_7495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031079h1SMcG0003374 dd_Smed_v4_7495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031079h1SMcG0003374 dd_Smed_v4_7495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031079h1SMcG0003374 dd_Smed_v6_7495_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031079h1SMcG0003374 dd_Smed_v4_7495_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN (leishmanolysin like peptidase [Source:HGNC Symbol;Acc:HGNC:15991])

HSP 1 Score: 236.113 bits (601), Expect = 1.952e-68
Identity = 159/549 (28.96%), Postives = 265/549 (48.27%), Query Frame = 3
Query:  117 LDEMVTGIEIDQNLQNYRTRKSSSHLRIHYHYTDSFGSY--PNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRC-INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCR----KILPSGEIIYSQSEGPGIENVDIIIVV---AFTHCNDHTKAS-AASCFIEKQLDRPILGVIEMCIGKFQVNVN-VIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESV-NGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMT-PQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVF-KENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS--APNSFCNDITNSYLQDKYNILTSY----YGKDSLC-------IENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTC 1679
            L+ ++  + +  N  +   R    HLRI   Y  S         + +K ++   +   +E+  + + P  G + + R+C  N   R   D  R C   C A TKC  + +PEE+L++CR       P G +     EG  I + D ++ V   A   C+     S AA C  E  +DRPI G   +C           +  +  ++HE+IHALGF+   +A++   +G P+  R   G+P    N     Y W+DK+++KV+R  +   N I + T+   V   +V+ A++HF CP ++ ++LE+ GG G+ L H+++ LL N+ MT   T N   V+S+ TLAL++DTGWY+ +YS A+  D+G+G GC    K C  ++++QRQK   L P+CD +        C + +     C+L  + +   +E QYF E+ GI  ED  +Y G  E  ++CPF   FS      +        L+++  I  +Y    YG  S+C       +    E  +    +G+ C  Y  + + +  ++++   S  C
Sbjct:   19 LERVINKVHLKAN--HVVKRDVDEHLRIKTVYDKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPA-GTILLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPHGAVGVPDQEG--ISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMISTQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRFADGLPPF--NYSLGLYQWSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVEEARKHFDCPVLEGMELENQGGVGTELNHWEKRLLENEAMTGSHTQNR--VLSRITLALMEDTGWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQKRQMLSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPEIFKNYGAEKYGPHSVCLIQKSAFVMEKCERKLSYPDWGSGC--YQVSCSPQGLKVWVQDTSYLC 556          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN (leishmanolysin like peptidase [Source:HGNC Symbol;Acc:HGNC:15991])

HSP 1 Score: 236.498 bits (602), Expect = 4.425e-68
Identity = 157/530 (29.62%), Postives = 257/530 (48.49%), Query Frame = 3
Query:  174 RKSSSHLRIHYHYTDSFGSY--PNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRC-INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKI----LPSGEIIYSQSEGPGIENVDIIIVV---AFTHCNDHTKAS-AASCFIEKQLDRPILGVIEMCIGKFQVNVN-VIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESV-NGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMT-PQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVF-KENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS--APNSFCNDITNSYLQDKYNILTSY----YGKDSLC-------IENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTC 1679
            R    HLRI   Y  S         + +K ++   +   +E+  + + P  G + + R+C  N   R   D  R C   C A TKC  + +PEE+L++CR       P G +     EG  I + D ++ V   A   C+     S AA C  E  +DRPI G   +C           +  +  ++HE+IHALGF+   +A++   +G P+  R   G+P    N     Y W+DK+++KV+R  +   N I + T+   V   +V+ A++HF CP ++ ++LE+ GG G+ L H+++ LL N+ MT   T N   V+S+ TLAL++DTGWY+ +YS A+  D+G+G GC    K C  ++++QRQK   L P+CD +        C + +     C+L  + +   +E QYF E+ GI  ED  +Y G  E  ++CPF   FS      +        L+++  I  +Y    YG  S+C       +    E  +    +G+ C  Y  + + +  ++++   S  C
Sbjct:   88 RDVDEHLRIKTVYDKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPA-GTILLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPHGAVGVPDQEG--ISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMISTQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRFADGLPPF--NYSLGLYQWSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVEEARKHFDCPVLEGMELENQGGVGTELNHWEKRLLENEAMTGSHTQNR--VLSRITLALMEDTGWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQKRQMLSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPEIFKNYGAEKYGPHSVCLIQKSAFVMEKCERKLSYPDWGSGC--YQVSCSPQGLKVWVQDTSYLC 608          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN (leishmanolysin like peptidase [Source:HGNC Symbol;Acc:HGNC:15991])

HSP 1 Score: 180.644 bits (457), Expect = 2.036e-48
Identity = 145/549 (26.41%), Postives = 242/549 (44.08%), Query Frame = 3
Query:  117 LDEMVTGIEIDQNLQNYRTRKSSSHLRIHYHYTDSFGSY--PNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRC-INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKI----LPSGEIIYSQSEGPGIENVDIIIVV---AFTHCNDHTKAS-AASCFIEKQLDRPILGVIEMCIGKFQVNVN-VIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESV-NGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMT-PQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVF-KENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS--APNSFCNDITNSYLQDKYNILTSY----YGKDSLC-------IENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTC 1679
            L+ ++  + +  N  +   R    HLRI   Y  S         + +K ++   +   +E+  + + P  G + + R+C  N   R   D  R C   C A TKC  + +PEE+L++CR       P G +     EG  I + D ++ V   A   C+     S AA C  E  +DRPI G   +C           +  +  ++HE+IHALGF+   +A++   +G P+  R   G+P    N     Y W+DK+++KV+R  +   N I + T+   V   +V+ A++HF CP ++ ++LE+ GG G+ L H+++ LL N+ MT   T N   V+S+ TLAL++DTG                            R M         L P+CD +        C + +     C+L  + +   +E QYF E+ GI  ED  +Y G  E  ++CPF   FS      +        L+++  I  +Y    YG  S+C       +    E  +    +G+ C  Y  + + +  ++++   S  C
Sbjct:   19 LERVINKVHLKAN--HVVKRDVDEHLRIKTVYDKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPA-GTILLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPHGAVGVPDQEG--ISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMISTQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRFADGLPPF--NYSLGLYQWSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVEEARKHFDCPVLEGMELENQGGVGTELNHWEKRLLENEAMTGSHTQNR--VLSRITLALMEDTG----------------------------RQM---------LSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPEIFKNYGAEKYGPHSVCLIQKSAFVMEKCERKLSYPDWGSGC--YQVSCSPQGLKVWVQDTSYLC 519          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN (leishmanolysin like peptidase [Source:HGNC Symbol;Acc:HGNC:15991])

HSP 1 Score: 180.644 bits (457), Expect = 3.559e-48
Identity = 143/530 (26.98%), Postives = 234/530 (44.15%), Query Frame = 3
Query:  174 RKSSSHLRIHYHYTDSFGSY--PNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRC-INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKI----LPSGEIIYSQSEGPGIENVDIIIVV---AFTHCNDHTKAS-AASCFIEKQLDRPILGVIEMCIGKFQVNVN-VIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESV-NGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMT-PQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVF-KENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS--APNSFCNDITNSYLQDKYNILTSY----YGKDSLC-------IENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTC 1679
            R    HLRI   Y  S         + +K ++   +   +E+  + + P  G + + R+C  N   R   D  R C   C A TKC  + +PEE+L++CR       P G +     EG  I + D ++ V   A   C+     S AA C  E  +DRPI G   +C           +  +  ++HE+IHALGF+   +A++   +G P+  R   G+P    N     Y W+DK+++KV+R  +   N I + T+   V   +V+ A++HF CP ++ ++LE+ GG G+ L H+++ LL N+ MT   T N   V+S+ TLAL++DTG                            R M         L P+CD +        C + +     C+L  + +   +E QYF E+ GI  ED  +Y G  E  ++CPF   FS      +        L+++  I  +Y    YG  S+C       +    E  +    +G+ C  Y  + + +  ++++   S  C
Sbjct:   88 RDVDEHLRIKTVYDKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPA-GTILLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPHGAVGVPDQEG--ISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMISTQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRFADGLPPF--NYSLGLYQWSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVEEARKHFDCPVLEGMELENQGGVGTELNHWEKRLLENEAMTGSHTQN--RVLSRITLALMEDTG----------------------------RQM---------LSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPEIFKNYGAEKYGPHSVCLIQKSAFVMEKCERKLSYPDWGSGC--YQVSCSPQGLKVWVQDTSYLC 571          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN2 (leishmanolysin like peptidase 2 [Source:HGNC Symbol;Acc:HGNC:53647])

HSP 1 Score: 82.4185 bits (202), Expect = 1.159e-15
Identity = 81/325 (24.92%), Postives = 133/325 (40.92%), Query Frame = 3
Query:  417 KCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVVAFTHCND-HTKAS----AASCFIEKQLDRPILGVIEMCIGKF-QVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDV-ISKFTLALLQDTGWYEVDYSKAQDYDYGKGKG-----------------CTLPLKGC-YRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYY 1316
             CLG  IP+ +L+        G     Q +GPG++N D ++ V   H +  H + S    AA C ++ + DRP+ G I  C       +++  + V    HE++HALGF+   +  +R            F V    + N     L        V R  E    +      +  L   + V+    G P      LE+  G  S  +H++  LL   +MT   + A    +   TLA  +D+GWY+V++S A++  +G+G G                 CT    GC Y ++++    + P+   C       N + C KK N +
Sbjct:  148 SCLGAKIPDTHLRGYALWPEQGPPQLVQPDGPGVQNTDFLLYVRVAHTSKCHQEPSVIAYAACCQLDSE-DRPLAGTIVYCAQHLTSPSLSHSDIVMATLHELLHALGFSGQLFKKWRDCP-------SGFSV----RENCSTRQL--------VTRQDEWGQLLLTTPAVSLSLAKHLGVSGASLGVP------LEEEEGLLS--SHWEARLLQGSLMTATFDGAQRTRLDPITLAAFKDSGWYQVNHSAAEELLWGQGSGPEFGLVTTCGTGSSDFFCTGSGLGCHYLHLDKGSCSSDPMLEGCRMYKPLANGSECWKKENGF 444          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Celegans
Match: Y43F4A.1 (Leishmanolysin-like peptidase [Source:UniProtKB/Swiss-Prot;Acc:O62446])

