PiggyBac transposable element-derived protein 4

Overview
NamePiggyBac transposable element-derived protein 4
Smed IDSMED30031043
Length (bp)2303
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PiggyBac transposable element-derived protein 4 (SMED30031043) t-SNE clustered cells

Violin plots show distribution of expression levels for PiggyBac transposable element-derived protein 4 (SMED30031043) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PiggyBac transposable element-derived protein 4 (SMED30031043) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PiggyBac transposable element-derived protein 4 (SMED30031043) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031043

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30031043h1SMcG0001585 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031043h1SMcG0001585 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031043h1SMcG0001585 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031043h1SMcG0001585 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031043h1SMcG0001585 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031043h1SMcG0021829 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031043h1SMcG0021829 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031043h1SMcG0021829 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031043h1SMcG0021829 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031043h1SMcG0021829 dd_Smed_v4_8652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Match: PGBD4 (piggyBac transposable element derived 4 [Source:HGNC Symbol;Acc:HGNC:19401])

HSP 1 Score: 155.992 bits (393), Expect = 2.112e-39
Identity = 123/498 (24.70%), Postives = 234/498 (46.99%), Query Frame = 2
Query:  605 DFLGIPGITLNNPPKTQ-MDVLKLFINDDFLVIESNKYYYQNIDRLKSQTKGIK-------WKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDR----LEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRLIET---------IQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYL-NA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTK-WTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRD--PPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSAC------KVRSETCFICNFVKFP 2005
            DF G PG  ++    T  +   +LF  ++ LV +  +        L S+  G K       WKD    E+K F  ++   G+V+K     + +T P+L+TP+  + M+  RF  ++R  HF +N  I+    +    L+KI+P+ +  V KF  +Y P + +++DE ++ ++G L  + Y   K +++G+ + +L ES +GY+ N  ++   G+ L ++         + T+V+      + +++DN+  S      L Q +    GT +     + N  K  + +  T+ R   +++   W   KEV+++S+ H+  + E +N +    +K  +P  ++DYN+ M  VD ADQ L+ Y   RK  K W K+   ++++  + NS++++     KK   +  +  I F     ++ E ++ +   P     +  P  D   P RLS    +H    I +    +    +C++C +       K+R ET + C     P
Sbjct:   87 DFTGTPGRKVDVSDITDPLQYFELFFTEE-LVSKITRETNAQAALLASKPPGPKGFSRMDKWKDTDNDELKVFFAVMLLQGIVQKPELEMFWSTRPLLDTPYLRQIMTGERFLLLFRCLHFVNNSSISAGQSKAQISLQKIKPVFDFLVNKFSTVYTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVLCESQSGYVWNALVHTGPGMNLKDSADGLKSSRIVLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKRIAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIEVNNRN---GKKTKRPRVIVDYNENMGAVDSADQMLTSYPSERKRHKVWYKKFFHHLLHITVLNSYILF-----KKDNPEHTMSHINFRL---ALIERMLEKHHKPGQQHLRGRPCSDDVTPLRLS---GRHFPKSIPATSGKQNPTGRCKICCSQYDKDGKKIRKETRYFCAECDVP 569          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 105.531 bits (262), Expect = 6.795e-23
Identity = 112/474 (23.63%), Postives = 200/474 (42.19%), Query Frame = 2
Query:  647 KTQMDVLKLFINDDFLVIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQ-----------GLRLI-ETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKK-------IEAYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISS---IHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSA-CKVRSETCFICNFVK 1999
            +T  ++L+LF++D+  VIE    Y      L + +KG+    +T  E K F+G+I   G V   RR  +      +        M R+RF  I+   H  DN ++ DP D+  K+RP+I+   E+       +   S DE ++P+ GR   + +  GK I++G        +  GYIC F+ Y  +           G  L+ +  + +   +   +H+++ +N++ S+     L     +  GT++K       +E+ +   K +    D     K +I+ + W     V++ SS   IH   +   ++     + ++ +PN +  YN++M GVDRAD+ +  Y    +  KW     ++     L N++ ++ +   K + +  F   +   +     H         P      R   R+   R   D   HVI K   +GK    Q +C  C      R E C +   VK
Sbjct:  140 RTPTEILELFLDDE--VIELIVKY----SNLYACSKGVHL-GLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANL-DPVDKFSKLRPLISKLNERCMKFVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKF-WCGATCLGYICWFQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHPGQYHFVF-NNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKKKERGTFDYRIDGKGNIVCR-WNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQVQQPNMIKVYNQFMGGVDRADENIDKYRASIRGKKWYSSPLLFCFELVLQNAWQLHKTYDEKPVDFLEFRRRVVCHYLETHGHP--------PEPGQKGRPQKRNIDSR--YDGINHVIVK---QGK----QTRCAECHKNTTFRCEKCDVALHVK 585          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 102.064 bits (253), Expect = 1.724e-21
Identity = 109/476 (22.90%), Postives = 201/476 (42.23%), Query Frame = 2
Query:  647 KTQMDVLKLFINDDF--LVIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQ-----------GLRLI-ETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKK-------IEAYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISS---IHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSA-CKVRSETCFICNFVK 1999
            +T  ++L+LF++D+   L+++ +  Y        + +KG+    +T  E K F+G+I   G V   RR  +      +        M R+RF  I+   H  DN ++ DP D+  K+RP+I+   E+       +   S DE ++P+ GR   + +  GK I++G        +  GYIC F+ Y  +           G  L+ +  + +   +   +H+++ +N++ S+     L     +  GT++K       +E+ +   K +    D     K +I+ + W     V++ SS   IH   +   ++     + ++ +PN +  YN++M GVDRAD+ +  Y    +  KW     ++     L N++ ++ +   K + +  F   +   +     H         P      R   R+   R   D   HVI K   +GK    Q +C  C      R E C +   VK
Sbjct:  608 RTPTEILELFLDDEVIELIVKYSNLY--------ACSKGVHL-GLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANL-DPVDKFSKLRPLISKLNERCMKFVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKF-WCGATCLGYICWFQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHPGQYHFVF-NNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKKKERGTFDYRIDGKGNIVCR-WNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQVQQPNMIKVYNQFMGGVDRADENIDKYRASIRGKKWYSSPLLFCFELVLQNAWQLHKTYDEKPVDFLEFRRRVVCHYLETHGHP--------PEPGQKGRPQKRNIDSRY--DGINHVIVK---QGK----QTRCAECHKNTTFRCEKCDVALHVK 1053          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Match: ERCC6 (ERCC excision repair 6, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:3438])

