Small conductance calcium-activated potassium channel protein

Overview
NameSmall conductance calcium-activated potassium channel protein
Smed IDSMED30031047
Length (bp)2020
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Small conductance calcium-activated potassium channel protein (SMED30031047) t-SNE clustered cells

Violin plots show distribution of expression levels for Small conductance calcium-activated potassium channel protein (SMED30031047) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Small conductance calcium-activated potassium channel protein (SMED30031047) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Small conductance calcium-activated potassium channel protein (SMED30031047) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031047

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30031047SMESG000046926.1 dd_Smed_v4_13707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031047SMESG000046926.1 dd_Smed_v4_13707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30031047SMESG000046926.1 dd_Smed_v4_13707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30031047SMESG000046926.1 dd_Smed_v4_13707_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN3 (potassium calcium-activated channel subfamily N member 3 [Source:HGNC Symbol;Acc:HGNC:6292])

HSP 1 Score: 382.489 bits (981), Expect = 1.784e-122
Identity = 212/460 (46.09%), Postives = 315/460 (68.48%), Query Frame = 2
Query:  593 HDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKM---AILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            H+ Q    + +S+T  +AN   R+N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W G+  ++S     LK LI+LST++L+  I+ YH   +QLF  D+  +DWRI +T++R   + LE+ VCAIHPIP     + K    A L  S+     +  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKL++ +D +++R HQRKFL+AIH LR +K++QRKL+D +NTLVD +K                        Q+ ++  +TE+ D   +  K+I ++ES + +L
Sbjct:  241 HNHQHAGTTASSTTFPKANK--RKNQNI--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIP----GEYKFFWTARLAFSYTPSRAEADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSK-----------------------MQNVMYDLITELNDRSEDLEKQIGSLESKLEHL 666          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN3 (potassium calcium-activated channel subfamily N member 3 [Source:HGNC Symbol;Acc:HGNC:6292])

HSP 1 Score: 379.407 bits (973), Expect = 4.492e-121
Identity = 213/475 (44.84%), Postives = 313/475 (65.89%), Query Frame = 2
Query:  593 HDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKM---AILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNS-----------------LLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            H+ Q    + +S+T  +AN   R+N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W G+  ++S     LK LI+LST++L+  I+ YH   +QLF  D+  +DWRI +T++R   + LE+ VCAIHPIP     + K    A L  S+     +  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +R CE    P   S                  L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKL++ +D +++R HQRKFL+AIH LR +K++QRKL+D +NTLVD +K                        Q+ ++  +TE+ D   +  K+I ++ES + +L
Sbjct:  241 HNHQHAGTTASSTTFPKANK--RKNQNI--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIP----GEYKFFWTARLAFSYTPSRAEADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCESPESPAQPSGSSLPAWYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSK-----------------------MQNVMYDLITELNDRSEDLEKQIGSLESKLEHL 681          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 372.089 bits (954), Expect = 2.463e-120
Identity = 198/428 (46.26%), Postives = 292/428 (68.22%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLAN-TDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W    K +  ++     +   + ++L + I+ YH   IQLF  D+  +DWRI +T++R   + LE+ VCAIHPIP   N T    A L  S+        V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +RACE   D +   ++ L + WLI+ITFLS+GYG+MVP+T CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV+ +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  ++++ +   +F KRI  +E+ +  L
Sbjct:  118 GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTIILLGLIIV-YHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIP--GNYTFTWTARLAFSYAPSTTTADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNIMYDMISDLNERSEDFEKRIVTLETKLETL 517          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 367.081 bits (941), Expect = 3.262e-118
Identity = 198/431 (45.94%), Postives = 292/431 (67.75%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLAN-TDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIH---GLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W    K +  ++     +   + ++L + I+ YH   IQLF  D+  +DWRI +T++R   + LE+ VCAIHPIP   N T    A L  S+        V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +RACE   D +   ++ L + WLI+ITFLS+GYG+MVP+T CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV+ +D +++R HQRKFL+AIH    LR +K++QRKL D +NTLVD AK                       TQ+ ++  ++++ +   +F KRI  +E+ +  L
Sbjct:  131 GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTIILLGLIIV-YHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIP--GNYTFTWTARLAFSYAPSTTTADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQARKLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNIMYDMISDLNERSEDFEKRIVTLETKLETL 533          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Match: KCNN2 (potassium calcium-activated channel subfamily N member 2 [Source:HGNC Symbol;Acc:HGNC:6291])

HSP 1 Score: 372.859 bits (956), Expect = 4.363e-118
Identity = 198/428 (46.26%), Postives = 292/428 (68.22%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLAN-TDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W    K +  ++     +   + ++L + I+ YH   IQLF  D+  +DWRI +T++R   + LE+ VCAIHPIP   N T    A L  S+        V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +RACE   D +   ++ L + WLI+ITFLS+GYG+MVP+T CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV+ +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  ++++ +   +F KRI  +E+ +  L
Sbjct:  330 GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTIILLGLIIV-YHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIP--GNYTFTWTARLAFSYAPSTTTADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNIMYDMISDLNERSEDFEKRIVTLETKLETL 729          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 308.145 bits (788), Expect = 1.158e-95
Identity = 173/383 (45.17%), Postives = 260/383 (67.89%), Query Frame = 2
Query:  662 RNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACE--IRVDPRHNSL--LNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKT 1792
            ++DN  +G RL  R+ L E+RR +SD +L  A+ GII MI+  E + A VI+  S+  + LK  I  +T  L+ F+  +HV+ IQLF   +  +DW + ++++R  Q+ LEL +C + P+P  F+A       + D  H   L     ++++ LS+ MF RLY + RV+LLHS++F+DA  RSI  +N+VNF+ RF+LKTL+TICP T+ ++F   +W+   WILR CE       ++N +  +NS WL+AITFLSVGYG++VP T CGR +AI +G++G+  ++++VAV+A+KLELT+AE+HV  F+ + ++ K++K+ AANVLRETW I+KF KLVE  D  +IR HQRKFL AI+ +R+++ DQRKL +N  +L D AKT
Sbjct:  196 KDDN--SGGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSSLSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPF-----MNDRFHDKTLY----AVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKT 567          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 308.145 bits (788), Expect = 1.725e-95
Identity = 173/383 (45.17%), Postives = 260/383 (67.89%), Query Frame = 2
Query:  662 RNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACE--IRVDPRHNSL--LNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKT 1792
            ++DN  +G RL  R+ L E+RR +SD +L  A+ GII MI+  E + A VI+  S+  + LK  I  +T  L+ F+  +HV+ IQLF   +  +DW + ++++R  Q+ LEL +C + P+P  F+A       + D  H   L     ++++ LS+ MF RLY + RV+LLHS++F+DA  RSI  +N+VNF+ RF+LKTL+TICP T+ ++F   +W+   WILR CE       ++N +  +NS WL+AITFLSVGYG++VP T CGR +AI +G++G+  ++++VAV+A+KLELT+AE+HV  F+ + ++ K++K+ AANVLRETW I+KF KLVE  D  +IR HQRKFL AI+ +R+++ DQRKL +N  +L D AKT
Sbjct:  203 KDDN--SGGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSSLSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPF-----MNDRFHDKTLY----AVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKT 574          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 308.145 bits (788), Expect = 1.837e-95
Identity = 173/383 (45.17%), Postives = 260/383 (67.89%), Query Frame = 2
Query:  662 RNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACE--IRVDPRHNSL--LNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKT 1792
            ++DN  +G RL  R+ L E+RR +SD +L  A+ GII MI+  E + A VI+  S+  + LK  I  +T  L+ F+  +HV+ IQLF   +  +DW + ++++R  Q+ LEL +C + P+P  F+A       + D  H   L     ++++ LS+ MF RLY + RV+LLHS++F+DA  RSI  +N+VNF+ RF+LKTL+TICP T+ ++F   +W+   WILR CE       ++N +  +NS WL+AITFLSVGYG++VP T CGR +AI +G++G+  ++++VAV+A+KLELT+AE+HV  F+ + ++ K++K+ AANVLRETW I+KF KLVE  D  +IR HQRKFL AI+ +R+++ DQRKL +N  +L D AKT
Sbjct:  203 KDDN--SGGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSSLSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPF-----MNDRFHDKTLY----AVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKT 574          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 308.531 bits (789), Expect = 2.003e-95
Identity = 173/383 (45.17%), Postives = 260/383 (67.89%), Query Frame = 2
Query:  662 RNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACE--IRVDPRHNSL--LNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKT 1792
            ++DN  +G RL  R+ L E+RR +SD +L  A+ GII MI+  E + A VI+  S+  + LK  I  +T  L+ F+  +HV+ IQLF   +  +DW + ++++R  Q+ LEL +C + P+P  F+A       + D  H   L     ++++ LS+ MF RLY + RV+LLHS++F+DA  RSI  +N+VNF+ RF+LKTL+TICP T+ ++F   +W+   WILR CE       ++N +  +NS WL+AITFLSVGYG++VP T CGR +AI +G++G+  ++++VAV+A+KLELT+AE+HV  F+ + ++ K++K+ AANVLRETW I+KF KLVE  D  +IR HQRKFL AI+ +R+++ DQRKL +N  +L D AKT
Sbjct:  203 KDDN--SGGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSSLSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPF-----MNDRFHDKTLY----AVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKT 574          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Match: kcnl-2 (KCNN (Potassium K ChaNNel, calcium activated)-Like [Source:UniProtKB/TrEMBL;Acc:G5EDA9])

HSP 1 Score: 308.531 bits (789), Expect = 2.004e-95
Identity = 173/383 (45.17%), Postives = 260/383 (67.89%), Query Frame = 2
Query:  662 RNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACE--IRVDPRHNSL--LNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKT 1792
            ++DN  +G RL  R+ L E+RR +SD +L  A+ GII MI+  E + A VI+  S+  + LK  I  +T  L+ F+  +HV+ IQLF   +  +DW + ++++R  Q+ LEL +C + P+P  F+A       + D  H   L     ++++ LS+ MF RLY + RV+LLHS++F+DA  RSI  +N+VNF+ RF+LKTL+TICP T+ ++F   +W+   WILR CE       ++N +  +NS WL+AITFLSVGYG++VP T CGR +AI +G++G+  ++++VAV+A+KLELT+AE+HV  F+ + ++ K++K+ AANVLRETW I+KF KLVE  D  +IR HQRKFL AI+ +R+++ DQRKL +N  +L D AKT
Sbjct:  223 KDDN--SGGRLIRREILHEKRRHVSDRALAFAIMGIILMIIENELRTAYVIRPGSSLSHLLKFFIIFTTTALLSFVGYFHVIEIQLFMNANAADDWMVALSFRRTCQIGLELLICMLCPLPIEFIAPF-----MNDRFHDKTL----YAVNVFLSIMMFFRLYWLCRVMLLHSRVFTDASSRSIAGLNRVNFNARFILKTLMTICPGTMLMIFTAFLWIIAGWILRLCEREYMTPDKYNDINYVNSIWLVAITFLSVGYGDIVPKTNCGRSMAIVTGILGTCASSMVVAVIARKLELTRAEKHVHNFMQDTQLTKQLKHSAANVLRETWFIFKFRKLVEKPDFGKIRKHQRKFLLAIYEMRRVRRDQRKLAENLVSLGDVAKT 594          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0300467)