HSP 1 Score: 199.134 bits (505), Expect = 3.755e-55
Identity = 128/434 (29.49%), Postives = 211/434 (48.62%), Query Frame = 3
Query:  192 LRIHYHYTDSFGSYPNS--DAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSRTNADGIR--GCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVVAF---THC-NDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESV-KIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVN-GIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGN----IARCSKKRNYYDYCHLT-YYNEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPF 1448
            LRI  HY  S  +      + +   ++  +    E  L+ + P+   +R+ R+CI+        G+R   C +GC   T C    IP ++L  C     + +   +   G G+++ D I+ V       C    T + AA C  E   DRPI G + +C     V+ +  E +   ++HEI+HALGF++  YA+FR S G P   R+ +G P    N  + YY W+   I  V R       G     +   V   + + A+ HFGC  ++  +LE+ GG G+ LTH+++    N+ MT  T+    V S+ TLA L+DTGWY+ +Y  A+D  +GK  GC   +K C  ++ E++       P+C  +   G+    I RC+ +R+    C+L  +  E+  + + F  +PG+  + A++Y G  E  ++CPF
Sbjct:   70 LRIQLHYDKSIQNLTAEVQNFVNTTLLPEAVGYWENALRVR-PMTTPIRLRRKCISSFYYYK-QGMRNVACDKGCRERTTCGEADIPRDHLLDCLACNNTDDCKTTGELGEGVKDTDFILYVTAHDSKRCEGPETLSYAAHCQQEADFDRPIAGNVNLCPSALSVHNHDYEILTSTVKHEILHALGFSVGLYAFFRDSEGKPRTKRNRYGRPT-SLNKQKGYYDWDSNTITTVLRENWWTGEGKVIHPIHMMVTPKVREEARRHFGCDKLEGAELENQGGEGTYLTHWEKRAYENEAMT-GTHTQNPVYSRLTLAFLEDTGWYQPNYEVAEDLHWGKQLGCDFAMKSCGEWIHEKKILGEDAYPYCSDIKHDGSKSMAITRCTTQRDSLALCNLVPFQKELPSQYRNFMSLPGVNPDGAKYYGGSVEMADYCPF 499          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Celegans
Match: T13B5.9 (pep chromosome:WBcel235:II:1101371:1104509:-1 gene:WBGene00020476.1 transcript:T13B5.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T13B5.9)

HSP 1 Score: 60.4622 bits (145), Expect = 1.575e-9
Identity = 55/233 (23.61%), Postives = 96/233 (41.20%), Query Frame = 3
Query:  612 DRPILGVIEMCIGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDT-----GWYEVD----YSKAQDYDYGKGKGCTLPLKGCYRYME--EQRQKNAPLDPFCDRVFQY 1277
            +RP L V+ +C+       N      + +HEI+H LG+ L             I+ + +     L +   EKY +W+    +K+   R  ++       D   L    K A+ HF C ++  V        G    H +EY+  N++MT       +V S  ++ +++ T      WY ++     ++A  Y YGK  GC      C  +++  E+ +    L PFC +   Y
Sbjct:  132 NRPPLAVMSICLQNSPRPRNSGFFFDLFRHEILHGLGYGL-------------IIDKSK-----LTEKKSEKY-IWHGANNQKIPSIRHFLD------FDELSL----KAAKIHFNCQNMAGVQ-----ADGELKNHLNEYIFGNELMTTHLEPHGNVFSWISVGIIERTFNGEKQWYHINGTFISTEANQYSYGKKFGCEFLENSCEDFLKIAEKHKIGLKLAPFCRKSLCY 330          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Fly
Match: Invadolysin (gene:FBgn0086359 transcript:FBtr0082181)

HSP 1 Score: 226.868 bits (577), Expect = 6.712e-65
Identity = 153/516 (29.65%), Postives = 246/516 (47.67%), Query Frame = 3
Query:  321 GVLRVDRRCINGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGE---IIYSQSEGPGIENVDIIIVVAFTHCN----DHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIES-VKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRD-EFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIY-KKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYN-EVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS-------APNSFCNDITNSYLQDKYNILTSYYGKDSLCI--------ENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTC--PSNFASHFVIDN--FYKISVKCPEFMMKSNSEICG 1778
            GV+R++R+C + +     +G   CI+ C A T C  + +P+ +L  CR    +G+   I  +   G GIEN D +  V+           T A AA C  E  LDRPI G   +C          +++ +  ++HEI+HALGF+++ YA+FR  +G P  PR  + G P L  N   + + W+++ I+KV R   SV G +  K +D  V   ++   + HF C  ++  +LED GG G+ALTH+++ +L N+ MT  T+    V S+ TLAL++D+GWY  +YS A    +GKG GC   ++ C  +++    +   + PFC +V Q      C+  RN    C+L  +  E+ K  Q F  +  +K  +  FY G     + CP+   F+          S C    N+   +K N     YG+ + C         E +   + +  ++G+ C  Y Y+       I +G  S  C  P    S  +  N   +K ++ CP        E+CG
Sbjct:  124 GVIRLNRKCDSTQVYVK-NGHTHCIDHCKATTMCGEVQVPDAHLDVCRVCNATGQNCRIDSNTQPGEGIENADFVFYVSARQTQRCFKGLTVAYAAHCQQEAALDRPIAGHANLCPESISTKPQELQTLISTVKHEILHALGFSVSLYAFFRDDDGKPRTPRKLDTGKPYL--NEKLQIHQWSNETIRKVVRENWSVRGGHVNKVVDMMVTPRVIAEVRAHFNCNKLEGAELEDQGGEGTALTHWEKRILENEAMT-GTHTQSPVFSRITLALMEDSGWYRANYSMATPLTWGKGLGCAFAMRSCKDWIQYNHARGRSIHPFCSKVKQDPLQTECTDDRNSVALCNLIRHEFELPKGYQNFDSLNHVKDGEEGFYGGSVSLADHCPYIQEFTWRSKNVIVRGSHCRFTENNPRPEK-NFALESYGEGAKCFDHSESMWEERSCHQTREWQHWGSGC--YKYDCFDGRLHILVGNYSYKCSFPGQKLSIRIAANGWLHKGAIMCPPC-----HELCG 627          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Zebrafish
Match: lmln (leishmanolysin-like (metallopeptidase M8 family) [Source:ZFIN;Acc:ZDB-GENE-081104-298])

HSP 1 Score: 238.81 bits (608), Expect = 1.881e-69
Identity = 156/513 (30.41%), Postives = 248/513 (48.34%), Query Frame = 3
Query:  174 RKSSSHLRIHYHYTDSFGSY--PNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRC-INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEII--YSQSEGPGIENVDIII-VVAFT--HCN-DHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIES-VKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNG-IYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMT-PQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLT-YYNEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS-------APNSFCNDITNSYLQDKYNILTSYYGKDSLCIEN----TLENSIDTVYY---GASCQKYSYNA 1631
            R +   L I   Y  S        S  +K +++  + + +++  + +   +G + + R+C  N   R   D  R C   C   TKC  + +PE +L++CR    SG+        +G G+   D ++ V A T   C  ++  A AA C +E +LDRPI G   +C           E  +  ++HEIIHALGF+   +A++    G P+ PR   G+PA   N     Y W+DK+IK+  R  +   G + + T+       +V+ A+ HF CP ++ ++LE+ GG+G+ L H+++ LL N+ MT   T N   V S+ TLA+++DTGWY  +YS A++  +G+G GC   +K C  ++++ R K   L P+CD V        C + +     C+L  + N +  E QYF  IPG+ KED   Y G  E  ++CPF   FS         +S+C  I  +      N     YG  S+C+       +E     + Y   G+ C K S  A
Sbjct:   60 RSTDQQLNIKIEYDSSLDGLDEAKSSLVKDKLLPQAIDYLQKAFRVRRQ-SGPILLSRQCATNQYLRKRDDPHRYCQGPCANVTKCGPVVVPEHHLQQCRVCSESGKSCGPVGPPDGEGVARADFVLYVSAMTTERCGQENIVAYAAYCQLESELDRPIAGYANLCPNMISTQPQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDGGKPLTPRSASGLPAY--NESLGLYQWSDKVIKRATRLWDIRGGQMVRHTVHLLATPRVVEEARRHFNCPILEGMELENQGGAGTELNHWEKRLLENEAMTGSHTQN--RVFSRITLAIMEDTGWYRANYSMAENLQWGRGLGCDFVMKSCKFWIDQHRHKRPTLSPYCDSVRSAPLQLTCRQDQLAVAVCNLQKFSNALPAEYQYFDHIPGVPKEDLSAYGGAVEIADYCPFSQEFSWHVGGEYQRSSYCR-IQENQPATWRNYGAEQYGPGSVCLYQKSAFVMEQCTKRMTYPDWGSGCYKVSCTA 566          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Zebrafish
Match: lmln (leishmanolysin-like (metallopeptidase M8 family) [Source:ZFIN;Acc:ZDB-GENE-081104-298])

HSP 1 Score: 234.572 bits (597), Expect = 3.901e-68
Identity = 154/513 (30.02%), Postives = 247/513 (48.15%), Query Frame = 3
Query:  174 RKSSSHLRIHYHYTDSFGSY--PNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRC-INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEII--YSQSEGPGIENVDIIIVVAFT---HCN-DHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIES-VKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNG-IYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMT-PQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLT-YYNEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS-------APNSFCNDITNSYLQDKYNILTSYYGKDSLCIEN----TLENSIDTVYY---GASCQKYSYNA 1631
            R +   L I   Y  S        S  +K +++  + + +++  + +   +G + + R+C  N   R   D  R C   C   TKC  + +PE +L++CR    SG+        +G G+   D ++ V+      C  ++  A AA C +E +LDRPI G   +C           E  +  ++HEIIHALGF+   +A++    G P+ PR   G+PA   N     Y W+DK+IK+  R  +   G + + T+       +V+ A+ HF CP ++ ++LE+ GG+G+ L H+++ LL N+ MT   T N   V S+ TLA+++DTGWY  +YS A++  +G+G GC   +K C  ++++ R K   L P+CD V        C + +     C+L  + N +  E QYF  IPG+ KED   Y G  E  ++CPF   FS         +S+C  I  +      N     YG  S+C+       +E     + Y   G+ C K S  A
Sbjct:   16 RSTDQQLNIKIEYDSSLDGLDEAKSSLVKDKLLPQAIDYLQKAFRVRRQ-SGPILLSRQCATNQYLRKRDDPHRYCQGPCANVTKCGPVVVPEHHLQQCRVCSESGKSCGPVGPPDGEGVARADFVLYVSAMTTERCGQENIVAYAAYCQLESELDRPIAGYANLCPNMISTQPQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDGGKPLTPRSASGLPAY--NESLGLYQWSDKVIKRATRLWDIRGGQMVRHTVHLLATPRVVEEARRHFNCPILEGMELENQGGAGTELNHWEKRLLENEAMTGSHTQN--RVFSRITLAIMEDTGWYRANYSMAENLQWGRGLGCDFVMKSCKFWIDQHRHKPT-LSPYCDSVRSAPLQLTCRQDQLAVAVCNLQKFSNALPAEYQYFDHIPGVPKEDLSAYGGAVEIADYCPFSQEFSWHVGGEYQRSSYCR-IQENQPATWRNYGAEQYGPGSVCLYQKSAFVMEQCTKRMTYPDWGSGCYKVSCTA 521          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Zebrafish
Match: si:ch211-216p19.5 (si:ch211-216p19.5 [Source:ZFIN;Acc:ZDB-GENE-160728-97])

HSP 1 Score: 81.2629 bits (199), Expect = 1.383e-15
Identity = 72/266 (27.07%), Postives = 115/266 (43.23%), Query Frame = 3
Query:  420 CLGITIPEEYLKRCRKILPSGE---IIYSQSEGPGIENVDIIIVVAFTH----CNDHTKASAASCFIEKQLD-RPILGVIEMCIGKFQVNVNVIES-VKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDID-AVDLEDAGGSGSALT-HFDEYLLHNDIMTPQTNNA-LDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKG 1181
            CLG+ IP+E+L  C  + P+ E       +  GPG+ + D ++ V FTH    C   +   A +   +   D RP+ G + +C    +      +  VK + HE+ H LGF+         SN        + GV             W+   +    +T +    +Y  T        +++  Q+HF     D    LE+   +   L+ H++  +L   IM      A L  I   TLA LQDTGWY V++S+AQ   +G+G+G
Sbjct:  121 CLGVIIPDEHLDGC-SVYPNPEHPVPTVLRPRGPGVPDADFLLYV-FTHNTEKCRAESSVLAYTAHCQTGSDGRPLAGTMVICRETLKKERYTYQHFVKTVIHELFHVLGFSKELL-----SNWKDCTVSSQIGVDC-----------WSHGQVTSTDQTGQV--RLYSPT--------VIRAMQKHFNSTHTDLGAPLENKDAALDGLSSHWEARVLQGSIMAASLVEASLVRIDAITLAALQDTGWYSVNHSRAQSLVWGEGEG 358          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Xenopus
Match: LMLN (leishmanolysin-like (metallopeptidase M8 family) [Source:NCBI gene;Acc:100487583])