HSP 1 Score: 406.371 bits (1043), Expect = 1.197e-134
Identity = 221/460 (48.04%), Postives = 311/460 (67.61%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQ--LFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQ-----------RCLTHFTVDIQKSHQI*FP 2017
            G+RLG RK L E+R+RISDY+L   +FGII M++  E   AGV  + S     LK+LI++ST++L+  I+ YH L +Q  LF  D+C +DWRI +TWQR  Q+ LEL +CAIHPIP  +      K+A    +    +  + V  D+ LSLPMFLRLYL+ RV+LLHSKLF+DA  RSIGA+N++NF+TRF+LKTL+TICP TV ++F++S+W+  SW LR CE   D  H +LLN+ WLIAITFLSVG+G++VP+T CGR IA+S+G+MG+ CTAL+VAV+++KLELT+AE+HV  F+++ ++ K++KN AANVLRETWLIYK T+LV+ V+  R+R HQRKFL AI+ LRK+K+DQRKL DN+NT+ D AK                       TQ+++++ +++M        +R+ N+E  + ++Q           RCLT     I++      P
Sbjct:   64 GYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQVRLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLA----NKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAK-----------------------TQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLTQHQERIEQRRNFLHP 496          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0344555)

HSP 1 Score: 409.838 bits (1052), Expect = 2.000e-133
Identity = 221/460 (48.04%), Postives = 311/460 (67.61%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQ--LFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQ-----------RCLTHFTVDIQKSHQI*FP 2017
            G+RLG RK L E+R+RISDY+L   +FGII M++  E   AGV  + S     LK+LI++ST++L+  I+ YH L +Q  LF  D+C +DWRI +TWQR  Q+ LEL +CAIHPIP  +      K+A    +    +  + V  D+ LSLPMFLRLYL+ RV+LLHSKLF+DA  RSIGA+N++NF+TRF+LKTL+TICP TV ++F++S+W+  SW LR CE   D  H +LLN+ WLIAITFLSVG+G++VP+T CGR IA+S+G+MG+ CTAL+VAV+++KLELT+AE+HV  F+++ ++ K++KN AANVLRETWLIYK T+LV+ V+  R+R HQRKFL AI+ LRK+K+DQRKL DN+NT+ D AK                       TQ+++++ +++M        +R+ N+E  + ++Q           RCLT     I++      P
Sbjct:   64 GYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQVRLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLA----NKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAK-----------------------TQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLTQHQERIEQRRNFLHP 496          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301953)

HSP 1 Score: 415.616 bits (1067), Expect = 2.248e-133
Identity = 243/555 (43.78%), Postives = 347/555 (62.52%), Query Frame = 2
Query:  404 ISIDILKANCSFGGFKQLXXXXXXXXXXXXXXXXTISIINGNPKVSVGDLENVSN--NSENFKMPHDAQSN--RFSM-TSSTAIRANNKIRRNDNCQN------GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQ-----------RCLTHFTVDIQK 1996
            I+ D L+ N     FKQL+K  +           T+SI       S+ + E +S+  N E  +      S+  R+ M     A+   N  R+            G+RLG RK L E+R+RISDY+L   +FGII M++  E   AGV  + S     LK+LI++ST++L+  I+ YH L +QLF  D+C +DWRI +TWQR  Q+ LEL +CAIHPIP  +      K+A    +    +  + V  D+ LSLPMFLRLYL+ RV+LLHSKLF+DA  RSIGA+N++NF+TRF+LKTL+TICP TV ++F++S+W+  SW LR CE   D  H +LLN+ WLIAITFLSVG+G++VP+T CGR IA+S+G+MG+ CTAL+VAV+++KLELT+AE+HV  F+++ ++ K++KN AANVLRETWLIYK T+LV+ V+  R+R HQRKFL AI+ LRK+K+DQRKL DN+NT+ D AK                       TQ+++++ +++M        +R+ N+E  + ++Q           RCLT     I++
Sbjct:  376 IAADSLRINGGMRPFKQLRKPAS-----------TLSIPGSMKTPSIANREQISSGCNEEAAEALVGIHSDYPRYEMYMEERALTGGNTSRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLA----NKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNAMWLIAITFLSVGFGDIVPNTYCGRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAK-----------------------TQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLTQHQERIEQ 892          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301949)

HSP 1 Score: 401.749 bits (1031), Expect = 7.336e-133
Identity = 218/458 (47.60%), Postives = 307/458 (67.03%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQ-----------RCLTHFTVDIQKSHQI*FP 2017
            G+RLG RK L E+R+RISDY+L   +FGII M++  E   AGV  + S     LK+LI++ST++L+  I+ YH L +QLF  D+C +DWRI +TWQR  Q+ LEL +CAIHPIP  +      K+A    +    +  + V  D+ LSLPMFLRLYL+ RV+LLHSKLF+DA  RSIGA+N++NF+TRF+LKTL+TICP TV ++F++S+W+  SW LR CE   D  H +LLNS WL AITFL VGYG++VP+T CGR I ++ G++G+ CTAL+VAV+++KLELT+AE+HV  F+++ ++ K++KN AANVLRETWLIYK T+LV+ V+  R+R HQRKFL AI+ LRK+K+DQRKL DN+NT+ D AK                       TQ+++++ +++M        +R+ N+E  + ++Q           RCLT     I++      P
Sbjct:   64 GYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLA----NKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAK-----------------------TQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLTQHQERIEQRRNFLHP 494          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Match: SK (gene:FBgn0029761 transcript:FBtr0301952)

HSP 1 Score: 403.29 bits (1035), Expect = 1.103e-132
Identity = 218/458 (47.60%), Postives = 307/458 (67.03%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQ-----------RCLTHFTVDIQKSHQI*FP 2017
            G+RLG RK L E+R+RISDY+L   +FGII M++  E   AGV  + S     LK+LI++ST++L+  I+ YH L +QLF  D+C +DWRI +TWQR  Q+ LEL +CAIHPIP  +      K+A    +    +  + V  D+ LSLPMFLRLYL+ RV+LLHSKLF+DA  RSIGA+N++NF+TRF+LKTL+TICP TV ++F++S+W+  SW LR CE   D  H +LLNS WL AITFL VGYG++VP+T CGR I ++ G++G+ CTAL+VAV+++KLELT+AE+HV  F+++ ++ K++KN AANVLRETWLIYK T+LV+ V+  R+R HQRKFL AI+ LRK+K+DQRKL DN+NT+ D AK                       TQ+++++ +++M        +R+ N+E  + ++Q           RCLT     I++      P
Sbjct:   64 GYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLA----NKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAK-----------------------TQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLTQHQERIEQRRNFLHP 494          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn1a (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1a [Source:ZFIN;Acc:ZDB-GENE-070912-703])

HSP 1 Score: 381.333 bits (978), Expect = 1.408e-124
Identity = 207/443 (46.73%), Postives = 305/443 (68.85%), Query Frame = 2
Query:  623 TSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIE 1939
            ++ + +R +    +  N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M+  TE  W GV  + S+  + LK LI+LST++L+  I+ YH   IQLF  D+  +DWRI +T++R   ++LEL VCAIHPIP  ++     ++A    ++   + D  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV+ +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  V+E+++      KRI  +E
Sbjct:   58 SNESLVRESGNAPQKKNKDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQYVFTWTARLAF---TYVPSVADADV--DIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNVMYDLVSELQERSEELDKRIGTLE 471          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn1b (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-397])

HSP 1 Score: 374.4 bits (960), Expect = 8.353e-122
Identity = 204/433 (47.11%), Postives = 301/433 (69.52%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCL 1969
            G++LG+R+ L E+R+R+SDY+L   +FGI+ M+  TE  W GV  + S+  + LK LI+LST++L+  I+ YH   IQLF  D+  +DWRI +T++R   ++LEL VCAIHPIP  ++     ++A    ++   + D  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S W+  +W +  CE   D     ++ L + WLI+ITFLS+GYG+MVP+T CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV+ +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  V+E+++      KRI ++E+ + ++   L
Sbjct:   79 GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTVILLCLIIMYHAREIQLFMVDNGADDWRIAMTYERILFIVLELLVCAIHPIPGQYVFTWTARLAF---TYTPSVADADV--DIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVHVCERYHDKVEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNVMYDLVSELQERSEELEKRIGHLETKLDSINSSL 482          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn1a (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1a [Source:ZFIN;Acc:ZDB-GENE-070912-703])

HSP 1 Score: 382.489 bits (981), Expect = 9.640e-121
Identity = 207/443 (46.73%), Postives = 304/443 (68.62%), Query Frame = 2
Query:  623 TSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIE 1939
            ++ + +R +    +  N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M+  TE  W GV  + S+  + LK LI+LST++L+  I+ YH   IQLF  D+  +DWRI +T++R   ++LEL VCAIHPIP  ++     ++A   +     + D  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV+ +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  V+E+++      KRI  +E
Sbjct:  436 SNESLVRESGNAPQKKNKDIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQYVFTWTARLAFTYVP---SVADADV--DIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNVMYDLVSELQERSEELDKRIGTLE 849          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:ZFIN;Acc:ZDB-GENE-100921-56])

HSP 1 Score: 377.867 bits (969), Expect = 1.868e-120
Identity = 196/380 (51.58%), Postives = 282/380 (74.21%), Query Frame = 2
Query:  659 RRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVK-MAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAK 1789
            R+N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W GV  ++S     LK LI+LST++L+  I+ YH   +QLF  D+  +DWRI +T +R   + LEL V A+HP+P     D K M    ++  +     +  LD++LS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NKV+F+TRF++KTL+TICP TV ++F +S+W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKL++ +D SR+R HQRKFL+AIH LR +K++QRKL+D +NTLVD +K
Sbjct:  288 RKNQNI--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GVYSKSSMYSLALKCLISLSTIILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELIVSAVHPVP----GDFKFMWRARLAFSYAPSQAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSK 660          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Match: kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:ZFIN;Acc:ZDB-GENE-100921-56])

HSP 1 Score: 377.867 bits (969), Expect = 1.868e-120
Identity = 196/380 (51.58%), Postives = 282/380 (74.21%), Query Frame = 2
Query:  659 RRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVK-MAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAK 1789
            R+N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W GV  ++S     LK LI+LST++L+  I+ YH   +QLF  D+  +DWRI +T +R   + LEL V A+HP+P     D K M    ++  +     +  LD++LS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NKV+F+TRF++KTL+TICP TV ++F +S+W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKL++ +D SR+R HQRKFL+AIH LR +K++QRKL+D +NTLVD +K
Sbjct:  288 RKNQNI--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GVYSKSSMYSLALKCLISLSTIILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELIVSAVHPVP----GDFKFMWRARLAFSYAPSQAEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSK 660          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 377.096 bits (967), Expect = 4.082e-123
Identity = 208/451 (46.12%), Postives = 299/451 (66.30%), Query Frame = 2
Query:  659 RRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP------------FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCL 1969
            ++N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M+  TE  W GV  + S+  + LK LI+LST +L+  I+ YH   IQLF  D+  +DWRI +T++R   + LEL VCAIHPIP            F   T V  A                +D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVP+T CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV  +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  ++E+++   +  KRI  +E+ + +L   L
Sbjct:   74 KKNQNV--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFTWTARLAFFYTTSVANA---------------DIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNVMYDLMSELQERNEDLEKRIITLETKIDSLNTSL 483          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 377.096 bits (967), Expect = 6.927e-123
Identity = 205/441 (46.49%), Postives = 300/441 (68.03%), Query Frame = 2
Query:  659 RRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCL 1969
            ++N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M+  TE  W GV  + S+  + LK LI+LST +L+  I+ YH   IQLF  D+  +DWRI +T++R   + LEL VCAIHPIP  +      ++A    +           +D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVP+T CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV  +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  ++E+++   +  KRI  +E+ + +L   L
Sbjct:   66 KKNQNV--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFTWTARLAFFYTTSV-----ANADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNVMYDLMSELQERNEDLEKRIITLETKIDSLNTSL 475          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 376.711 bits (966), Expect = 1.132e-122
Identity = 205/441 (46.49%), Postives = 300/441 (68.03%), Query Frame = 2
Query:  659 RRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCL 1969
            ++N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M+  TE  W GV  + S+  + LK LI+LST +L+  I+ YH   IQLF  D+  +DWRI +T++R   + LEL VCAIHPIP  +      ++A    +           +D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVP+T CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV  +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  ++E+++   +  KRI  +E+ + +L   L
Sbjct:   74 KKNQNV--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFTWTARLAFFYTTSV-----ANADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNVMYDLMSELQERNEDLEKRIITLETKIDSLNTSL 483          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: wdr17 (WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-1000178])

HSP 1 Score: 377.096 bits (967), Expect = 2.994e-122
Identity = 205/441 (46.49%), Postives = 300/441 (68.03%), Query Frame = 2
Query:  659 RRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCL 1969
            ++N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M+  TE  W GV  + S+  + LK LI+LST +L+  I+ YH   IQLF  D+  +DWRI +T++R   + LEL VCAIHPIP  +      ++A    +           +D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVP+T CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV  +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  ++E+++   +  KRI  +E+ + +L   L
Sbjct:  111 KKNQNV--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTAILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFITLELTVCAIHPIPGQYSFTWTARLAFFYTTSV-----ANADIDIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLSKRVKNAAANVLRETWLIYKHTKLVRKIDHAKVRKHQRKFLQAIHLLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNVMYDLMSELQERNEDLEKRIITLETKIDSLNTSL 520          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Match: KCNN2 (potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 2 [Source:NCBI gene;Acc:100145581])

HSP 1 Score: 377.096 bits (967), Expect = 2.740e-121
Identity = 219/489 (44.79%), Postives = 321/489 (65.64%), Query Frame = 2
Query:  509 ISIINGNPKVSVGDLENVSNNSENF---KMPHDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLAN-TDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            +S  +  P++ V   E+ SN+   +   + P   Q+N           A +  ++N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W G   + S     LK LI+LST++L+  I+ YH   IQLF  D+  +DWRI +T++R   + LE+ VCAIHPIP   N T    A L  S+        V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +RACE   D +   ++ L + WLI+ITFLS+GYG+MVP+T CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV+ +D +R+R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  ++++ +   +F KRI  +E+ +  L
Sbjct:  151 VSSASAAPEIVVSKPEHNSNSLAPYGSGERPGGQQNNG----------AKSGKKKNQNI--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GAYDKGSLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIP--GNYTFTWTARLAFSYTPSTTTADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNIMYDMISDLNERSEDFEKRIVVLETKLETL 599          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:MGI Symbol;Acc:MGI:2153183])

HSP 1 Score: 381.333 bits (978), Expect = 3.972e-122
Identity = 212/460 (46.09%), Postives = 314/460 (68.26%), Query Frame = 2
Query:  593 HDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKM---AILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            H+ Q    +  S+T  +AN   R+N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W G+  ++S     LK LI+LST++L+  I+ YH   +QLF  D+  +DWRI +T++R   + LE+ VCAIHPIP     + K    A L  S+     +  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKL++ +D +++R HQRKFL+AIH LR +K++QRKL+D +NTLVD +K                        Q+ ++  +TE+ D   +  K+I ++ES + +L
Sbjct:  242 HNHQHAGTTAGSTTFPKANK--RKNQNI--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTVILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIP----GEYKFFWTARLAFSYTPSRAEADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSK-----------------------MQNVMYDLITELNDRSEDLEKQIGSLESKLEHL 667          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn2 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 [Source:MGI Symbol;Acc:MGI:2153182])

HSP 1 Score: 372.474 bits (955), Expect = 1.190e-120
Identity = 198/428 (46.26%), Postives = 292/428 (68.22%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLAN-TDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W    K +  ++     +   + ++L + I+ YH   IQLF  D+  +DWRI +T++R   + LE+ VCAIHPIP   N T    A L  S+        V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +RACE   D +   ++ L + WLI+ITFLS+GYG+MVP+T CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV+ +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  ++++ +   +F KRI  +E+ +  L
Sbjct:  113 GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTIILLGLIIV-YHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIP--GNYTFTWTARLAFSYAPSTTTADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNIMYDMISDLNERSEDFEKRIVTLETKLETL 512          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn2 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 [Source:MGI Symbol;Acc:MGI:2153182])

HSP 1 Score: 372.474 bits (955), Expect = 1.190e-120
Identity = 198/428 (46.26%), Postives = 292/428 (68.22%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLAN-TDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W    K +  ++     +   + ++L + I+ YH   IQLF  D+  +DWRI +T++R   + LE+ VCAIHPIP   N T    A L  S+        V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +RACE   D +   ++ L + WLI+ITFLS+GYG+MVP+T CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV+ +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  ++++ +   +F KRI  +E+ +  L
Sbjct:  113 GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTIILLGLIIV-YHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIP--GNYTFTWTARLAFSYAPSTTTADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNIMYDMISDLNERSEDFEKRIVTLETKLETL 512          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn2 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 [Source:MGI Symbol;Acc:MGI:2153182])

HSP 1 Score: 373.244 bits (957), Expect = 7.597e-118
Identity = 198/428 (46.26%), Postives = 292/428 (68.22%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLAN-TDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W    K +  ++     +   + ++L + I+ YH   IQLF  D+  +DWRI +T++R   + LE+ VCAIHPIP   N T    A L  S+        V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +RACE   D +   ++ L + WLI+ITFLS+GYG+MVP+T CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV+ +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  ++++ +   +F KRI  +E+ +  L
Sbjct:  378 GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTIILLGLIIV-YHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIP--GNYTFTWTARLAFSYAPSTTTADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNIMYDMISDLNERSEDFEKRIVTLETKLETL 777          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Match: Kcnn1 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1 [Source:MGI Symbol;Acc:MGI:1933993])

HSP 1 Score: 358.607 bits (919), Expect = 9.553e-116
Identity = 194/424 (45.75%), Postives = 283/424 (66.75%), Query Frame = 2
Query:  689 RLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP----FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIES 1942
            RLG+R+ L E+R+R+SDY+L   +FGI+ M+  TE  W GV  + S   + LK LI+LST++L+  ++ YH   IQLF  D+  +DWRI +TW+R   + LEL VCAIHP+P    F     +  +++  +        +  LD++LS+PMFLRLYL+ RV+LLHS++F+DA  RSIGA+N+V F+TRF+ KTL+TICP TV ++F +S W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK T+LV+  D  R+R HQRKFL+AIH LR +KI+Q K+ D +NTL + AK                        Q   ++ V+E++ +      R+  +ES
Sbjct:   90 RLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSA-------AEADLDVLLSIPMFLRLYLLARVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRKHQRKFLQAIHQLRSVKIEQGKVNDQANTLAELAK-----------------------AQSIAYEVVSELQAQQEELEARLAALES 482          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|Q7KVW5|KCNN_DROME (Small conductance calcium-activated potassium channel protein OS=Drosophila melanogaster OX=7227 GN=SK PE=2 SV=2)

HSP 1 Score: 407.142 bits (1045), Expect = 3.956e-129
Identity = 241/562 (42.88%), Postives = 344/562 (61.21%), Query Frame = 2
Query:  404 ISIDILKANCSFGGFKQLXXXXXXXXXXXXXXXXTISIINGNPKVSVGDLENVSN--NSENFKMPHDAQSN--RFSM-TSSTAIRANNKIRRNDNCQN------GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQ-----------RCLTHFTVDIQKSHQI*FP 2017
            I+ D L+ N     FKQL+K  +           T+SI       S+ + E +S+  N E  +      S+  R+ M     A+   N  R+            G+RLG RK L E+R+RISDY+L   +FGII M++  E   AGV  + S     LK+LI++ST++L+  I+ YH L +QLF  D+C +DWRI +TWQR  Q+ LEL +CAIHPIP  +      K+A    +    +  + V  D+ LSLPMFLRLYL+ RV+LLHSKLF+DA  RSIGA+N++NF+TRF+LKTL+TICP TV ++F++S+W+  SW LR CE   D  H +LLNS WL AITFL VGYG++VP+T CGR I ++ G++G+ CTAL+VAV+++KLELT+AE+HV  F+++ ++ K++KN AANVLRETWLIYK T+LV+ V+  R+R HQRKFL AI+ LRK+K+DQRKL DN+NT+ D AK                       TQ+++++ +++M        +R+ N+E  + ++Q           RCLT     I++      P
Sbjct:  376 IAADSLRINGGMRPFKQLRKPAS-----------TLSIPGSMKTPSIANREQISSGCNEEAAEALVGIHSDYPRYEMYMEERALTGGNTSRKPSTNSAKHKPNVGYRLGKRKALFEKRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLA----NKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTYCGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAK-----------------------TQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLTQHQERIEQRRNFLHP 899          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|Q9UGI6|KCNN3_HUMAN (Small conductance calcium-activated potassium channel protein 3 OS=Homo sapiens OX=9606 GN=KCNN3 PE=1 SV=2)