HSP 1 Score: 79.7221 bits (195), Expect = 4.361e-15
Identity = 56/200 (28.00%), Postives = 88/200 (44.00%), Query Frame = 3
Query: 1125 WYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLT-YYNEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS-------APNSFCNDITNSYLQDKYNILTSYYGKDSLCIEN----TLENSIDTVYY---GASCQKYSYNATSKEYQIFIGPNSLTC 1679
            WY  +YS A+  D+G+ +GC   +K C  ++++ ++KN  L PFCD V        C + +     C+L  + + + +E QYF +IPG+  +D   Y G  E  +FCPF   F          +S C    N     K N     YG  S C+E      +E     + Y   G+ C  Y  + T    Q+++      C
Sbjct:  182 WYRANYSMAERLDWGRRQGCDFAMKSCKFWIDKLKRKNQRLSPFCDTVRSNPLQLTCRQDQKAVAICNLQRFASPLPQEYQYFDDIPGVLADDLPHYGGAVEIADFCPFAQEFRWHQSGEFQRSSDCRAPENQPASSK-NYGAERYGPGSACLEQRSAFVMEQCTKRMSYPDWGSGC--YQVSCTEDGLQVWVHDTPYLC 378          

HSP 2 Score: 67.0106 bits (162), Expect = 3.827e-11
Identity = 53/192 (27.60%), Postives = 94/192 (48.96%), Query Frame = 3
Query:  324 VLRVDRRC-INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGE--IIYSQSEGPGIENVDIIIVVAFT---HCN-DHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVN-VIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTR 875
            +L  +R+C  N   +   D  R C   C  +T+   + +PEE+L++CR    +          +GPGI + D ++ V+      C+ ++  A AA C +E ++DRPI G   +C           +  +  ++HEIIHALGF+   +A++   +G P+ PR   G+P       E++Y  N  + +++   R
Sbjct:   10 ILCHNRQCATNQYLKKRDDPHRYCHGACSESTRSGPVIVPEEHLQQCRVCSETQWHCGPSGPPDGPGIPDTDFVLYVSAMTTERCSQENIVAYAAYCQLEAEMDRPIAGYANLCPNMISTQPQEFVGMLSTVKHEIIHALGFSAGLFAFYYDDDGNPLTPRYINGLPYFN----ERWYRANYSMAERLDWGR 197          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Mouse
Match: Lmln (leishmanolysin-like (metallopeptidase M8 family) [Source:MGI Symbol;Acc:MGI:2444736])

HSP 1 Score: 231.106 bits (588), Expect = 1.907e-66
Identity = 158/547 (28.88%), Postives = 262/547 (47.90%), Query Frame = 3
Query:  123 EMVTGIEIDQNLQNYRTRKSSSHLRIHYHYTDSFGSY-PNSD-AIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRC-INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKI----LPSGEIIYSQSEGPGIENVDIIIVV---AFTHCNDHTKAS-AASCFIEKQLDRPILGVIEMCIGKFQVNVN-VIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESV-NGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMT-PQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYY-NEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS--APNSFCNDITNSYLQDKYNILTSY----YGKDSLC-------IENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTC 1679
            E++  + +  N  +   R +  HLRI   Y  S     P     +K ++   +   +E+  + + P   +L + R+C  N   R   D  R C   C   TKC  + +PEE+L++CR       P G +     EG  + + D ++ V   A   C+     S AA C  E ++DRPI G   +C           I  +  ++HEIIHALGF+   +A++   +G P+  R   G+P    N     Y W+DK+++KV+R      N I + T+   V   +V+ A++HF CP ++ ++LE+ GG G+ L H+++ LL N+ MT   T N   V+S+ TLAL++DTGWY+ +YS A+  D+G+G GC    K C  ++++ RQ+     P+CD +        C + +     C+L  + N +  E QYF E+ GI  ED  +Y G  E  ++CPF   FS      +        L+++  +  +Y    YG  S+C       I    E  +    +G+ C  Y  + + +  ++++   S  C
Sbjct:   62 EVINKVHLKTN--HVTKRDADGHLRIKTIYDQSIEELLPEKRYLVKNKLFPQAISYLEKTFQVRRPAGRIL-LSRQCATNQYLRKENDPHRYCTGECAVHTKCGPVIVPEEHLQQCRVCREGKWPCGAVGVLDPEG--VRDADFVLYVGALATERCSHENIISYAAYCQQEAKMDRPIAGYANLCPNMISTQPQEFIGMLSTVKHEIIHALGFSAGLFAFYHDQDGNPLTSRSADGLPPF--NYSLGLYQWSDKVVRKVERLWNVRDNKIVRHTVYLLVTPRVVEEARKHFNCPVLEGMELENQGGMGTELNHWEKRLLENEAMTGSHTQNR--VLSRITLALMEDTGWYKANYSMAEKLDWGRGLGCEFVRKSCKFWIDQHRQRRQVPSPYCDTLRSNPLQLTCRQDQRAVAVCNLQRFPNPLPPEYQYFDELTGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPELFKNYGAEQYGPHSVCLLQKSAFIMEQCERKLSYPDWGSGC--YQVSCSPQGLKVWVQDTSYLC 597          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Mouse
Match: Gm29776 (predicted gene, 29776 [Source:MGI Symbol;Acc:MGI:5588935])

HSP 1 Score: 85.8853 bits (211), Expect = 5.794e-17
Identity = 73/262 (27.86%), Postives = 116/262 (44.27%), Query Frame = 3
Query:  420 CLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVVAFTHCNDHTK-----ASAASCFIEKQLDRPILGVIEMCIGKFQV-NVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPD-IDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDV-ISKFTLALLQDTGWYEVDYSKAQDYDYGKGKG 1181
            CLG  IP+ +L+        G     Q +GPG++N D ++ V   H +   K     A AA C ++ + DRP+ G I  C    +   ++  + V    HE++HALGF+   +  +R             G+ A             +    + Q TR    G    T  A V  ++ K    H G P  +    LE+  GS S  +H++  LL   IMT   + A    +   TLA  +D+GWY+V++S A++  +G+G G
Sbjct:  140 CLGAKIPDAHLRGYSLWPEHGLPQLIQPDGPGVQNADFLLYVQVAHTSKCHKEPSVIAYAACCQLDSE-DRPLAGTIVYCGQHLRSPTLSHDDIVMATLHELLHALGFSGQLFKMWRDCPS---------GLSA------------RENCSTRKQVTRRDERGQLLLTTPA-VSHSLAK----HLGVPGTLQGAPLEEKQGSLS--SHWESRLLQGSIMTATFHGAQHTRLDPVTLAAFEDSGWYQVNHSAAEELLWGQGSG 372          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Mouse
Match: Gm29776 (predicted gene, 29776 [Source:MGI Symbol;Acc:MGI:5588935])

HSP 1 Score: 67.0106 bits (162), Expect = 2.204e-11
Identity = 64/257 (24.90%), Postives = 99/257 (38.52%), Query Frame = 3
Query:  420 CLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVVAFTHCNDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQ-SNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPD-IDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDV-ISKFTLALLQDTGWYEVDYSKAQDYDYGKGKG 1181
            CLG  IP+ +L+        G     Q +GPG++N D ++ V   H         + C  E  L                             HE++HALGF+   +  +R   +GL                         +    + Q TR    G    T  A V  ++ K    H G P  +    LE+  GS S  +H++  LL   IMT   + A    +   TLA  +D+GWY+V++S A++  +G+G G
Sbjct:  137 CLGAKIPDAHLRGYSLWPEHGLPQLIQPDGPGVQNADFLLYVQVAH--------TSKCHKEATL-----------------------------HELLHALGFSGQLFKMWRDCPSGLSA----------------------RENCSTRKQVTRRDERGQLLLTTPA-VSHSLAK----HLGVPGTLQGAPLEEKQGSLS--SHWESRLLQGSIMTATFHGAQHTRLDPVTLAAFEDSGWYQVNHSAAEELLWGQGSG 327          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|Q29AK2|LMLN_DROPS (Leishmanolysin-like peptidase OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA17800 PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 4.679e-66
Identity = 155/516 (30.04%), Postives = 247/516 (47.87%), Query Frame = 3
Query:  321 GVLRVDRRCINGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGE---IIYSQSEGPGIENVDIIIVVAFTHCN----DHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIES-VKIIQHEIIHALGFALNKYAYFRQSNGLPIVPR-DEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIY-KKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYN-EVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS-------APNSFCNDITNSYLQDKYNILTSYYGKDSLCI--------ENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTC--PSNFASHFVIDN--FYKISVKCPEFMMKSNSEICG 1778
            G++R++R+C + +     +G   CI+ C A T C  + +P E+L  CR    +G+   I  +   G GI+N D +  V+           T A AA C  E  LDRPI G   +C          +++ +  ++HEI+HALGF+++ YA+FR   G P  PR  E G P L  N   + + W+++ I+KV R   SV G +  K +D  V   +V  A+ HF C  ++  +LED GG G+ALTH+++ +L N+ MT  T+    V S+ TLAL++D+GWY  +YS A    +GKG GC+  ++ C  +++    +   + PFC +V Q      C+  RN    C+L  ++ E+ K  Q F  +  +K  +  FY G     + CP+   F+          S C  + N+   +K N     YG  S C         E +   + +  ++G+ C  Y Y        I +G  +  C  P    S  +  N   +K ++ CP        E+CG
Sbjct:  124 GIIRLNRKCDSTQVYVK-NGHTHCIDQCKATTMCGEVQVPNEHLDVCRVCNATGQNCRIDSNTQPGDGIQNADFVFYVSARQTQRCFKGLTVAYAAHCQQEAALDRPIAGHANLCPESISTKPQELQTLISTVKHEILHALGFSVSLYAFFRDDEGRPRTPRKSETGKPFL--NEKLQIHQWSNETIRKVVRENWSVRGGHVNKEVDMMVTPRVVAEARAHFDCDKLEGAELEDQGGEGTALTHWEKRILENEAMT-GTHTQSPVFSRITLALMEDSGWYRANYSMATPLSWGKGLGCSFAMRSCKDWIQMNHARGRSIHPFCSKVKQDPLQTECTDDRNSVALCNLIRHDYELPKSYQNFDSLQNVKSGEEGFYGGSVSLADHCPYIQEFTWRSKNIIVRGSHCRFVENNPKPEK-NFALESYGHGSKCFDHSEAMWEERSCHQTREWQHWGSGC--YKYTCFDGRLHILVGNYTYKCSFPGQKLSIRIAANGWLHKGAIMCPPC-----HELCG 627          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|Q8BMN4|LMLN_MOUSE (Leishmanolysin-like peptidase OS=Mus musculus OX=10090 GN=Lmln PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 1.334e-65
Identity = 158/547 (28.88%), Postives = 262/547 (47.90%), Query Frame = 3
Query:  123 EMVTGIEIDQNLQNYRTRKSSSHLRIHYHYTDSFGSY-PNSD-AIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRC-INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKI----LPSGEIIYSQSEGPGIENVDIIIVV---AFTHCNDHTKAS-AASCFIEKQLDRPILGVIEMCIGKFQVNVN-VIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESV-NGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMT-PQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYY-NEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS--APNSFCNDITNSYLQDKYNILTSY----YGKDSLC-------IENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTC 1679
            E++  + +  N  +   R +  HLRI   Y  S     P     +K ++   +   +E+  + + P   +L + R+C  N   R   D  R C   C   TKC  + +PEE+L++CR       P G +     EG  + + D ++ V   A   C+     S AA C  E ++DRPI G   +C           I  +  ++HEIIHALGF+   +A++   +G P+  R   G+P    N     Y W+DK+++KV+R      N I + T+   V   +V+ A++HF CP ++ ++LE+ GG G+ L H+++ LL N+ MT   T N   V+S+ TLAL++DTGWY+ +YS A+  D+G+G GC    K C  ++++ RQ+     P+CD +        C + +     C+L  + N +  E QYF E+ GI  ED  +Y G  E  ++CPF   FS      +        L+++  +  +Y    YG  S+C       I    E  +    +G+ C  Y  + + +  ++++   S  C
Sbjct:   62 EVINKVHLKTN--HVTKRDADGHLRIKTIYDQSIEELLPEKRYLVKNKLFPQAISYLEKTFQVRRPAGRIL-LSRQCATNQYLRKENDPHRYCTGECAVHTKCGPVIVPEEHLQQCRVCREGKWPCGAVGVLDPEG--VRDADFVLYVGALATERCSHENIISYAAYCQQEAKMDRPIAGYANLCPNMISTQPQEFIGMLSTVKHEIIHALGFSAGLFAFYHDQDGNPLTSRSADGLPPF--NYSLGLYQWSDKVVRKVERLWNVRDNKIVRHTVYLLVTPRVVEEARKHFNCPVLEGMELENQGGMGTELNHWEKRLLENEAMTGSHTQNR--VLSRITLALMEDTGWYKANYSMAEKLDWGRGLGCEFVRKSCKFWIDQHRQRRQVPSPYCDTLRSNPLQLTCRQDQRAVAVCNLQRFPNPLPPEYQYFDELTGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPELFKNYGAEQYGPHSVCLLQKSAFIMEQCERKLSYPDWGSGC--YQVSCSPQGLKVWVQDTSYLC 597          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|Q9VH19|LMLN_DROME (Leishmanolysin-like peptidase OS=Drosophila melanogaster OX=7227 GN=Invadolysin PE=2 SV=2)

HSP 1 Score: 226.868 bits (577), Expect = 6.728e-64
Identity = 153/516 (29.65%), Postives = 246/516 (47.67%), Query Frame = 3
Query:  321 GVLRVDRRCINGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGE---IIYSQSEGPGIENVDIIIVVAFTHCN----DHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIES-VKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRD-EFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIY-KKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYN-EVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS-------APNSFCNDITNSYLQDKYNILTSYYGKDSLCI--------ENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTC--PSNFASHFVIDN--FYKISVKCPEFMMKSNSEICG 1778
            GV+R++R+C + +     +G   CI+ C A T C  + +P+ +L  CR    +G+   I  +   G GIEN D +  V+           T A AA C  E  LDRPI G   +C          +++ +  ++HEI+HALGF+++ YA+FR  +G P  PR  + G P L  N   + + W+++ I+KV R   SV G +  K +D  V   ++   + HF C  ++  +LED GG G+ALTH+++ +L N+ MT  T+    V S+ TLAL++D+GWY  +YS A    +GKG GC   ++ C  +++    +   + PFC +V Q      C+  RN    C+L  +  E+ K  Q F  +  +K  +  FY G     + CP+   F+          S C    N+   +K N     YG+ + C         E +   + +  ++G+ C  Y Y+       I +G  S  C  P    S  +  N   +K ++ CP        E+CG
Sbjct:  124 GVIRLNRKCDSTQVYVK-NGHTHCIDHCKATTMCGEVQVPDAHLDVCRVCNATGQNCRIDSNTQPGEGIENADFVFYVSARQTQRCFKGLTVAYAAHCQQEAALDRPIAGHANLCPESISTKPQELQTLISTVKHEILHALGFSVSLYAFFRDDDGKPRTPRKLDTGKPYL--NEKLQIHQWSNETIRKVVRENWSVRGGHVNKVVDMMVTPRVIAEVRAHFNCNKLEGAELEDQGGEGTALTHWEKRILENEAMT-GTHTQSPVFSRITLALMEDSGWYRANYSMATPLTWGKGLGCAFAMRSCKDWIQYNHARGRSIHPFCSKVKQDPLQTECTDDRNSVALCNLIRHEFELPKGYQNFDSLNHVKDGEEGFYGGSVSLADHCPYIQEFTWRSKNVIVRGSHCRFTENNPRPEK-NFALESYGEGAKCFDHSESMWEERSCHQTREWQHWGSGC--YKYDCFDGRLHILVGNYSYKCSFPGQKLSIRIAANGWLHKGAIMCPPC-----HELCG 627          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|O62446|LMLN_CAEEL (Leishmanolysin-like peptidase OS=Caenorhabditis elegans OX=6239 GN=Y43F4A.1 PE=3 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 4.776e-54
Identity = 128/434 (29.49%), Postives = 211/434 (48.62%), Query Frame = 3
Query:  192 LRIHYHYTDSFGSYPNS--DAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSRTNADGIR--GCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVVAF---THC-NDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESV-KIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVN-GIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGN----IARCSKKRNYYDYCHLT-YYNEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPF 1448
            LRI  HY  S  +      + +   ++  +    E  L+ + P+   +R+ R+CI+        G+R   C +GC   T C    IP ++L  C     + +   +   G G+++ D I+ V       C    T + AA C  E   DRPI G + +C     V+ +  E +   ++HEI+HALGF++  YA+FR S G P   R+ +G P    N  + YY W+   I  V R       G     +   V   + + A+ HFGC  ++  +LE+ GG G+ LTH+++    N+ MT  T+    V S+ TLA L+DTGWY+ +Y  A+D  +GK  GC   +K C  ++ E++       P+C  +   G+    I RC+ +R+    C+L  +  E+  + + F  +PG+  + A++Y G  E  ++CPF
Sbjct:   70 LRIQLHYDKSIQNLTAEVQNFVNTTLLPEAVGYWENALRVR-PMTTPIRLRRKCISSFYYYK-QGMRNVACDKGCRERTTCGEADIPRDHLLDCLACNNTDDCKTTGELGEGVKDTDFILYVTAHDSKRCEGPETLSYAAHCQQEADFDRPIAGNVNLCPSALSVHNHDYEILTSTVKHEILHALGFSVGLYAFFRDSEGKPRTKRNRYGRPT-SLNKQKGYYDWDSNTITTVLRENWWTGEGKVIHPIHMMVTPKVREEARRHFGCDKLEGAELENQGGEGTYLTHWEKRAYENEAMT-GTHTQNPVYSRLTLAFLEDTGWYQPNYEVAEDLHWGKQLGCDFAMKSCGEWIHEKKILGEDAYPYCSDIKHDGSKSMAITRCTTQRDSLALCNLVPFQKELPSQYRNFMSLPGVNPDGAKYYGGSVEMADYCPF 499          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|Q61YG1|LMLN_CAEBR (Leishmanolysin-like peptidase OS=Caenorhabditis briggsae OX=6238 GN=CBG03556 PE=3 SV=2)