HSP 1 Score: 382.489 bits (981), Expect = 8.566e-122
Identity = 212/460 (46.09%), Postives = 315/460 (68.48%), Query Frame = 2
Query:  593 HDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKM---AILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            H+ Q    + +S+T  +AN   R+N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W G+  ++S     LK LI+LST++L+  I+ YH   +QLF  D+  +DWRI +T++R   + LE+ VCAIHPIP     + K    A L  S+     +  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKL++ +D +++R HQRKFL+AIH LR +K++QRKL+D +NTLVD +K                        Q+ ++  +TE+ D   +  K+I ++ES + +L
Sbjct:  241 HNHQHAGTTASSTTFPKANK--RKNQNI--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIP----GEYKFFWTARLAFSYTPSRAEADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSK-----------------------MQNVMYDLITELNDRSEDLEKQIGSLESKLEHL 666          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|P58392|KCNN3_PIG (Small conductance calcium-activated potassium channel protein 3 OS=Sus scrofa OX=9823 GN=KCNN3 PE=2 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 9.082e-122
Identity = 212/460 (46.09%), Postives = 315/460 (68.48%), Query Frame = 2
Query:  593 HDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKM---AILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            H+ Q    + +S+T  +AN   R+N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W G+  ++S     LK LI+LST++L+  I+ YH   +QLF  D+  +DWRI +T++R   + LE+ VCAIHPIP     + K    A L  S+     +  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKL++ +D +++R HQRKFL+AIH LR +K++QRKL+D +NTLVD +K                        Q+ ++  +TE+ D   +  K+I ++ES + +L
Sbjct:  234 HNHQHAGTTASSTTFPKANK--RKNQNI--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIP----GEYKFFWTARLAFSYTPSRAEADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSK-----------------------MQNVMYDLITELNDRSEDLEKQIGSLESKLEHL 659          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|P58391|KCNN3_MOUSE (Small conductance calcium-activated potassium channel protein 3 OS=Mus musculus OX=10090 GN=Kcnn3 PE=1 SV=2)

HSP 1 Score: 381.333 bits (978), Expect = 2.778e-121
Identity = 212/460 (46.09%), Postives = 314/460 (68.26%), Query Frame = 2
Query:  593 HDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKM---AILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            H+ Q    +  S+T  +AN   R+N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W G+  ++S     LK LI+LST++L+  I+ YH   +QLF  D+  +DWRI +T++R   + LE+ VCAIHPIP     + K    A L  S+     +  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKL++ +D +++R HQRKFL+AIH LR +K++QRKL+D +NTLVD +K                        Q+ ++  +TE+ D   +  K+I ++ES + +L
Sbjct:  242 HNHQHAGTTAGSTTFPKANK--RKNQNI--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTVILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIP----GEYKFFWTARLAFSYTPSRAEADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSK-----------------------MQNVMYDLITELNDRSEDLEKQIGSLESKLEHL 667          
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Match: sp|P70605|KCNN3_RAT (Small conductance calcium-activated potassium channel protein 3 OS=Rattus norvegicus OX=10116 GN=Kcnn3 PE=2 SV=3)

HSP 1 Score: 380.948 bits (977), Expect = 3.549e-121
Identity = 212/460 (46.09%), Postives = 314/460 (68.26%), Query Frame = 2
Query:  593 HDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKM---AILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINL 1957
            H+ Q    +  S+T  +AN   R+N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W G+  ++S     LK LI+LST++L+  I+ YH   +QLF  D+  +DWRI +T++R   + LE+ VCAIHPIP     + K    A L  S+     +  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKL++ +D +++R HQRKFL+AIH LR +K++QRKL+D +NTLVD +K                        Q+ ++  +TE+ D   +  K+I ++ES + +L
Sbjct:  242 HNHQHAGTTAGSTTFPKANK--RKNQNI--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIP----GEYKFFWTARLAFSYTPSRAEADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSK-----------------------MQNVMYDLITELNDRSEDLEKQIGSLESKLEHL 667          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A1S3HTQ2 (small conductance calcium-activated potassium channel protein 2 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106158085 PE=4 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 7.747e-151
Identity = 237/450 (52.67%), Postives = 337/450 (74.89%), Query Frame = 2
Query:  641 RANNKIRRNDNCQN--GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTE--FQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP----FLANTDVKMAILDISHQHMLL-DDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTI-QTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQ 1960
            +ANN ++   +  N  G+RLG RKTL E+RR+ISDYSL   +FGI+ MI+ TE  F WAG+  ++S     +KS+I+ ST+ L+  I+ YH + +Q+F+ D+C+EDWRI ++ QR GQ+I+EL VC+IHPIP    F+  T        + H  + +  ++V +D++LSLPMF+RLYL+ RV+LLHSKLF+DA  RSIGA+N+++F+TRF+LK L+TICP  V ++F LS+W+  SW LR CE   D +H +LLNS W+IAITFLS+GYG++VP+T CGR IA+ +G+MGS CTAL+VAV+A+KLELT+AE+HV  F++++++ K+MKN AANVLRETWLIYK+TKLV+ V+ S++R HQRKFL+AIH LRK+K+ QRKLTD +NTLVD AK + Q GL + PS YIS+P  +Y++TQ ++F+ VT+M  +      R++ IE  + +LQ
Sbjct:  262 KANNNVKAEKDRTNHVGYRLGARKTLFEKRRKISDYSLALGMFGIVMMIMETELSFPWAGIYNKSSPYSLVMKSVISASTIALLSLIIAYHAVEVQIFAIDNCVEDWRIAMSLQRIGQIIVELVVCSIHPIPGTYDFIWTT--------VHHDGVTVTSEKVPIDILLSLPMFIRLYLICRVMLLHSKLFTDASSRSIGALNRISFNTRFVLKALMTICPGAVLLVFTLSLWIIASWTLRGCESYHDDQHKNLLNSMWMIAITFLSIGYGDLVPNTYCGRAIAVFTGIMGSGCTALVVAVIARKLELTRAEKHVHNFMMDSQLTKRMKNSAANVLRETWLIYKYTKLVKRVNTSKVRTHQRKFLQAIHSLRKVKVYQRKLTDQANTLVDLAKRMFQNGLEACPSVYISVPHIVYQQTQTNMFEMVTDMHLKQATVESRVDEIEEKLTSLQ 703          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A210QBZ8 (Small conductance calcium-activated potassium channel protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15468 PE=4 SV=1)

HSP 1 Score: 458.759 bits (1179), Expect = 7.954e-148
Identity = 263/529 (49.72%), Postives = 356/529 (67.30%), Query Frame = 2
Query:  395 LDEISIDILKANCSFGGFKQLXXXXXXXXXXXXXXXXTISIINGNPKVSVGDLENVSNNSENFKMPHDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTI-QTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCLTHF 1978
            L +I  D ++ N + G FKQLQK  +++    + + +  S   G   V V        NSE  K   + +    + +S       N +        G+RLG RKTL ERRR+ISDY L   + GI+ MI+ TE   A V  ++    + LKSLI+LSTL+L+  IL YH L IQLF+ D+C+EDWRI I+W+R  Q++ E+ VC +HPIP   +        D S    LL + V +D++LSLPMFLRLYL+ RV+LLHS+LF+DA  RSIGA+N+++FDTRF+LKTL+TICP TV ++F+LS+W+  SWILR+CE   D  H ++LNS WLI+ITFLSVGYG++VP+T CGR IAI++GVMG+ CTAL+VAV+A+KLEL++AE+HV  F+++ ++ K+MKN AANVLRETWLIYK+TKLV+ VD S++RAHQRKFL+AIH LRKIK+ QRKL +N NTLVD AK +   GL S PS YIS+P   Y++TQ  I   V E+    ++  KR+  IE  +  LQ  L   
Sbjct:  224 LSDIGADYMRVNGAIGSFKQLQKPTSMQSLPTSSKMSYTSEDAGAALVGV--------NSELGKYGMEQKQQPETKSSKP-----NPV--------GYRLGKRKTLYERRRKISDYCLVFGMGGIVLMIVETELTMANVYLKDHVCSFVLKSLISLSTLILVCLILAYHALEIQLFAIDNCVEDWRIAISWKRLSQLLTEILVCVVHPIPGNFHFTWYTMKYDGSE---LLKNVVPVDILLSLPMFLRLYLIARVMLLHSRLFTDASSRSIGALNRISFDTRFVLKTLMTICPGTVMLVFMLSLWIIGSWILRSCEYYHDENHQNILNSMWLISITFLSVGYGDIVPNTYCGRAIAIATGVMGAGCTALVVAVMARKLELSRAEKHVHNFMMDTQLTKRMKNAAANVLRETWLIYKYTKLVKKVDGSKVRAHQRKFLQAIHSLRKIKMGQRKLLENQNTLVDMAKNVGMAGLDSMPSCYISIPHVQYQQTQTQISDGVMEINSNQSSLEKRVNKIEEKLAGLQGTLDQL 728          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A1I8IIG4 (CaMBD domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 2.180e-144
Identity = 233/426 (54.69%), Postives = 318/426 (74.65%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQ 1960
            G+RLG R+ L E+R+R+SDY+L   +FGI+ MI+ TE   A    +       L+SLI++ST++L+  IL YH+L IQLFS D+C+EDWRI IT +R  QM++E+ VCAIHP+P     + +  +    H    +   V +DL LSLPMFLRLYL+FRV+LLHSKLF+DA  RSIGA+N+++F+TRF+LKTL+T+ P TV ++F+LS+W+  SW+LRACE   D  H ++LNS WLI+ITFLS+GYG++VP+T CGR I+I++GVMGS+CTAL+VAV A+KLEL++AE+HV  F+++  + K++KN AANVLRETWLIYK+TKLV+ V+ S++R HQRKFL AIH LRK+K DQRKL DN+NTLVD AKT    L+ QP AYIS P+ +Y +TQ  IF TV  M +E     +R++ IE  ++ LQ
Sbjct:  289 GYRLGRRRQLYEKRKRLSDYALAFGMFGIVIMIIETELTMAKQYTKADIYSKVLRSLISISTVILVGLILGYHMLEIQLFSIDNCIEDWRIAITTRRLTQMLMEVIVCAIHPVPNDLTFNWETYV---PHDRKKVSVLVPIDLFLSLPMFLRLYLIFRVMLLHSKLFTDASSRSIGALNRISFNTRFVLKTLMTMFPGTVLLVFILSLWITASWLLRACESYHDALHGNILNSMWLISITFLSIGYGDIVPNTYCGRGISIATGVMGSSCTALVVAVFARKLELSRAEKHVHNFMMDTALTKRLKNSAANVLRETWLIYKYTKLVKRVNPSKVRTHQRKFLHAIHSLRKVKRDQRKLMDNANTLVDLAKTNHDALIKQPRAYISKPLAVYSQTQSDIFGTVQAMHNEQDCLRERMDKIEDYLMMLQ 711          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A1S3HWG1 (small conductance calcium-activated potassium channel protein 2 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106158085 PE=4 SV=1)