HSP 1 Score: 196.823 bits (499), Expect = 3.355e-53
Identity = 126/434 (29.03%), Postives = 207/434 (47.70%), Query Frame = 3
Query:  192 LRIHYHYTDSFGSYPNS--DAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSRTNADGIR--GCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVVAFTHC----NDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESV-KIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVN-GIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGN----IARCSKKRNYYDYCHL-TYYNEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPF 1448
            LRI  HY  S  +        +   ++  +    E  L+ + P+   +R+ R+CI+        G+R   C +GC   T C    IP ++L  C     + +   +   G G++  D I+ V   +        T + AA C  E   DRPI G + +C     V+ +  E +   ++HEI+HALGF++  YA+FR  +G P   R+ +G P    N    YY W+   I  V R       G     +   V   + + A+ HFGC  ++  +LE+ GG G+ LTH+++    N+ MT  T+    V S+ TLA L+DTGWY+ +Y  A+D  +GK  GC   +K C  ++ ++R       P+C  +   G     I RC+ +R+    C+L  +  E+  + + F  +PG+  + A++Y G  E  ++CPF
Sbjct:   70 LRIQLHYDKSIQNLTAEVQHFVNTTLLPEAVGYWENALRVR-PMKTPIRLRRKCISSFYYYK-QGMRNVACDKGCRERTTCGEADIPNDHLLDCLACNNTDDCQTTGEMGEGVKESDFILYVTAHNSKRCEGPETLSYAAHCQQEADFDRPIAGNVNLCPSALSVHNHDYEILTSTVKHEILHALGFSVGLYAFFRDKDGKPRTKRNRYGRPT-SLNKQRGYYDWDKNTITTVLREEWWTGEGKVIHPIQMMVTPKVREEARRHFGCDKLEGAELENQGGEGTVLTHWEKRAYENEAMT-GTHTQNPVYSRLTLAFLEDTGWYQPNYEVAEDLHWGKQLGCDFAMKSCGEWIHQKRILGEDAYPYCSDIKHDGTKSMAITRCTSQRDSLALCNLIPFQKELPPQYRNFMSLPGVNPDGAKYYGGSVEMADYCPF 499          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: G7YNV5 (Leishmanolysin-like peptidase (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_104496 PE=3 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 2.702e-78
Identity = 165/487 (33.88%), Postives = 257/487 (52.77%), Query Frame = 3
Query:   57 TVLILVLQKLI---SVESSERQDLDEMVTGIEIDQNLQNYRTRK-SSSHLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSR--TNADGIRG--CIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVV---AFTHCNDHTKASAASCFIEKQLDRPILGVIEMC---IGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEF-GVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLE-------NIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVFKEN-QYFREIPGIKKEDAQFYAGQSEFNEFCPF 1448
            T   +VL K +    V ++   D+  +   +E+ +++ +  +   S   LRI  +YT +F +   S+A+K Q +EP+       L+AK+PIN VL   R+C  G S+   + DG+    C  GC A T C    IP+EYL +CR+I+ +G    +   G G+ N D++I+V     T+CN    A A +C +E +LDRP+LG I +C   IG    +  ++ S   I HE+ HALGF+   YA+ R ++G P  PRD    +P LG+ +   +        +    T ++VN  +K  +  F+L        ++++ A+ HF CP +D VDLE+ GGSG+A++HF++ + +ND+MT      L V S  TL+  QDTGWY VD SKA D+ +GKG GCT   K CY +M E R +   + P+C           C    N +  C L  Y+ + +   QYFR++P +      +Y G+    + CPF
Sbjct:   56 TTSFIVLSKGLRPHEVTNATFMDIQVVRKKLEVAEHVTHVTSEALSVGSLRITPYYTLAFENTAQSEALKTQFIEPAIAYWSEALEAKSPINNVLSFARQCDGGLSQKEVDTDGVERNFCTRGCKAKTLCYTEPIPDEYLDQCREII-NGSPQRTGYAGAGLSNTDMLILVDASVTTNCNGVVLAYATTCQLEIKLDRPVLGYINLCPSSIGFNYPDSRILYSA--ILHELGHALGFSSLLYAFMRDTDGNPRTPRDPITNLPNLGRTDYGTF--------RAASSTVDTVNREWKSALGTFLLPVWTLKTPHVLEYAKTHFNCPTLDGVDLENEGGSGTAISHFEKRIGNNDLMTGSIEQTL-VPSPLTLSFFQDTGWYNVDMSKAADWKWGKGLGCTFVQKSCYEFM-ESRTREESMRPWCAE--PPAGQTECLSYDNAFGQCDLRMYSSMLEAKYQYFRQLPNVPTSTVPYYGGKHSLMDRCPF 527          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: A0A3R7FUZ7 (Leishmanolysin-like peptidase OS=Clonorchis sinensis OX=79923 GN=CSKR_4710s PE=3 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 4.028e-78
Identity = 165/487 (33.88%), Postives = 257/487 (52.77%), Query Frame = 3
Query:   57 TVLILVLQKLI---SVESSERQDLDEMVTGIEIDQNLQNYRTRK-SSSHLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSR--TNADGIRG--CIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVV---AFTHCNDHTKASAASCFIEKQLDRPILGVIEMC---IGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEF-GVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLE-------NIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVFKEN-QYFREIPGIKKEDAQFYAGQSEFNEFCPF 1448
            T   +VL K +    V ++   D+  +   +E+ +++ +  +   S   LRI  +YT +F +   S+A+K Q +EP+       L+AK+PIN VL   R+C  G S+   + DG+    C  GC A T C    IP+EYL +CR+I+ +G    +   G G+ N D++I+V     T+CN    A A +C +E +LDRP+LG I +C   IG    +  ++ S   I HE+ HALGF+   YA+ R ++G P  PRD    +P LG+ +   +        +    T ++VN  +K  +  F+L        ++++ A+ HF CP +D VDLE+ GGSG+A++HF++ + +ND+MT      L V S  TL+  QDTGWY VD SKA D+ +GKG GCT   K CY +ME  R +   + P+C           C    N +  C L  Y+ + +   QYFR++P +      +Y G+    + CPF
Sbjct:   56 TTSFIVLSKGLRPHEVTNATLMDIQVVRKKLEVAEHVTHVTSEALSVGSLRITPYYTLAFENTAQSEALKTQFIEPAIAYWSEALEAKSPINNVLSFARQCDGGLSQKEVDTDGVERNFCTRGCKAKTLCYTEPIPDEYLDQCREII-NGSPQRTGYAGAGLSNTDMLILVDASVTTNCNGVVLAYATTCQLEIKLDRPVLGYINLCPSSIGFNYPDSRILYSA--ILHELGHALGFSSLLYAFMRDTDGNPRTPRDPITNLPNLGRTDYGTF--------RAASSTVDTVNREWKSALGTFLLPVWTLKTPHVLEYAKTHFNCPTLDGVDLENEGGSGTAISHFEKRIGNNDLMTGSIEQTL-VPSPLTLSFFQDTGWYNVDMSKATDWKWGKGLGCTFVQKSCYEFMES-RTREESMRPWCAE--PPAGQTECLSYDNAFGQCDLRMYSSMLEAKYQYFRQLPNVPTSTVPYYGGKHSLMDRCPF 527          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: A0A4E0R0T4 (Leishmanolysin-like peptidase OS=Fasciola hepatica OX=6192 GN=D915_007678 PE=3 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 2.021e-75
Identity = 160/514 (31.13%), Postives = 254/514 (49.42%), Query Frame = 3
Query:  144 IDQNLQNYRTRKSSSHLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSRTNADG----IRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVVAFTH---CNDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIE-SVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRD-EFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALD-VISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHL-TYYNEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFK----VIFSAPNSFCNDITNSYLQD-KYNILTSYYGKDSLCIENTLENSIDTVYYGASCQKYSYNATS 1637
            +++ + N  T+ + S+ RI   YT  F    +S+ IKK+I+E +      ++K K P  G  R  R CIN R   + D        C+ GC  AT C    IP   + +CR I+     +  ++ G G  N D +I V  T    C   T A  A C  E  LDRP +G I  C     ++   +  S     HE+ HA GF    +A+ R  NG P  PRD   G+P LG ++    Y+ ++ ++++     +S  G Y +T        +++ A++HFGCP +D V+LE+ GGSG+A  HF++ +  N++M      A D V+S F LA  QD+GWY+VD SKA+DY + KG GC    K CY YM  ++     + P+C+      +   C    N +  C+L     ++ ++NQYF  I G+ + +   Y G+    +FCP+     +I + P+++C+   NS  ++ K N L   YG ++ C  +    + ++ Y   + Q YS    S
Sbjct:   42 VNEGVPNLETKNNGSNFRITAIYTKGFYRNVHSERIKKEIVEFAISHWSSVMKPKKPFQGTFRAARGCINNRYELHQDSDGQIYEYCLTGCQRATDCFAARIPRYLMDKCRMIVDGKPTVTEEAPGIGEPNTDYVIFVDATDTEVCRQGTLAYTAICQTESTLDRPSMGYINFCSKGINLDFPHLRISRDTALHEMAHAFGFHDVLFAFMRTENGEPRTPRDNRTGMPTLGTHS-SGVYIPSEDVLEEKTMVWKSARGTYNRTRTLLKTPKLLETARKHFGCPSLDGVELENQGGSGTASAHFEKRIYLNELMVGSI--AFDAVMSPFVLAFFQDSGWYDVDISKAEDYRWAKGTGCDFVFKSCYEYMAIKQAAGQSILPWCNEASL--DKTSCLNYANAFGLCNLRKRVRKLPEQNQYFASIKGVPERELSLYGGEDSLADFCPYWAPEVLIENGPSTYCDHAENSKFENGKNNHLLEGYGSNARCFNHDQTQAWNS-YQCKAIQSYSPTTAS 549          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: A0A4E0RV18 (Leishmanolysin-like peptidase OS=Fasciola hepatica OX=6192 GN=D915_004040 PE=3 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 2.049e-75
Identity = 148/433 (34.18%), Postives = 233/433 (53.81%), Query Frame = 3
Query:  189 HLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGR--SRTNADG--IRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYS-QSEGPGIENVDIIIVVAF---THCNDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNV-NVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRD-EFGVPALGK--NNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVFKE-NQYFREIPGIKKEDAQFYAGQSEFNEFCPF 1448
            H RI   YT +F    NS+  K++I+E + E   + +K   P+ G LR+ R+CIN     ++ +DG     C EGC A T+C G+ +P EYL  CR +  +G+ I    +EG G+ N D  ++V      +C     A A  C +E +LDRP+L  I  C   F++   +++ S     HE+ HA GF+   +A+FR  NG P  PRD + G P LG+  N +   Y+ +   +  V R   +V G +          NI+K A+EHFGCPD++ +++E+ GG G+A  HF++ ++ N+IM    + A  V SK TLA   DTGWYEVD +KA+ Y + +  GC+     CY YME + + N  + P+C+++    +  +C    N Y  C+L          ++YF+ I G++++   +Y G S   +FCP+
Sbjct:   46 HFRITPLYTKNFERSINSERSKREIVEYALEYWSKAMKPIEPLTGPLRLSRQCINNEFVRQSGSDGQIYTYCTEGCSAQTRCFGVDLPSEYLNMCR-VFRNGQFIEEYGTEGSGLPNSDYAVLVDMYESRYCESDVIAYAGICQVESKLDRPVLEYINFCPRSFRLEYPHLLISRSAALHELAHAFGFSPTMHAFFRDENGQPRTPRDPKTGAPRLGRLRNGV---YIPSRSTVDYVVRKWLTVAGTFNVNRTILRTPNILKYAREHFGCPDLEGLEMENQGGDGTASAHFEKRIVLNEIMAGSVSLAATV-SKLTLAYFLDTGWYEVDMTKAESYTWARNAGCSFARLSCYEYMEAKIRNNQSVAPWCNQI--QTDATQCLSYTNAYGSCNLKKLTFTLHPIHRYFKSISGVEQKMLGYYGGASVLTDFCPY 471          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: A0A1S8WW94 (Leishmanolysin-like peptidase (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_05652 PE=3 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 2.915e-74
Identity = 152/433 (35.10%), Postives = 230/433 (53.12%), Query Frame = 3
Query:  180 SSSHLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSR--TNADGIRG--CIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVV---AFTHCNDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESV-KIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDE-FGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVFK-ENQYFREIPGIKKEDAQFYAGQSEFNEFCPF 1448
            S   LRI  +YT +F +   S A+K Q +EP+     + L+AK+PI+ VL   R+C  G SR   + DG+    C  GC A + C    IP+EYL +C +I+ +G    +   G G+ N D++I+V   A + C+    A A +C +E  LDRP+LG I +C      N   I+ V   I HE+ HALGF+   YA+ R ++G P  PRD    +P LG+ +    +      I  V R  ++  G +  ++      +++  A+ HF CP +D VDLE+ GGSG+A++HF++ + +ND+MT      L V S  TL+  QDTGWY VD S+A D+ +GKG GCT   K CY +M E R +   + P+C           C    N +  C L  ++ + + E QYFR++P +      +Y G+    + CPF
Sbjct:   16 SVGSLRITPYYTLAFENAAQSAALKTQFVEPAIAYWSKALEAKSPISDVLSFARQCNGGLSRKAVDIDGVERSFCTYGCKAQSMCYTEPIPDEYLDQCLEII-NGTPQRTGYAGAGLPNTDMLILVDASATSTCDGVVLAYATTCQLEVTLDRPVLGYINLCPSSIGFNYPDIKIVYSAILHELGHALGFSSLLYAFMRDTDGNPRTPRDPNTNLPNLGRTD-HGTFRAASSTIDIVNREWKAAFGTFSLSVWTLKTPHVLGYARTHFDCPTLDGVDLENEGGSGTAISHFEKRIGNNDLMTGSIEQLL-VPSPLTLSFFQDTGWYNVDMSRAADWKWGKGLGCTFVQKSCYEFM-ESRTREQSIRPWCAE--PPAGQTECLSYDNAFGQCDLRMHSSILEAEYQYFRQLPNVPTSMVPYYGGKHSLMDRCPF 442          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Cavefish
Match: lmln (leishmanolysin like peptidase [Source:NCBI gene;Acc:103047341])

HSP 1 Score: 236.884 bits (603), Expect = 1.562e-68
Identity = 152/530 (28.68%), Postives = 257/530 (48.49%), Query Frame = 3
Query:  174 RKSSSHLRIHYHYTDSFGSYP--NSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRC-INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEII--YSQSEGPGIENVDIIIVVAFT---HCN-DHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIES-VKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNG--IYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMT-PQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVF-KENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS-------APNSFCNDITNSYLQDKYNILTSYYGKDSLC-------IENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTC 1679
            R +   L+I   Y  S        S  +K ++   + + ++R  + +     VL + R+C  N   R   D  R C   C   T+C  + +P+E+L++CR    +G+        +G G++  D ++ V+      C  ++  A AA C +E +LDRPI G   +C       +   E  +  ++HEIIHALGF+   +A++   +G P+ PR   G+PA   N     Y W+D++I++  R  + + G  + +  +   V   +V+ A+ HF CP ++ ++LE+ GG G+ L H+++ LL N+ MT   T N   V S+ TLA+++DTGWY  +YS A++ ++GKG GC   +K C  ++++QR     L P+C+ V        C + +     C+L  Y++    E QYF  IPG+ +ED   Y G  E  +FCPF   FS         +S+C  I  +      N     YG +S+C       +    + S+    +G+ C  Y    T+    +++   S  C
Sbjct:   86 RSTEQQLKIQIFYDSSLDVLDEDKSSLVKDKLFPQAIDYLQRAFRVRRQTGPVL-LSRQCSTNQYLRKKDDPHRYCQGACADITRCGPVIVPDEHLQQCRVCSETGKSCGPVGPPDGEGVDRADFLLYVSAVTTERCGQENIVAYAAYCQLEAELDRPIAGYANLCPNMISTQLQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDDGKPLTPRFASGLPAF--NETLGLYQWSDRVIRRSTRLWD-IRGRHMVRHEVHLMVTPRVVEEARRHFNCPILEGMELENQGGMGTELNHWEKRLLENEAMTGSHTQN--RVFSRITLAIMEDTGWYRANYSMAENLEWGKGLGCDFVMKSCKFWIDQQRHARLSLTPYCESVRGTPLQLSCRQDQLAVAVCNLQKYSQPLPTEYQYFDSIPGVPEEDLSMYGGAVEIADFCPFSQEFSWHLSGEYQRSSYCR-IQENQPDSWRNYAAEEYGPNSVCLYQKSAFVMKQCKKSMTYPDWGSGC--YKMTCTALGLLVWVQDQSFLC 606          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Cavefish
Match: lmln (leishmanolysin like peptidase [Source:NCBI gene;Acc:103047341])

HSP 1 Score: 236.884 bits (603), Expect = 2.044e-68
Identity = 152/530 (28.68%), Postives = 257/530 (48.49%), Query Frame = 3
Query:  174 RKSSSHLRIHYHYTDSFGSYP--NSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRC-INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEII--YSQSEGPGIENVDIIIVVAFT---HCN-DHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIES-VKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNG--IYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMT-PQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVF-KENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS-------APNSFCNDITNSYLQDKYNILTSYYGKDSLC-------IENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTC 1679
            R +   L+I   Y  S        S  +K ++   + + ++R  + +     VL + R+C  N   R   D  R C   C   T+C  + +P+E+L++CR    +G+        +G G++  D ++ V+      C  ++  A AA C +E +LDRPI G   +C       +   E  +  ++HEIIHALGF+   +A++   +G P+ PR   G+PA   N     Y W+D++I++  R  + + G  + +  +   V   +V+ A+ HF CP ++ ++LE+ GG G+ L H+++ LL N+ MT   T N   V S+ TLA+++DTGWY  +YS A++ ++GKG GC   +K C  ++++QR     L P+C+ V        C + +     C+L  Y++    E QYF  IPG+ +ED   Y G  E  +FCPF   FS         +S+C  I  +      N     YG +S+C       +    + S+    +G+ C  Y    T+    +++   S  C
Sbjct:   86 RSTEQQLKIQIFYDSSLDVLDEDKSSLVKDKLFPQAIDYLQRAFRVRRQTGPVL-LSRQCSTNQYLRKKDDPHRYCQGACADITRCGPVIVPDEHLQQCRVCSETGKSCGPVGPPDGEGVDRADFLLYVSAVTTERCGQENIVAYAAYCQLEAELDRPIAGYANLCPNMISTQLQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDDGKPLTPRFASGLPAF--NETLGLYQWSDRVIRRSTRLWD-IRGRHMVRHEVHLMVTPRVVEEARRHFNCPILEGMELENQGGMGTELNHWEKRLLENEAMTGSHTQN--RVFSRITLAIMEDTGWYRANYSMAENLEWGKGLGCDFVMKSCKFWIDQQRHARLSLTPYCESVRGTPLQLSCRQDQLAVAVCNLQKYSQPLPTEYQYFDSIPGVPEEDLSMYGGAVEIADFCPFSQEFSWHLSGEYQRSSYCR-IQENQPDSWRNYAAEEYGPNSVCLYQKSAFVMKQCKKSMTYPDWGSGC--YKMTCTALGLLVWVQDQSFLC 606          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004358.1 (pep scaffold:Pmarinus_7.0:GL476418:369102:375246:1 gene:ENSPMAG00000003980.1 transcript:ENSPMAT00000004358.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.849 bits (281), Expect = 3.431e-28
Identity = 74/243 (30.45%), Postives = 124/243 (51.03%), Query Frame = 3
Query:  192 LRIHYHYTDSFGSYPNS--DAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRC-INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYS--QSEGPGIENVDIIIVVAFTHCN----DHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVN-VIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNG 890
            LR+   Y  S  S PN   D IK ++   + + I+  L  ++P   +L ++R C  N     + D  R C   C   T+C  +T+P+E+L++CR     G    S   + GPG  + D ++ V+    +    +   A AA C +E QLDRPI G   +C  K  ++     + +  ++HE+IHALGF+   +A++R  +G P+ PR   G+P    N+    Y W++++ ++V R R +V G
Sbjct:    3 LRVRLIYDSSVDSLPNEKRDFIKMRLFPEAVDYIQSALFVRSPGAKIL-LNRYCATNHYFMKHRDPHRYCQSACAETTRCGPVTVPDEHLQQCRVCDEGGRNCGSIGPAGGPGEPDADYVLYVSALGTDRCQQEGVVAYAAYCQLEAQLDRPIAGYANLCPDKVSLDAGEQPDMLSTVKHEVIHALGFSAGLFAFYRDDDGQPLTPRYGNGLPPF--NDTTGLYQWSERVARRVSR-RWAVRG 241          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002113.1 (pep scaffold:Pmarinus_7.0:GL501047:4779:9283:1 gene:ENSPMAG00000001917.1 transcript:ENSPMAT00000002113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 9.718e-25
Identity = 58/184 (31.52%), Postives = 89/184 (48.37%), Query Frame = 3
Query: 1038 LHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHL-TYYNEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS-------APNSFCNDITNSYLQDKYNILTSYYGKDSLCIEN 1565
            L N+ MT  ++    + S+FTLAL++DTGWY  +YS A+   +G+G GC   ++ C  +M+ +      + PFC  V  +     C   R+    C+L  Y N +    QY   +PG+   D Q Y G  E  ++CPF   FS       +  S C +  N    ++ N     YG++S CIE 
Sbjct:    1 LQNEAMT-GSHTQRRIFSRFTLALMEDTGWYHANYSHAEALGWGRGLGCVFAMQSCKAWMDHRSDSGLNVAPFCKEVRGHPLRLGCGAGRSALVLCNLQRYTNPLPTHYQYLDFLPGVSSADMQLYGGLVEIADYCPFSQEFSWHEGGAFSRGSACQNPRNQP-DERVNYGLETYGQESACIEQ 182          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Nematostella
Match: EDO33070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST90])

HSP 1 Score: 202.601 bits (514), Expect = 1.909e-57
Identity = 148/519 (28.52%), Postives = 239/519 (46.05%), Query Frame = 3
Query:  246 AIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGR---SRTNADG---IRGCIEGCVAATKCLGI-TIPEEYLKRCRKILPSGEIIYSQ---SEGPGIENVDIIIVV--AFTHCNDH-TKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVP----ALGKNNIEKYYLWNDKIIKKVQ------RTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQ-TNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIAR--CSKKRNYYDYCHLTYYNEVFK-ENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFSAPN-------SFCNDITNSYLQDKYNILTSYYGKDSLCI--ENTLENS-----IDTVYYGASCQKYSYNATSKEYQIFIGPNSLTC 1679
            ++ K+++  + +      + +  +  ++ +DRRC+N          DG   +R C   C A+    G   +P   +  CR     GE  +++   S G G  + D ++ V  +   C    T A AA C  E  +DRP+ G + +C  K  V+ +  E +   +HEI HALGF+ + YA+FR  NG  I PR + G+P    ALG+      Y W+D+ IK ++      RT +  NG+   T+   V   + +  Q+HF C  ++  +LE+ GG G+ L H+++ +  N+ MT   T NA  V S+ TLAL++DTGWY  ++  A+   +GK  GC      C  ++ +Q++      PFC  +       R  CS  +     C+L  Y +    E QYF  + GI   +   Y G  +  +FCP+   F   +       S+C   +N   ++K N    YYG D+ C       E S       +V +G+ C  Y Y       +I IG  +  C
Sbjct:   27 SVVKKVLSEAIQYFHDTFRVRQTVERII-LDRRCLNDSYFLKNATGDGPGKVRFCKVACDASKPLCGPRNVPRSDVAACRVCNEHGEDCHAENNSSSGVGKNDTDFVLYVTASMEKCEKRETLAYAAVCQQEGNVDRPVAGFLNICPDKMNVSNDQKELLATFKHEIFHALGFSPSLYAFFRYDNGTAITPRSDTGMPPYDLALGR------YTWSDRTIKTIERKDWMIRTDKGNNGMVSHTVQLMVTPRVQQEVQDHFNCSSLEGAELENQGGPGTELAHWEKRVFENEGMTGAFTQNA--VFSRVTLALMEDTGWYRSNFKMAETLRWGKNLGCLFVNNSCKAWLTQQQRLKEKAYPFCQTLKNSTEAQRTYCSNDKTSVAMCNLAQYTQPLPVEYQYFESLAGIN--NPGLYGGSVDLADFCPYYQGFVWTSKGAGLLGSYCLSSSNQKTEEK-NYGLEYYGSDAKCFLQGQVWEKSKCAVRWISVDWGSGC--YKYRCDQDGLKIIIGGLTYQC 531          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Nematostella
Match: EDO44382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW33])

HSP 1 Score: 194.512 bits (493), Expect = 4.619e-54
Identity = 130/413 (31.48%), Postives = 208/413 (50.36%), Query Frame = 3
Query:  312 PINGVLRVDRRCING------RSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSG-EIIY----SQSEGPGIENVDIIIVVA---FTHCN-DHTKASAASCFIEKQLDRPILGVIEMCIGKFQVN----VNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESV-NGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVF-KENQYFREIP---GIKKEDAQF-----YAGQSEFNEFCPFKVIFS 1463
            PI   +++ R C N        + T    ++ C E CV  T+C  +T+P  +L +CR     G E +       + GPGI   D ++ V+    +HC+  +  A A+ C  E  LDRP+ G   +C  +   +     N+I +VK   HE+ HALGF+   YA++R   G P+  R + G+P    N+    Y W++K++KKV R +  V +G    ++   V   +V+VA+EHF C  ++  ++E+ GG+G+ LTH+++ L  N+ MT  T     V S+ TLAL++DTGWY+ +YS A+  D+G+  GC    + C  +M+     N   +PFC  + Q     RC+  +     C+L  Y +    E QYF  +P     K  +A F     Y G     ++CPF   F+
Sbjct:   61 PIKIPIKLQRTCKNNAYFLKDETGTKLGDVQYCKEECVT-TRCGPVTVPARHLDQCRVCDARGLECVRMPGDEWASGPGITRRDFVLYVSSIQTSHCSVANAVAYASYCQQEHMLDRPVAGFANLCPDRLDTDPRHYSNLISTVK---HEVYHALGFSAGLYAFYRDKQGAPLTQRRKHGLPVY--NDKTNLYQWSNKVVKKVTRKKWQVRHGHVTHSVSMIVTPRVVRVAREHFNCATLEGAEIENQGGTGTELTHWEKRLFENEAMT-GTYTQNPVFSRLTLALMEDTGWYKANYSMAETLDWGRNLGCVFAKESCRTWMQSHVAHNKSSEPFCYTLKQAPLRMRCTHSKLSIALCNLRKYPQPLPPEYQYFSHLPKESSRKTREAVFADTDSYGGAVPLADYCPFYQKFT 466          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Medaka
Match: lmln (leishmanolysin like peptidase [Source:NCBI gene;Acc:101175034])