HSP 1 Score: 438.728 bits (1127), Expect = 1.193e-140
Identity = 227/449 (50.56%), Postives = 321/449 (71.49%), Query Frame = 2
Query:  641 RANNKIRRNDNCQN--GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTE--FQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP----FLANTDVKMAILDISHQHMLL-DDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQ 1960
            +ANN ++   +  N  G+RLG RKTL E+RR+ISDYSL   +FGI+ MI+ TE  F WAG+  ++S     +KS+I+ ST+ L+  I+ YH + +Q+F+ D+C+EDWRI ++ QR GQ+I+EL VC+IHPIP    F+  T        + H  + +  ++V +D++LSLPMF+RLYL+ RV+LLHSKLF+DA  RSIGA+N+++F+TRF+LK L+TICP  V ++F LS+W+  SW LR CE   D +H +LLNS W+IAITFLS+GYG++VP+T CGR IA+ +G+MGS CTAL+VAV+A+KLELT+AE+HV  F++++++ K+MKN AANVLRETWLIYK+TKLV+ V+ S++R HQRKFL+AIH LRK+K+ QRKLTD +NTLVD AK                       TQ ++F+ VT+M  +      R++ IE  + +LQ
Sbjct:  262 KANNNVKAEKDRTNHVGYRLGARKTLFEKRRKISDYSLALGMFGIVMMIMETELSFPWAGIYNKSSPYSLVMKSVISASTIALLSLIIAYHAVEVQIFAIDNCVEDWRIAMSLQRIGQIIVELVVCSIHPIPGTYDFIWTT--------VHHDGVTVTSEKVPIDILLSLPMFIRLYLICRVMLLHSKLFTDASSRSIGALNRISFNTRFVLKALMTICPGAVLLVFTLSLWIIASWTLRGCESYHDDQHKNLLNSMWMIAITFLSIGYGDLVPNTYCGRAIAVFTGIMGSGCTALVVAVIARKLELTRAEKHVHNFMMDSQLTKRMKNSAANVLRETWLIYKYTKLVKRVNTSKVRTHQRKFLQAIHSLRKVKVYQRKLTDQANTLVDLAK-----------------------TQTNMFEMVTDMHLKQATVESRVDEIEEKLTSLQ 679          
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Match: A0A1I8HIS4 (CaMBD domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 1.376e-136
Identity = 221/403 (54.84%), Postives = 299/403 (74.19%), Query Frame = 2
Query:  758 VFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQ 1960
            +FGI+ MI+ TE   A    +       L+SLI++ST++L+  IL YH+L IQLFS D+C+EDWRI IT +R  QM++E+ VCAIHP+P     N +       + H    +   V +DL LSLPMFLRLYL+FRV+LLHSKLF+DA  RSIGA+N+++F+TRF+LKTL+T+ P TV ++F+LS+W+  SW+LRACE   D  H ++LNS WLI+ITFLS+GYG++VP+T CGR I+I++GVMGS+CTAL+VAV A+KLEL++AE+HV  F+++  + K++KN AANVLRETWLIYK+TKLV+ V+ S++R HQRKFL AIH LRK+K DQRKL DN+NTLVD AKT    L+ QP AYIS P+ +Y +TQ  IF TV  M +E     +R++ IE  ++ LQ
Sbjct:    1 MFGIVIMIIETELTMAKQYTKADIYSKVLRSLISISTVILVGLILGYHMLEIQLFSIDNCIEDWRIAITTRRLTQMLMEVIVCAIHPVPNDLTFNWETY-----VPHDRKKVSVLVPIDLFLSLPMFLRLYLIFRVMLLHSKLFTDASSRSIGALNRISFNTRFVLKTLMTMFPGTVLLVFILSLWITASWLLRACESYHDALHGNILNSMWLISITFLSIGYGDIVPNTYCGRGISIATGVMGSSCTALVVAVFARKLELSRAEKHVHNFMMDTALTKRLKNSAANVLRETWLIYKYTKLVKRVNPSKVRTHQRKFLHAIHSLRKVKRDQRKLMDNANTLVDLAKTNHDALIKQPRAYISKPLAVYSQTQSDIFGTVQAMHNEQDCLRERMDKIEDYLMMLQ 398          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn3 (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 3 [Source:ZFIN;Acc:ZDB-GENE-100921-56])

HSP 1 Score: 375.941 bits (964), Expect = 2.095e-120
Identity = 206/456 (45.18%), Postives = 305/456 (66.89%), Query Frame = 2
Query:  659 RRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCLT----HFTVDIQKSH 2002
            R+N N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W GV  ++S     LK LI+LST++L+  I+ YH   +QLF  D+  +DWRI +T +R   + LEL V A+HP+P  F      ++A   I  Q      +  LD++LS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NKV+F+TRF++KTL+TICP TV ++F +S+W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKL++ +D SR+R HQRKFL+AIH LR +K++QRKL+D +NTLVD +K                        Q  +++ ++E+ D   +  +++ ++E  V  L    +    H T  +   H
Sbjct:  241 RKNQNI--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GVYSKSSMYSLALKCLISLSTIILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKFVWRARLAFTYIPSQ-----AEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSK-----------------------MQSVMYELMSELNDRSEDLERQMLSLEQRVEQLTAGFSALPAHLTATLSAQH 665          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn2 (potassium calcium-activated channel subfamily N member 2 [Source:ZFIN;Acc:ZDB-GENE-091116-41])

HSP 1 Score: 370.163 bits (949), Expect = 2.952e-120
Identity = 189/382 (49.48%), Postives = 276/382 (72.25%), Query Frame = 2
Query:  659 RRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKT 1792
            ++N N   G +LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W    K++  ++     +   + ++L + I+ YH   IQLF  D+  +DWRI +T++R   + LE+ VCAIHPIP  +      ++A    S +         +D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +RACE   D +   ++ L + WLI+ITFL++GYG+MVP+T CG+ + + +G+MG+ CTAL+VAV+AKKLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV  +D +R+R HQRKFL+AIH LR +K++QRKL D +N+LVD AKT
Sbjct:   81 KKNQNI--GQKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYGKESLYSLALKCLISLSTIILLGLIII-YHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHPIPGKYTFTWTARLAFYYTSSK-----TDADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNQDVTSNFLGAMWLISITFLTIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKMDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKT 454          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn1b (potassium intermediate/small conductance calcium-activated channel, subfamily N, member 1b [Source:ZFIN;Acc:ZDB-GENE-060503-397])

HSP 1 Score: 323.553 bits (828), Expect = 1.141e-102
Identity = 196/450 (43.56%), Postives = 288/450 (64.00%), Query Frame = 2
Query:  644 ANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIA-ISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCLTHFTV 1984
            +N   +RN +   G++LG+R+ L E+R+R+SDY+L   +FGI+ M+  TE  W GV  + S+  + LK LI+LSTL+L+  I+ YH   IQLF  D+  +DWRI +T++R   ++LEL VCAIHPIP  ++     ++A    ++   + D  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S W+  +W +R          N L  + WL+ + F  +  G  VP     + +A +     G+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV+ +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  V+E+++      KRI  +E  + ++   L    V
Sbjct:   68 SNAPQKRNKDI--GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTLILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERILFIVLELLVCAIHPIPGHYVFTWTARLAF---TYAPSVADADV--DIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVFLFWYP--QNILPIALWLVYVIFSKLQTGSSVPF---WKAVAFLLQPFRGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNVMYDLVSELQERSEELDKRIGQLEEKLDSITSSLQALPV 481          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: kcnn4 (potassium calcium-activated channel subfamily N member 4 [Source:NCBI gene;Acc:103046778])

HSP 1 Score: 244.588 bits (623), Expect = 4.997e-73
Identity = 157/383 (40.99%), Postives = 232/383 (60.57%), Query Frame = 2
Query:  680 NGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKMAI-------------LDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAK 1789
            N +RL  RK L E +RR+  ++L +A+ GI+ MI   E   A V +  S     +  LI+ ST  L+I I+ +H   I+LF  D    DWRI +T  R   + LEL VCA+HP+      DV + +             L  SH+   L+    ++L+LS  MFLRLYLV R ILLHSK+   A  RSIG++N +NF  RF+LK L+   PA   ++F++  WL  +W+LR CE + +     +  + WLIAITFL+VGYG++ P T+CG+ + + +GVMG ACTA++VAV+ KKL L K E+HV +F+++ +I K+++N AANVLRE WL+++ T+     +    R HQR  L+AI   R +++ QRKL D ++ +VD +K
Sbjct:   53 NLYRLRDRKFLLEDKRRLCAWALGAAMLGILLMIGHAELCPA-VYQPGSIYAISINGLISFSTGCLLILIIAFHYKDIRLFIIDHNQVDWRIAMTTNRVLGISLELLVCAVHPVASYLGPDVGVQVPVLKWNSSVTPICLCQSHRETWLE----IELLLSGLMFLRLYLVHRAILLHSKVLLSASYRSIGSLNNINFTFRFVLKVLMNKYPARTLLVFIMLFWLSAAWMLRLCERQAEVETGDMGTALWLIAITFLTVGYGDVSPCTSCGKVVCLFTGVMGVACTAMLVAVVTKKLALNKGEKHVHFFMMDIQISKEIRNAAANVLRECWLLHRTTQAKN--NNGEHRHHQRCLLEAIRVFRHLRLKQRKLRDYTSEMVDLSK 428          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Match: KCNQ4 (potassium voltage-gated channel subfamily Q member 4 [Source:NCBI gene;Acc:103034244])

HSP 1 Score: 51.6026 bits (122), Expect = 2.483e-6
Identity = 31/110 (28.18%), Postives = 54/110 (49.09%), Query Frame = 2
Query: 1310 LFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIY 1639
            +F S+++   E  ++   ++  +S W   IT  ++GYG+  PHT  GR +A    ++G +  AL   +L     L   EQH        K  +K +  AAN+++  W +Y
Sbjct:  247 IFASFLVYLAEKDINTEFSTYADSLWWGTITLTTIGYGDKTPHTWLGRLLAAGFALLGVSFFALPAGILGSGFALKVQEQH------RQKHFEKRRTPAANLIQAAWRLY 350          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010066.1 (pep scaffold:Pmarinus_7.0:GL480376:18291:27660:1 gene:ENSPMAG00000009109.1 transcript:ENSPMAT00000010066.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 200.29 bits (508), Expect = 1.130e-60
Identity = 95/191 (49.74%), Postives = 138/191 (72.25%), Query Frame = 2
Query:  914 QLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVM 1480
            QLF  D+  +DWRI +T+QR   + LEL +CAIHPIP        M    ++  ++    +  +D++LS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+ F+TRF++KTL+TICP TV ++F +S+W+  +W +RACE   DP+   ++ L + WLI+ITFL++GYG+MVPHT CGR + + +G+M
Sbjct:    1 QLFIVDNGADDWRIAMTYQRIFNIGLELLICAIHPIP---GNYTFMWTARLAFTYVSSVKEADVDIVLSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDPQDITSNFLAAMWLISITFLTIGYGDMVPHTYCGRGVCLLTGIM 188          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004465.1 (pep scaffold:Pmarinus_7.0:GL499141:545:1291:-1 gene:ENSPMAG00000004066.1 transcript:ENSPMAT00000004465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.466e-8
Identity = 19/41 (46.34%), Postives = 32/41 (78.05%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWA 805
            G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W+
Sbjct:  107 GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWS 147          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009413.1 (pep scaffold:Pmarinus_7.0:GL479604:29420:34785:-1 gene:ENSPMAG00000008520.1 transcript:ENSPMAT00000009413.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 6.473e-7
Identity = 26/93 (27.96%), Postives = 44/93 (47.31%), Query Frame = 2
Query: 1721 LRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCLTHFTVDIQKS 1999
            LR +K++QRKLTD +NTLVD AK                       TQ+ ++  V+++ +    F KR+  +E  +  +  C+T     I ++
Sbjct:    2 LRSVKMEQRKLTDQANTLVDLAK-----------------------TQNVMYDLVSDLNERNEEFEKRLATMEGKLEAMADCITSLPARIAQT 71          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Nematostella
Match: EDO47600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLG2])

HSP 1 Score: 54.299 bits (129), Expect = 7.754e-8
Identity = 38/129 (29.46%), Postives = 68/129 (52.71%), Query Frame = 2
Query: 1133 LRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACE-IRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVL 1516
            LRL+ VFR+I L  +      LR+I +I      T +++ TL            VL + +FFS I+   E +  D +  S+ ++ W  A+T  S+GYG+MVP T  G+   +++ + G   ++L++ ++
Sbjct:  255 LRLFRVFRIIRLTKR---SERLRAIASIATSTGLTDYVMVTL-----------GVLMLLVFFSTIIYYVEQMSSDTQFESIPDAMWYAAVTITSLGYGDMVPSTMLGKLCGVATILTGFLGSSLLIPIV 369          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Nematostella
Match: EDO47671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC9])

HSP 1 Score: 52.7582 bits (125), Expect = 2.519e-7
Identity = 29/86 (33.72%), Postives = 48/86 (55.81%), Query Frame = 2
Query: 1280 VFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELT 1537
            +FI FVL   + FS ++   E++ +P+  S+  + W   IT  + GYG++VP TA G+ I  +  ++G    AL V +L  K+  T
Sbjct:  290 LFIYFVLV--IVFSSVMYYAEMQDNPKFVSIPEAMWYAVITTTTTGYGDIVPETALGKVIGSACCILGVLVVALPVPILQIKVSNT 373          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn1a (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101164003])

HSP 1 Score: 379.022 bits (972), Expect = 1.055e-122
Identity = 205/423 (48.46%), Postives = 297/423 (70.21%), Query Frame = 2
Query:  683 GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIE 1939
            G++LG+R+ L E+R+R+SDY+L   +FGI+ M+  TE  W GV  + S+  + LK LI+LST++L+  I+ YH   IQLF  D+  +DWRI +T++R   ++LEL VCAIHPIP  ++     ++A    ++   + D  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV+ +D +++R HQRKFL+AIH LR +K++QRKL D +NTLVD AK                       TQ+ ++  V+E+++      KRI  +E
Sbjct:  149 GYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVTETELSW-GVYTKESSYSFALKCLISLSTVILLGLIIMYHAREIQLFMVDNGADDWRIAMTYERIFFIVLELLVCAIHPIPGQYVFTWTARLAF---TYTPSVADADV--DIILSIPMFLRLYLIGRVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWTVRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLCKRVKNTAANVLRETWLIYKHTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAK-----------------------TQNVMYDLVSELQERSEELDKRIGTLE 542          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn2 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101174204])

HSP 1 Score: 372.089 bits (954), Expect = 2.933e-121
Identity = 196/391 (50.13%), Postives = 280/391 (71.61%), Query Frame = 2
Query:  629 STAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLAN-TDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKT 1792
             T +   +  ++N N   G +LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W    K++  ++     +   + ++L + I+ YH   IQLF  D+  +DWRI +T++R   + LE+ VCAIHPIP   N T    A L  S+     D  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +RACE   D +   ++ L + WLI+ITFL++GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+AKKLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV  +D +R+R HQRKFL+AIH LR +K++QRKL D +N+LVD AKT
Sbjct:   52 ETPLHGKSGKKKNQNI--GEKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYGKESLYSLALKCLISLSTIILLGLIII-YHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHPIP--GNYTFTWTARLAYSYVPSRTDADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNQDITSNFLGAMWLISITFLTIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKMDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKT 435          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn3 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101156116])

HSP 1 Score: 376.326 bits (965), Expect = 2.705e-120
Identity = 200/405 (49.38%), Postives = 289/405 (71.36%), Query Frame = 2
Query:  593 HDAQSNRFSMTSS--TAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAK 1789
            HD Q +  S  S+      + +K  +  N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W GV  ++S     LK LI+LST++L+  I+ YH   +QLF  D+  +DWRI +T +R   + LEL V A+HP+P  F      ++A      Q      +  LD++LS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NKV+F+TRF++KTL+TICP TV ++F +S+W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKL++ +D SR+R HQRKFL+AIH LR +K++QRKL+D +NTLVD +K
Sbjct:  200 HDRQRDAPSAYSTYPRGGGSTSKASKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GVYSKSSMYSLALKCLISLSTVILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKFQWRARLAFSYAPSQ-----AEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSK 598          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn2 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101174204])

HSP 1 Score: 374.015 bits (959), Expect = 3.893e-120
Identity = 195/381 (51.18%), Postives = 277/381 (72.70%), Query Frame = 2
Query:  659 RRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLAN-TDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKT 1792
            ++N N   G +LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W    K++  ++     +   + ++L + I+ YH   IQLF  D+  +DWRI +T++R   + LE+ VCAIHPIP   N T    A L  S+     D  V  D+ILS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NK+NF+TRF++KTL+TICP TV ++F +S+W+  +W +RACE   D +   ++ L + WLI+ITFL++GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+AKKLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKLV  +D +R+R HQRKFL+AIH LR +K++QRKL D +N+LVD AKT
Sbjct:  208 KKNQNI--GEKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYGKESLYSLALKCLISLSTIILLGLIII-YHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHPIP--GNYTFTWTARLAYSYVPSRTDADV--DIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNQDITSNFLGAMWLISITFLTIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHNFMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKMDHARVRKHQRKFLQAIHQLRSVKMEQRKLNDQANSLVDLAKT 581          
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Match: kcnn3 (small conductance calcium-activated potassium channel protein 2 [Source:NCBI gene;Acc:101156116])

HSP 1 Score: 377.867 bits (969), Expect = 6.118e-120
Identity = 198/394 (50.25%), Postives = 286/394 (72.59%), Query Frame = 2
Query:  623 TSSTAIRAN-NKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIP--FLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRH--NSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAK 1789
             +ST  R + +K  +  N   G++LG+R+ L E+R+R+SDY+L   +FGI+ M++ TE  W GV  ++S     LK LI+LST++L+  I+ YH   +QLF  D+  +DWRI +T +R   + LEL V A+HP+P  F      ++A      Q      +  LD++LS+PMFLRLYL+ RV+LLHSKLF+DA  RSIGA+NKV+F+TRF++KTL+TICP TV ++F +S+W+  +W +R CE   D +   ++ L + WLI+ITFLS+GYG+MVPHT CG+ + + +G+MG+ CTAL+VAV+A+KLELTKAE+HV  F+++ ++ K++KN AANVLRETWLIYK TKL++ +D SR+R HQRKFL+AIH LR +K++QRKL+D +NTLVD +K
Sbjct:  298 AASTGARGSTSKASKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSW-GVYSKSSMYSLALKCLISLSTVILLGLIIAYHAREVQLFVIDNGADDWRIAMTMERVLLIALELLVSAVHPVPGDFKFQWRARLAFSYAPSQ-----AEADLDMVLSVPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKVHFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDAQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLMKKIDHSRVRKHQRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSK 685          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000046926.1 (SMESG000046926.1)

HSP 1 Score: 1224.15 bits (3166), Expect = 0.000e+0
Identity = 640/642 (99.69%), Postives = 640/642 (99.69%), Query Frame = 2
Query:   83 MESHEKYPEIYLNDGNEDSFKNGMKFYHSNKPASFDDSSRNLQVNTHENCNKKVYLTTPSPCVRRYSDTSISKFCETDLLKLNNQLITRKRFCPRQFSIQKPPALDEISIDILKANCSFGGFKQLXXXXXXXXXXXXXXXXTISIINGNPKVSVGDLENVSNNSENFKMPHDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCLTHFTVDIQKSHQI 2008
            MESHEKYPEIYLNDGNEDSFKNGMKFYHSNKPASFDDSSRNLQVNT ENCNKKVYLTTPSPCVRRYSDTSISKFCETDLLKLNNQLITRKRFCPRQFSIQKPPALDEISIDILKANCSFGGFKQLQKVNNVKKECKNEEQNTISIINGNPKVSVGDLENVSNNSENFKMPHDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFLKSLITLSTLVLIIFILTYHVLVIQLFSCDDCLEDWRITITWQR GQMILELGVCAIHPIPFLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILNNKIKKKMKNCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCLTHFTVDIQKSHQI
Sbjct:    1 MESHEKYPEIYLNDGNEDSFKNGMKFYHSNKPASFDDSSRNLQVNTDENCNKKVYLTTPSPCVRRYSDTSISKFCETDLLKLNNQLITRKRFCPRQFSIQKPPALDEISIDILKANCSFGGFKQLQKVNNVKKECKNEEQNTISIINGNPKVSVGDLENVSNNSENFKMPHDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFLKSLITLSTLVLIIFILTYHVLVIQLFSCDDCLEDWRITITWQRIGQMILELGVCAIHPIPFLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILNNKIKKKMKNCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCLTHFTVDIQKSHQI 642          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000076156.1 (SMESG000076156.1)

HSP 1 Score: 479.559 bits (1233), Expect = 1.341e-160
Identity = 267/543 (49.17%), Postives = 367/543 (67.59%), Query Frame = 2
Query:  392 ALDEISIDILKANCSFGGFKQLXXXXXXXXXXXXXXXXTISIINGNPKVSVGD----------LENVSNNSENFKMP--HDAQSNRF----SMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKMAILDISHQHML-LDDQVS--LDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVD-PRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQ 1960
             +DEI +D ++AN +  GFKQL +  +   E K+   + I+I   NP  S             L++   +++N K P   D     +    +  S+   R + +I        G+RLG RK L E+R RISD+SL  A+FGI+ M++ TE  WAG+ +++S     LKSLI++ST++L+  IL YH LVIQLFSCDDC+EDWRI ITWQ   Q++LEL +C+IHPIP   N ++    +    + +L +DD++   ++ IL++PM LR Y++FR +LLHS++F DAG RSIGA+NKV+FDTRF+LKTL+T+CP TV + F+L++W+  SW +R CEI  D P+H ++LN  WLIA+TFLS+GYG++VPHT CGR IAIS+GVMGSACTAL+VAV A+KLEL+KAE+HVT F+L N++ KK+K  AANVLRETWLIYK+TKLV+ V+ S++R HQRKFLKAIHGLRK+KIDQRK  DNSNTLVD AK                       TQ++I++TVTEMR  ++    RI  IE +++ L 
Sbjct:  167 GIDEIGLDYMRANGAIPGFKQLHQPMSNGNEQKSSVASLINIFTKNPFSSASHSFDKSHSCNYLQSNMESNDNSKDPSSKDKTPQTYLPNPNQKSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKSSIYSILLKSLISISTIILLGLILAYHALVIQLFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIP--GNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGTVLLTFILTLWILLSWTMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAK-----------------------TQNNIYETVTEMRLHHSYLENRISKIEDNLVTLH 684          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000076156.1 (SMESG000076156.1)