HSP 1 Score: 223.016 bits (567), Expect = 1.244e-63
Identity = 154/531 (29.00%), Postives = 259/531 (48.78%), Query Frame = 3
Query:  171 TRKSSS---HLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRC-INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGE--IIYSQSEGPGIENVDIIIVVA---FTHCN-DHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIES-VKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIY-KKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMT-PQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVFK-ENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFS-------APNSFCNDITNSYLQDKYNILTSYYGKDSLCIENTLENSIDTVY-------YGASCQKYSYNATSKEYQIFIGPNSLTC 1679
            T++SS     L+I   Y DS   Y    +++ ++   + + ++R    K+ +  +L + R C  N   R   D  R C E C   T+C  + +P  +L++C+     G+        +GPG+E  D ++ V+      C  ++  A AA C +E +LDRPI G   +C           E  +  ++HEIIHALGF+   +A++    G P+ PR   G+PA   N     Y W++ +I++V R  +   G+  +  +   V   +V+ A+ HF CP ++ ++LE+ GG+G+ L H+++ LL N+ MT   T N   V S+ TLA+++D+GWY  +YS AQ  D+G+G GC   +K C  +M++Q Q+   + P+C+ V        C + +     C+L  Y E    E QYF +I  +  +   FY G  E  ++CPF   FS         NS+C  ++ +      N     YG DS+C+       ++  +       +G+ C  Y  + T +   +F+   S TC
Sbjct:   60 TKRSSPDVLQLKIKIIY-DSSRCYKLFCSLQDKLFPQAIDFLQRAFSVKHRVGPIL-LSRLCATNQYMRKRNDPHRYCQESCADVTRCGPVIVPHHHLQQCKVCSEFGKSCGPTGPPDGPGVEGSDFVLYVSGITTERCGQENIVAYAAYCQLEAELDRPIAGYANLCPTMISSQPQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDEGKPLTPRFASGLPAF--NESLGLYQWSEAVIRRVSRLWDIRGGVMVRHHVHVMVTPRVVEEARNHFNCPILEGMELENQGGAGTELNHWEKRLLENEAMTGSHTQN--RVFSRLTLAIMEDSGWYRANYSLAQRLDWGRGLGCDFVMKSCKLWMDKQSQRRHAVTPYCNTVRSSPLQLTCRQDQLAVAVCNLQKYPEKLPLEYQYFDQISDVAADQLSFYGGAVEIADYCPFSQEFSWHLSGEYQRNSYCR-VSENQPDWWRNYGAEEYGPDSVCLYQKSAFVMEQCFRKMTYPDWGSGC--YKVSCTPQGLAVFVQDRSFTC 581          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000036783.1 (SMESG000036783.1)

HSP 1 Score: 1183.7 bits (3061), Expect = 0.000e+0
Identity = 571/580 (98.45%), Postives = 572/580 (98.62%), Query Frame = 3
Query:   48 MKITVLILVLQKLISVESSERQDLDEMVTGIEIDQNLQNYRTRKSSSHLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVVAFTHCNDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFSAPNSFCNDITNSYLQDKYNILTSYYGKDSLCIENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTCPSNFASHFVIDNFYKISVKCPEFMMKSNSEICGLMN 1787
            MKITVLILVLQKLISVESSERQDLDEMVTGIEIDQNLQNYRTRKSSSHLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGI NVDIIIVVAFTHCNDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIE+YYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEV KENQYFREI GIKKEDAQFYAGQSEFNEFCPFKVIFSAPNSFCNDITNSYLQDKYNILTSYYGKDSLCIENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTCPSN ASHFVIDNFYKISVKCPEFMMKSNSE   L N
Sbjct:    1 MKITVLILVLQKLISVESSERQDLDEMVTGIEIDQNLQNYRTRKSSSHLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIANVDIIIVVAFTHCNDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIERYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVSKENQYFREIHGIKKEDAQFYAGQSEFNEFCPFKVIFSAPNSFCNDITNSYLQDKYNILTSYYGKDSLCIENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTCPSNVASHFVIDNFYKISVKCPEFMMKSNSESQMLRN 580          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000008405.1 (SMESG000008405.1)

HSP 1 Score: 521.546 bits (1342), Expect = 6.593e-179
Identity = 258/574 (44.95%), Postives = 361/574 (62.89%), Query Frame = 3
Query:  117 LDEMVTGIEIDQNLQNYRTRKSSS-HLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVVAFTHCNDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFSAPNSFCNDITNSYLQDKYNILTSYYGKDSLCIENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTCPSNFASHFVIDNFYKISVKCPEFMMKSNSEICGLMNDIQNSWMKQDQIVYFE 1835
            + E+V GIE      N R ++++S +LRI++ Y  SF S   ++A+K  +MEP+K  ++ ++  K+P NG+L VDR C N   R N+   +GC  GC   T+CLGI +P  YLK C+ +   G    + S+G GI ++DI+++V +T+C+ +T A A SCF+E  LDRPILGV+ +C        N     K+I HEIIH+LGF+++KYA++R  +G PIVPR+ +G P LG +    YY WN+ IIK + R R SVN  Y      FVL N++  A+ HF CP ++AVDLED GG+ SA +HFDEY L N++MTPQ+N A+D +S+ TLALLQDTGWY VD+S   ++DYG+ KGC LP KGCY YM+ +  K+  LDP C+    YGNI  CS  RNY+  C+L  Y  V    QYF+ +PGI   D QFYAG S +NE+CP   + S PN  CND+ N+ +   YN + SY+G DS+CI   + N ++T  YGASCQK+SYN +S  Y  FIG + L CPSN   +F   N     V C  F ++S+S    L N   +S+ K+  ++ +E
Sbjct:   34 VSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGC-TQTECLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVS-ANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLFKYTSVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCPGYWVSSKPNFVCNDMQNNNVITGYNSIPSYFGSDSMCINTYINNGLNTSIYGASCQKFSYNPSS-SYSFFIGNSILKCPSNVIQNFTTSNGSLAYVDCITFNIESSSP--DLWNVRSSSFSKKTNLITYE 602          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000008414.1 (SMESG000008414.1)

HSP 1 Score: 472.626 bits (1215), Expect = 5.840e-160
Identity = 241/545 (44.22%), Postives = 338/545 (62.02%), Query Frame = 3
Query:  117 LDEMVTGIEIDQNLQNYRTRKS-SSHLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVVAFTHCNDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAG--GSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFSAPNSFCNDITNSYLQDKYNILTSYYGKDSLCIENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTCPSNFASHFVIDNFYKISVKCP 1742
            + E+VTGI  +    + R ++S S +LRI+Y Y  SF +YP ++ +K  +MEP++  ++ ++  K    G+L VDR C     R N + I+GC  GC  AT CLG  +P++YLK C  I  +G +I S S+G G+ + DI+++V +T C   T A A SCF E  LDRPILGVI +C    QVN  V E+VKII HEIIHALGF+++KYA++R  NG PIV R+ FG P  G  +   YY+WNDKII  + R+R SV   Y    + FVL N++  A+ HF CP + AVDLED G    GSAL+HFDEY L+N++MTP +NN +D IS  TLALL DTGWY V+YS   + DYG  KGC LP KGCY YM+ Q Q  + LDPFC+  F  G    CS  R Y+  C+L   + +    QYF  + G+   D Q+Y+G S +NE+CP  ++F+ P+  CN+  N+ + + YN++ SY+G DS+C  N ++N     YYGASCQKY+ N+ +  Y ++I  +  +CPS     + + +    +  CP
Sbjct:   34 ISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINGTGGVIQSGSQGSGVADADIVLLVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVS-NSYYMWNDKIITTITRSRTSVTSSYSLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMQSQSQSQS-LDPFCNVPFARGRTLACSLFREYFYLCNLNKISGLNPTYQYFTSLAGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFVCNNELNNNVPNLYNVVPSYFGPDSMCFSNYIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQTYTLSDGSSNTFLCP 575          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000008414.1 (SMESG000008414.1)

HSP 1 Score: 472.626 bits (1215), Expect = 1.160e-159
Identity = 241/545 (44.22%), Postives = 338/545 (62.02%), Query Frame = 3
Query:  117 LDEMVTGIEIDQNLQNYRTRKS-SSHLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIENVDIIIVVAFTHCNDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAG--GSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIFSAPNSFCNDITNSYLQDKYNILTSYYGKDSLCIENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTCPSNFASHFVIDNFYKISVKCP 1742
            + E+VTGI  +    + R ++S S +LRI+Y Y  SF +YP ++ +K  +MEP++  ++ ++  K    G+L VDR C     R N + I+GC  GC  AT CLG  +P++YLK C  I  +G +I S S+G G+ + DI+++V +T C   T A A SCF E  LDRPILGVI +C    QVN  V E+VKII HEIIHALGF+++KYA++R  NG PIV R+ FG P  G  +   YY+WNDKII  + R+R SV   Y    + FVL N++  A+ HF CP + AVDLED G    GSAL+HFDEY L+N++MTP +NN +D IS  TLALL DTGWY V+YS   + DYG  KGC LP KGCY YM+ Q Q  + LDPFC+  F  G    CS  R Y+  C+L   + +    QYF  + G+   D Q+Y+G S +NE+CP  ++F+ P+  CN+  N+ + + YN++ SY+G DS+C  N ++N     YYGASCQKY+ N+ +  Y ++I  +  +CPS     + + +    +  CP
Sbjct:   56 ISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENAT-CLGFPVPDKYLKVCTTINGTGGVIQSGSQGSGVADADIVLLVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVS-NSYYMWNDKIITTITRSRTSVTSSYSLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMQSQSQSQS-LDPFCNVPFARGRTLACSLFREYFYLCNLNKISGLNPTYQYFTSLAGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFVCNNELNNNVPNLYNVVPSYFGPDSMCFSNYIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQTYTLSDGSSNTFLCP 597          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000063815.1 (SMESG000063815.1)