HSP 1 Score: 468.774 bits (1205), Expect = 1.374e-156
Identity = 264/543 (48.62%), Postives = 364/543 (67.03%), Query Frame = 2
Query:  392 ALDEISIDILKANCSFGGFKQLXXXXXXXXXXXXXXXXTISIINGNPKVSVGD----------LENVSNNSENFKMP--HDAQSNRF----SMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKMAILDISHQHML-LDDQVS--LDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVD-PRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQ 1960
             +DEI +D ++AN +  GFKQL +  +   E K+   + I+I   NP  S             L++   +++N K P   D     +    +  S+   R + +I        G+RLG RK L E+R RISD+SL  A+FGI+ M++ TE  WAG+ +++S     LKSLI++ST++L+  IL YH L   LFSCDDC+EDWRI ITWQ   Q++LEL +C+IHPIP   N ++    +    + +L +DD++   ++ IL++PM LR Y++FR +LLHS++F DAG RSIGA+NKV+FDTRF+LKTL+T+CP TV + F+L++W+  SW +R CEI  D P+H ++LN  WLIA+TFLS+GYG++VPHT CGR IAIS+GVMGSACTAL+VAV A+KLEL+KAE+HVT F+L N++ KK+K  AANVLRETWLIYK+TKLV+ V+ S++R HQRKFLKAIHGLRK+KIDQRK  DNSNTLVD AK                       TQ++I++TVTEMR  ++    RI  IE +++ L 
Sbjct:  166 GIDEIGLDYMRANGAIPGFKQLHQPMSNGNEQKSSVASLINIFTKNPFSSASHSFDKSHSCNYLQSNMESNDNSKDPSSKDKTPQTYLPNPNQKSTCYTRGSRQIASRSMKSVGYRLGRRKELYEKRMRISDFSLSFAIFGILVMVIDTELLWAGIYRKSSIYSILLKSLISISTIILLGLILAYHAL---LFSCDDCIEDWRIAITWQSVAQLLLELLICSIHPIP--GNFNISQYFVTPKFKGVLSVDDRLESMIEPILAVPMLLRFYMIFRSLLLHSRMFRDAGSRSIGAMNKVSFDTRFILKTLMTMCPGTVLLTFILTLWILLSWTMRMCEINTDSPKHANMLNCMWLIAVTFLSIGYGDIVPHTNCGRGIAISAGVMGSACTALLVAVFARKLELSKAEKHVTQFMLENQMTKKLKYYAANVLRETWLIYKYTKLVKHVNASKVRTHQRKFLKAIHGLRKLKIDQRKFQDNSNTLVDLAK-----------------------TQNNIYETVTEMRLHHSYLENRISKIEDNLVTLH 680          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000046614.1 (SMESG000046614.1)

HSP 1 Score: 410.223 bits (1053), Expect = 2.827e-134
Identity = 256/596 (42.95%), Postives = 360/596 (60.40%), Query Frame = 2
Query:  272 RRYSDTSISKFCETDLLKLNNQLITRKRFCPRQFSIQKPPA----------------LDEISIDILKANCSFGGFKQLXXXXXXXXXXXXXXXXTISIINGNP--------------KVSVGDLENVSNNSENFKMPHDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCL 1969
            RRYSDT+I    E                C  +++  K P+                L+ I +D ++ N +  GFKQL++    K   + ++    SI N +               + S G L++     E  K+ +D      ++        NN      N   G+RLG RK L E+R+R++DYSL  AVFG+  MIL  E     +    S     +K LI +ST++L+  I+ YHVL I++FS DD +EDWRI ITWQR  QMI E+ +C++ PIP       K  + ++       +  V+L+++LSLPM LRLYL+ RV+LLHSKLFSDAG RSIGA+NKV+F+  F+LKT++T  P TV ++F+L +WL FSW +R CE+  D +H +L NS WLI++TFLS+GYG++VPHT CGR IAI++GV GSACTAL+VAV A++LEL+KAE+HV +F+  N++ K++KN AANVLRETWLIYK+TKLV+ ++  ++R HQRKFL+AIHG+R++KIDQRKL DNSNTLVD AK                       TQ SI++TVTEMR E    H  +E ++ +++ LQ C+
Sbjct:   99 RRYSDTTIGGPIEN-------------ANCQHKYAFYKNPSHLVYPTGAIKDKMKTGLETIGVDFMRVNGAVSGFKQLKRAEEFKTAHRQKKLIK-SISNASQPQNDVKFKPSDSDYRTSFGTLKS-EEVQEECKVQNDHSGESAALCRRRDDYNNNNRTHKTNKNVGYRLGKRKELFEKRKRVTDYSLMFAVFGVFIMILDLELSMYNLYHPTSIYSITMKGLILISTVILVGLIMAYHVLEIKIFSWDDSIEDWRIAITWQRIAQMIAEVFICSVQPIP--GYYTFKWRVRNV-------EKDVNLNIVLSLPMLLRLYLILRVLLLHSKLFSDAGSRSIGAMNKVSFNISFVLKTVMTTNPGTVLLVFILFIWLVFSWTMRICEVVYDDQHGNLFNSMWLISVTFLSIGYGDIVPHTYCGRGIAIATGVTGSACTALVVAVFARRLELSKAEKHVIHFMFENQLTKQLKNYAANVLRETWLIYKYTKLVKHINPMKVRVHQRKFLRAIHGMRQVKIDQRKLQDNSNTLVDLAK-----------------------TQSSIYETVTEMRIEQNYLHHTLEILDQNLLKLQECI 647          
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Match: SMESG000046614.1 (SMESG000046614.1)

HSP 1 Score: 409.838 bits (1052), Expect = 4.463e-134
Identity = 256/596 (42.95%), Postives = 360/596 (60.40%), Query Frame = 2
Query:  272 RRYSDTSISKFCETDLLKLNNQLITRKRFCPRQFSIQKPPA----------------LDEISIDILKANCSFGGFKQLXXXXXXXXXXXXXXXXTISIINGNP--------------KVSVGDLENVSNNSENFKMPHDAQSNRFSMTSSTAIRANNKIRRNDNCQNGFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNTVYFXXXXXXXXXXXXXXXXXXYHVLVIQLFSCDDCLEDWRITITWQRFGQMILELGVCAIHPIPFLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMFLRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATVFILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMVPHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILXXXXXXXXXXCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKIKIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKTVTEMRDEYTNFHKRIENIESSVINLQRCL 1969
            RRYSDT+I    E                C  +++  K P+                L+ I +D ++ N +  GFKQL++    K   + ++    SI N +               + S G L++     E  K+ +D      ++        NN      N   G+RLG RK L E+R+R++DYSL  AVFG+  MIL  E     +    S     +K LI +ST++L+  I+ YHVL I++FS DD +EDWRI ITWQR  QMI E+ +C++ PIP       K  + ++       +  V+L+++LSLPM LRLYL+ RV+LLHSKLFSDAG RSIGA+NKV+F+  F+LKT++T  P TV ++F+L +WL FSW +R CE+  D +H +L NS WLI++TFLS+GYG++VPHT CGR IAI++GV GSACTAL+VAV A++LEL+KAE+HV +F+  N++ K++KN AANVLRETWLIYK+TKLV+ ++  ++R HQRKFL+AIHG+R++KIDQRKL DNSNTLVD AK                       TQ SI++TVTEMR E    H  +E ++ +++ LQ C+
Sbjct:  107 RRYSDTTIGGPIEN-------------ANCQHKYAFYKNPSHLVYPTGAIKDKMKTGLETIGVDFMRVNGAVSGFKQLKRAEEFKTAHRQKKLIK-SISNASQPQNDVKFKPSDSDYRTSFGTLKS-EEVQEECKVQNDHSGESAALCRRRDDYNNNNRTHKTNKNVGYRLGKRKELFEKRKRVTDYSLMFAVFGVFIMILDLELSMYNLYHPTSIYSITMKGLILISTVILVGLIMAYHVLEIKIFSWDDSIEDWRIAITWQRIAQMIAEVFICSVQPIP--GYYTFKWRVRNV-------EKDVNLNIVLSLPMLLRLYLILRVLLLHSKLFSDAGSRSIGAMNKVSFNISFVLKTVMTTNPGTVLLVFILFIWLVFSWTMRICEVVYDDQHGNLFNSMWLISVTFLSIGYGDIVPHTYCGRGIAIATGVTGSACTALVVAVFARRLELSKAEKHVIHFMFENQLTKQLKNYAANVLRETWLIYKYTKLVKHINPMKVRVHQRKFLRAIHGMRQVKIDQRKLQDNSNTLVDLAK-----------------------TQSSIYETVTEMRIEQNYLHHTLEILDQNLLKLQECI 655          
The following BLAST results are available for this feature:
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNN31.784e-12246.09potassium calcium-activated channel subfamily N me... [more]
KCNN34.492e-12144.84potassium calcium-activated channel subfamily N me... [more]
KCNN22.463e-12046.26potassium calcium-activated channel subfamily N me... [more]
KCNN23.262e-11845.94potassium calcium-activated channel subfamily N me... [more]
KCNN24.363e-11846.26potassium calcium-activated channel subfamily N me... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnl-21.158e-9545.17KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-21.725e-9545.17KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-21.837e-9545.17KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-22.003e-9545.17KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
kcnl-22.004e-9545.17KCNN (Potassium K ChaNNel, calcium activated)-Like... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SK1.197e-13448.04gene:FBgn0029761 transcript:FBtr0300467[more]
SK2.000e-13348.04gene:FBgn0029761 transcript:FBtr0344555[more]
SK2.248e-13343.78gene:FBgn0029761 transcript:FBtr0301953[more]
SK7.336e-13347.60gene:FBgn0029761 transcript:FBtr0301949[more]
SK1.103e-13247.60gene:FBgn0029761 transcript:FBtr0301952[more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnn1a1.408e-12446.73potassium intermediate/small conductance calcium-a... [more]
kcnn1b8.353e-12247.11potassium intermediate/small conductance calcium-a... [more]
kcnn1a9.640e-12146.73potassium intermediate/small conductance calcium-a... [more]
kcnn31.868e-12051.58potassium intermediate/small conductance calcium-a... [more]
kcnn31.868e-12051.58potassium intermediate/small conductance calcium-a... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr174.082e-12346.12WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
wdr176.927e-12346.49WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
wdr171.132e-12246.49WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
wdr172.994e-12246.49WD repeat domain 17 [Source:Xenbase;Acc:XB-GENE-10... [more]
KCNN22.740e-12144.79potassium channel, calcium activated intermediate/... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnn33.972e-12246.09potassium intermediate/small conductance calcium-a... [more]
Kcnn21.190e-12046.26potassium intermediate/small conductance calcium-a... [more]
Kcnn21.190e-12046.26potassium intermediate/small conductance calcium-a... [more]
Kcnn27.597e-11846.26potassium intermediate/small conductance calcium-a... [more]
Kcnn19.553e-11645.75potassium intermediate/small conductance calcium-a... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7KVW5|KCNN_DROME3.956e-12942.88Small conductance calcium-activated potassium chan... [more]
sp|Q9UGI6|KCNN3_HUMAN8.566e-12246.09Small conductance calcium-activated potassium chan... [more]
sp|P58392|KCNN3_PIG9.082e-12246.09Small conductance calcium-activated potassium chan... [more]
sp|P58391|KCNN3_MOUSE2.778e-12146.09Small conductance calcium-activated potassium chan... [more]
sp|P70605|KCNN3_RAT3.549e-12146.09Small conductance calcium-activated potassium chan... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HTQ27.747e-15152.67small conductance calcium-activated potassium chan... [more]
A0A210QBZ87.954e-14849.72Small conductance calcium-activated potassium chan... [more]
A0A1I8IIG42.180e-14454.69CaMBD domain-containing protein OS=Macrostomum lig... [more]
A0A1S3HWG11.193e-14050.56small conductance calcium-activated potassium chan... [more]
A0A1I8HIS41.376e-13654.84CaMBD domain-containing protein OS=Macrostomum lig... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnn32.095e-12045.18potassium intermediate/small conductance calcium-a... [more]
kcnn22.952e-12049.48potassium calcium-activated channel subfamily N me... [more]
kcnn1b1.141e-10243.56potassium intermediate/small conductance calcium-a... [more]
kcnn44.997e-7340.99potassium calcium-activated channel subfamily N me... [more]
KCNQ42.483e-628.18potassium voltage-gated channel subfamily Q member... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000010066.11.130e-6049.74pep scaffold:Pmarinus_7.0:GL480376:18291:27660:1 g... [more]
ENSPMAT00000004465.11.466e-846.34pep scaffold:Pmarinus_7.0:GL499141:545:1291:-1 gen... [more]
ENSPMAT00000009413.16.473e-727.96pep scaffold:Pmarinus_7.0:GL479604:29420:34785:-1 ... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO476007.754e-829.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476712.519e-733.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnn1a1.055e-12248.46small conductance calcium-activated potassium chan... [more]
kcnn22.933e-12150.13small conductance calcium-activated potassium chan... [more]
kcnn32.705e-12049.38small conductance calcium-activated potassium chan... [more]
kcnn23.893e-12051.18small conductance calcium-activated potassium chan... [more]
kcnn36.118e-12050.25small conductance calcium-activated potassium chan... [more]
back to top
BLAST of Small conductance calcium-activated potassium channel protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046926.10.000e+099.69SMESG000046926.1[more]
SMESG000076156.11.341e-16049.17SMESG000076156.1[more]
SMESG000076156.11.374e-15648.62SMESG000076156.1[more]
SMESG000046614.12.827e-13442.95SMESG000046614.1[more]
SMESG000046614.14.463e-13442.95SMESG000046614.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031047 ID=SMED30031047|Name=Small conductance calcium-activated potassium channel protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2020bp
AGGCACTTAGATACGTAGAATATTTTCATTGAAGAAATGTTTCGCGTTTT
AAGATAAAATTAAAAGGACATTTCAAGAATCTATGGAATCTCACGAGAAA
TATCCAGAAATCTATCTCAACGATGGTAACGAGGACTCTTTTAAAAATGG
AATGAAATTTTATCATTCAAACAAACCAGCCAGTTTTGATGACAGTTCGA
GAAATTTGCAGGTAAATACGCATGAGAATTGTAATAAAAAAGTGTATCTA
ACTACGCCATCACCTTGCGTTCGGAGGTACAGCGACACGTCAATCAGTAA
ATTCTGTGAAACAGACCTCCTGAAATTGAATAATCAGCTGATTACGAGGA
AACGATTTTGTCCACGACAATTTTCAATCCAAAAGCCGCCAGCTCTAGAC
GAGATAAGCATTGATATTTTAAAAGCCAACTGTAGTTTCGGAGGATTTAA
GCAGCTTCAAAAAGTGAATAATGTGAAAAAAGAATGCAAAAACGAAGAGC
AAAATACAATTTCAATTATAAACGGAAATCCTAAAGTCTCAGTTGGGGAC
CTGGAAAATGTTTCAAATAATTCTGAGAATTTCAAAATGCCACATGATGC
TCAATCTAATAGATTTTCTATGACAAGCAGCACAGCAATAAGAGCTAACA
ATAAAATTCGTCGCAACGACAACTGTCAAAATGGATTTCGTTTAGGATAT
CGAAAAACCTTACAAGAGAGACGGCGACGAATATCAGATTATTCTTTATG
TTCGGCAGTGTTTGGGATTATTACGATGATCTTGATGACAGAATTTCAAT
GGGCCGGGGTCATAAAACAAAATTCCAACACAGTATATTTTTTGAAATCG
CTTATCACTTTATCAACACTTGTTCTGATTATTTTTATTCTCACTTATCA
TGTACTTGTAATACAGCTATTTTCTTGCGATGATTGCTTGGAGGACTGGC
GGATAACTATAACTTGGCAGCGATTCGGACAAATGATCTTAGAGCTCGGA
GTATGCGCAATTCATCCAATCCCATTTTTGGCAAATACTGATGTCAAAAT
GGCGATTCTTGACATAAGTCATCAGCATATGTTACTTGATGATCAAGTTT
CTTTAGATTTAATTTTGTCTCTTCCAATGTTTTTAAGATTGTATTTGGTG
TTTCGAGTTATTTTACTTCATTCAAAGCTCTTTTCCGATGCTGGTTTAAG
AAGCATTGGTGCAATAAATAAAGTTAATTTTGATACAAGATTCCTCCTGA
AAACTCTACTGACAATTTGTCCAGCAACAGTTTTCATTTTGTTCGTTTTA
TCCATGTGGTTGTTTTTCAGTTGGATTCTCAGAGCTTGTGAAATTCGAGT
AGATCCCAGACATAATAGCTTGCTCAATTCGACTTGGTTAATTGCTATTA
CATTTCTCAGTGTAGGATATGGAGAAATGGTTCCGCATACTGCTTGCGGA
AGATGTATAGCCATTTCTTCTGGTGTCATGGGATCTGCTTGTACAGCTCT
CATTGTGGCAGTTTTAGCCAAAAAGCTGGAGCTAACCAAAGCCGAACAGC
ATGTCACATATTTCATTTTAAATAACAAAATCAAAAAAAAGATGAAAAAT
TGTGCAGCTAATGTACTCAGAGAAACTTGGCTGATATATAAATTTACAAA
ACTGGTTGAAATCGTCGATCTTAGTCGAATTAGGGCACACCAAAGAAAGT
TCCTTAAAGCAATTCATGGGTTGAGAAAAATCAAAATAGATCAAAGGAAA
CTGACAGATAATTCAAATACTCTAGTCGATTTTGCAAAGACTATTCAAAC
TGGTTTACTGAGCCAACCGTCAGCTTATATCTCAATGCCTGTTGAATTAT
ACAGAGAAACACAACATTCTATATTTAAAACTGTCACTGAAATGCGTGAT
GAATATACAAACTTCCACAAAAGGATTGAAAATATAGAAAGTTCAGTAAT
AAATTTACAACGTTGCCTCACTCACTTTACTGTTGATATTCAAAAGTCTC
ATCAAATTTAATTCCCTAAA
back to top

protein sequence of SMED30031047-orf-1

>SMED30031047-orf-1 ID=SMED30031047-orf-1|Name=SMED30031047-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=643bp
MESHEKYPEIYLNDGNEDSFKNGMKFYHSNKPASFDDSSRNLQVNTHENC
NKKVYLTTPSPCVRRYSDTSISKFCETDLLKLNNQLITRKRFCPRQFSIQ
KPPALDEISIDILKANCSFGGFKQLQKVNNVKKECKNEEQNTISIINGNP
KVSVGDLENVSNNSENFKMPHDAQSNRFSMTSSTAIRANNKIRRNDNCQN
GFRLGYRKTLQERRRRISDYSLCSAVFGIITMILMTEFQWAGVIKQNSNT
VYFLKSLITLSTLVLIIFILTYHVLVIQLFSCDDCLEDWRITITWQRFGQ
MILELGVCAIHPIPFLANTDVKMAILDISHQHMLLDDQVSLDLILSLPMF
LRLYLVFRVILLHSKLFSDAGLRSIGAINKVNFDTRFLLKTLLTICPATV
FILFVLSMWLFFSWILRACEIRVDPRHNSLLNSTWLIAITFLSVGYGEMV
PHTACGRCIAISSGVMGSACTALIVAVLAKKLELTKAEQHVTYFILNNKI
KKKMKNCAANVLRETWLIYKFTKLVEIVDLSRIRAHQRKFLKAIHGLRKI
KIDQRKLTDNSNTLVDFAKTIQTGLLSQPSAYISMPVELYRETQHSIFKT
VTEMRDEYTNFHKRIENIESSVINLQRCLTHFTVDIQKSHQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036122CaM-bd_dom_sf
IPR028325VG_K_chnl
IPR015449K_chnl_Ca-activ_SK
IPR004178CaM-bd_dom
IPR013099K_chnl_dom
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0016286small conductance calcium-activated potassium channel activity
GO:0015269calcium-activated potassium channel activity
GO:0005516calmodulin binding
GO:0009881photoreceptor activity
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0007165signal transduction
GO:0016057regulation of membrane potential in photoreceptor cell
GO:0071805potassium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
GO:0043025neuronal cell body
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 427..449
score: 33.03
coord: 10..29
score: 27.53
coord: 356..382
score: 21.99
coord: 456..482
score: 21.46
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 386..482
e-value: 1.2E-13
score: 52.7
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 483..575
e-value: 2.7E-37
score: 128.8
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 351..520
NoneNo IPR availableTMHMMTMhelixcoord: 258..280
NoneNo IPR availableTMHMMTMhelixcoord: 460..479
NoneNo IPR availableTMHMMTMhelixcoord: 393..415
NoneNo IPR availableTMHMMTMhelixcoord: 428..450
NoneNo IPR availableTMHMMTMhelixcoord: 221..243
NoneNo IPR availableTMHMMTMhelixcoord: 343..362
IPR015449Potassium channel, calcium-activated, SKPRINTSPR01451SKCHANNELcoord: 203..223
score: 53.06
coord: 304..322
score: 47.37
IPR015449Potassium channel, calcium-activated, SKPFAMPF03530SK_channelcoord: 203..315
e-value: 9.7E-37
score: 125.5
IPR015449Potassium channel, calcium-activated, SKPANTHERPTHR10153SMALL CONDUCTANCE CALCIUM-ACTIVATED POTASSIUM CHANNELcoord: 181..632
IPR004178Calmodulin-binding domainSMARTSM01053CaMBD_2coord: 497..573
e-value: 1.6E-34
score: 130.7
IPR004178Calmodulin-binding domainPFAMPF02888CaMBDcoord: 498..570
e-value: 1.7E-31
score: 108.2
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 405..482
e-value: 4.6E-13
score: 48.9
IPR036122SK, calmodulin-binding domain superfamilySUPERFAMILYSSF81327Small-conductance potassium channelcoord: 480..570