HSP 1 Score: 261.151 bits (666), Expect = 3.394e-78
Identity = 162/521 (31.09%), Postives = 272/521 (52.21%), Query Frame = 3
Query:   48 MKITVLILVLQKLISV-ESSERQDLDEMVTGIEIDQNLQNYRTRKSSSHLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGR--SRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQS--EGPGIENVDIIIVVAFTH--CNDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALG--KNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVFKENQYFREIPGIKKEDAQFYAGQSEFNEFCPFKVIF-------SAPNSFCNDITNSYLQDKYNILTSYYGKDSLCIE 1562
            M +  L+++L  +I + +SS     D  +T I ++ ++ N R ++   +LRI  HY  SF S  N +  KK  +EP+ +  E  L  KNP+   + ++R C  G   +  N + I+ C + C+   KC    IPE+YL +C  I  S    Y  S  +G G  N D+II+V+++   C++++ A + +C +E +++RP+LG + +C  K   + N+  ++  I+HEI+H LGF    YA+F  ++G+P  PRD  G P  G  +  + +YY  ++++IK+ +   +       +T    V  NI K AQEHF C  +D + LED G + S L+HF+  +L+N++MT    +    +S+FT+A L+DTGWY+ DY KA  + + K  GC   +K CY YM+ +  ++  + P+C +   Y    +CS    Y + C+L    +V  + +YF+E  G              F E+CP+   F       +  N  C D  N+ ++  ++     YG  S C E
Sbjct:    1 MILYFLVILLSGVIFISQSSFIPRGDVKITNIHLN-SIHNKRIKRDVRNLRILIHYDKSFDSLENKNEFKKNAIEPAVKFWEDSLIVKNPVTSPILIERICPTGFRFAFVNGNRIKICKDKCLLDPKCSLAVIPEKYLAKCYYIDDSHYESYRTSGEDGAGAINADLIILVSYSSNGCSENSLAYSTTCELESKINRPVLGSLNICPNKINSDQNLFWAISAIKHEIVHILGFNAALYAFFMDNDGIPFTPRDSHGYPNNGFIQLGLLEYYKSSERVIKEEKYKAKYKERTEIQTRHILVTPNIKKEAQEHFNCSTLDGIYLEDYGNANSVLSHFERRILYNELMTATIQD-YSFVSRFTMAFLEDTGWYQPDYRKADKFLFAKNAGCDFVMKTCYDYMQIKSSRHESIAPYC-KALPYSENMKCSDNLEYKEVCNLRQGYQVPPKYKYFKENMG----------SFDHFAEYCPYYQNFRQSESDGTISNGICTDQGNNVVKG-FDKGLETYGSSSACFE 507          
The following BLAST results are available for this feature:
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMLN1.952e-6828.96leishmanolysin like peptidase [Source:HGNC Symbol;... [more]
LMLN4.425e-6829.62leishmanolysin like peptidase [Source:HGNC Symbol;... [more]
LMLN2.036e-4826.41leishmanolysin like peptidase [Source:HGNC Symbol;... [more]
LMLN3.559e-4826.98leishmanolysin like peptidase [Source:HGNC Symbol;... [more]
LMLN21.159e-1524.92leishmanolysin like peptidase 2 [Source:HGNC Symbo... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y43F4A.13.755e-5529.49Leishmanolysin-like peptidase [Source:UniProtKB/S... [more]
T13B5.91.575e-923.61pep chromosome:WBcel235:II:1101371:1104509:-1 gene... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Invadolysin6.712e-6529.65gene:FBgn0086359 transcript:FBtr0082181[more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lmln1.881e-6930.41leishmanolysin-like (metallopeptidase M8 family) [... [more]
lmln3.901e-6830.02leishmanolysin-like (metallopeptidase M8 family) [... [more]
si:ch211-216p19.51.383e-1527.07si:ch211-216p19.5 [Source:ZFIN;Acc:ZDB-GENE-160728... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
LMLN4.361e-1528.00leishmanolysin-like (metallopeptidase M8 family) [... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Lmln1.907e-6628.88leishmanolysin-like (metallopeptidase M8 family) [... [more]
Gm297765.794e-1727.86predicted gene, 29776 [Source:MGI Symbol;Acc:MGI:5... [more]
Gm297762.204e-1124.90predicted gene, 29776 [Source:MGI Symbol;Acc:MGI:5... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29AK2|LMLN_DROPS4.679e-6630.04Leishmanolysin-like peptidase OS=Drosophila pseudo... [more]
sp|Q8BMN4|LMLN_MOUSE1.334e-6528.88Leishmanolysin-like peptidase OS=Mus musculus OX=1... [more]
sp|Q9VH19|LMLN_DROME6.728e-6429.65Leishmanolysin-like peptidase OS=Drosophila melano... [more]
sp|O62446|LMLN_CAEEL4.776e-5429.49Leishmanolysin-like peptidase OS=Caenorhabditis el... [more]
sp|Q61YG1|LMLN_CAEBR3.355e-5329.03Leishmanolysin-like peptidase OS=Caenorhabditis br... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YNV52.702e-7833.88Leishmanolysin-like peptidase (Fragment) OS=Clonor... [more]
A0A3R7FUZ74.028e-7833.88Leishmanolysin-like peptidase OS=Clonorchis sinens... [more]
A0A4E0R0T42.021e-7531.13Leishmanolysin-like peptidase OS=Fasciola hepatica... [more]
A0A4E0RV182.049e-7534.18Leishmanolysin-like peptidase OS=Fasciola hepatica... [more]
A0A1S8WW942.915e-7435.10Leishmanolysin-like peptidase (Fragment) OS=Opisth... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lmln1.562e-6828.68leishmanolysin like peptidase [Source:NCBI gene;Ac... [more]
lmln2.044e-6828.68leishmanolysin like peptidase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004358.13.431e-2830.45pep scaffold:Pmarinus_7.0:GL476418:369102:375246:1... [more]
ENSPMAT00000002113.19.718e-2531.52pep scaffold:Pmarinus_7.0:GL501047:4779:9283:1 gen... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO330701.909e-5728.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443824.619e-5431.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lmln1.244e-6329.00leishmanolysin like peptidase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036783.10.000e+098.45SMESG000036783.1[more]
SMESG000008405.16.593e-17944.95SMESG000008405.1[more]
SMESG000008414.15.840e-16044.22SMESG000008414.1[more]
SMESG000008414.11.160e-15944.22SMESG000008414.1[more]
SMESG000063815.13.394e-7831.09SMESG000063815.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031079 ID=SMED30031079|Name=Leishmanolysin-like peptidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1895bp
GTGTTTAGTTCAATTCTATTATTATATTTGGATTACAAAGTTTTTTGATG
AAAATTACTGTTTTAATTTTGGTACTTCAAAAATTAATTTCAGTCGAATC
TAGTGAAAGACAAGACTTGGATGAAATGGTAACAGGTATTGAAATAGATC
AAAATCTTCAGAATTATCGAACCAGAAAATCGTCTTCACATTTACGAATA
CACTATCACTACACAGACAGCTTTGGATCATACCCAAATTCTGATGCTAT
CAAAAAACAAATAATGGAACCCTCAAAAGAGGAAATAGAGAGAATGTTGA
AAGCAAAAAATCCTATAAACGGAGTTCTGAGAGTTGACAGACGCTGTATT
AATGGAAGATCAAGAACCAATGCTGATGGTATTCGTGGCTGCATAGAAGG
CTGCGTGGCAGCAACAAAGTGCTTAGGAATTACAATTCCCGAAGAATATT
TAAAACGCTGTCGAAAAATATTGCCTTCGGGAGAAATAATTTATTCACAA
TCCGAAGGTCCTGGAATAGAAAATGTCGACATAATCATTGTCGTGGCTTT
CACTCATTGTAATGATCACACAAAAGCAAGTGCTGCTTCTTGTTTCATTG
AAAAGCAGTTAGACAGACCAATTTTAGGGGTCATTGAAATGTGTATTGGA
AAGTTTCAGGTCAATGTAAATGTTATTGAAAGCGTCAAAATAATACAACA
CGAAATAATTCATGCTCTGGGTTTTGCTCTCAATAAATATGCTTATTTTC
GACAAAGCAATGGCTTGCCGATTGTTCCGAGAGATGAATTCGGAGTTCCA
GCTTTGGGTAAAAACAATATCGAAAAATATTATCTTTGGAATGACAAAAT
AATCAAAAAGGTTCAGAGAACTAGAGAATCAGTGAACGGAATATATAAAA
AAACAATGGATGCGTTTGTACTTGAAAACATAGTGAAAGTAGCCCAAGAA
CATTTTGGTTGTCCTGATATAGATGCAGTTGATCTTGAAGATGCTGGAGG
ATCGGGATCAGCTTTAACTCATTTCGATGAATACCTTTTACATAATGATA
TAATGACTCCACAAACAAATAACGCCCTCGATGTTATTTCAAAATTTACT
TTAGCTTTACTTCAAGACACTGGATGGTATGAAGTCGATTATTCTAAAGC
TCAAGACTATGATTACGGTAAAGGCAAAGGTTGTACTCTTCCATTAAAAG
GCTGTTATAGGTACATGGAAGAACAAAGGCAAAAAAATGCACCATTGGAT
CCGTTTTGTGACAGAGTATTTCAATATGGAAATATTGCGCGCTGCTCTAA
GAAAAGAAATTATTATGATTACTGCCATTTAACCTATTATAATGAAGTAT
TTAAAGAAAACCAATACTTTAGAGAAATACCTGGTATAAAAAAGGAAGAT
GCCCAGTTTTATGCTGGTCAATCAGAATTCAATGAATTTTGTCCCTTTAA
AGTGATATTTTCAGCTCCCAATTCATTTTGTAATGACATCACAAATTCCT
ATTTGCAAGATAAATACAATATATTAACTTCTTATTATGGAAAGGATTCT
CTGTGTATTGAAAACACTTTAGAAAATAGTATTGACACAGTTTATTATGG
AGCTTCATGTCAAAAGTATTCGTACAATGCAACAAGTAAAGAATATCAAA
TTTTCATCGGACCGAATTCCTTGACTTGTCCATCAAATTTTGCATCTCAT
TTTGTTATAGATAACTTTTATAAGATATCGGTCAAATGCCCAGAATTCAT
GATGAAATCAAATTCGGAAATATGTGGATTAATGAACGATATCCAAAATA
GCTGGATGAAACAGGATCAGATTGTGTATTTTGAAGAATTCAACGAGAAT
CTCAATAAGACTACCTTGAAACTAAACTAAGAATCACAGTGAGCA
back to top

protein sequence of SMED30031079-orf-1

>SMED30031079-orf-1 ID=SMED30031079-orf-1|Name=SMED30031079-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=611bp
MKITVLILVLQKLISVESSERQDLDEMVTGIEIDQNLQNYRTRKSSSHLR
IHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRC
INGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYS
QSEGPGIENVDIIIVVAFTHCNDHTKASAASCFIEKQLDRPILGVIEMCI
GKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGV
PALGKNNIEKYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQ
EHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKF
TLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPL
DPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVFKENQYFREIPGIKKE
DAQFYAGQSEFNEFCPFKVIFSAPNSFCNDITNSYLQDKYNILTSYYGKD
SLCIENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTCPSNFAS
HFVIDNFYKISVKCPEFMMKSNSEICGLMNDIQNSWMKQDQIVYFEEFNE
NLNKTTLKLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
GO:0004222metalloendopeptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001577Peptidase_M8
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001577Peptidase M8, leishmanolysinPFAMPF01457Peptidase_M8coord: 151..524
e-value: 1.8E-35
score: 122.7
IPR001577Peptidase M8, leishmanolysinPANTHERPTHR10942LEISHMANOLYSIN-LIKE PEPTIDASEcoord: 44..580
NoneNo IPR availableGENE3DG3DSA:3.90.132.10coord: 261..386
e-value: 1.2E-30
score: 108.2
NoneNo IPR availableGENE3DG3DSA:3.10.170.20coord: 129..223
e-value: 4.8E-7
score: 31.5
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.632
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 43..547