HSP 1 Score: 102.064 bits (253), Expect = 1.724e-21
Identity = 109/476 (22.90%), Postives = 201/476 (42.23%), Query Frame = 2
Query:  647 KTQMDVLKLFINDDF--LVIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQ-----------GLRLI-ETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKK-------IEAYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISS---IHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSA-CKVRSETCFICNFVK 1999
            +T  ++L+LF++D+   L+++ +  Y        + +KG+    +T  E K F+G+I   G V   RR  +      +        M R+RF  I+   H  DN ++ DP D+  K+RP+I+   E+       +   S DE ++P+ GR   + +  GK I++G        +  GYIC F+ Y  +           G  L+ +  + +   +   +H+++ +N++ S+     L     +  GT++K       +E+ +   K +    D     K +I+ + W     V++ SS   IH   +   ++     + ++ +PN +  YN++M GVDRAD+ +  Y    +  KW     ++     L N++ ++ +   K + +  F   +   +     H         P      R   R+   R   D   HVI K   +GK    Q +C  C      R E C +   VK
Sbjct:  608 RTPTEILELFLDDEVIELIVKYSNLY--------ACSKGVHL-GLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANL-DPVDKFSKLRPLISKLNERCMKFVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKF-WCGATCLGYICWFQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHPGQYHFVF-NNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKKKERGTFDYRIDGKGNIVCR-WNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQVQQPNMIKVYNQFMGGVDRADENIDKYRASIRGKKWYSSPLLFCFELVLQNAWQLHKTYDEKPVDFLEFRRRVVCHYLETHGHP--------PEPGQKGRPQKRNIDSRY--DGINHVIVK---QGK----QTRCAECHKNTTFRCEKCDVALHVK 1053          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Match: PGBD2 (piggyBac transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:19399])

HSP 1 Score: 87.4261 bits (215), Expect = 3.144e-17
Identity = 91/435 (20.92%), Postives = 184/435 (42.30%), Query Frame = 2
Query:  572 WSINDNPPVLEDFLGIPGITLNNPPKTQMDVLKLFIND---DFLVIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGL------RLIETIQTVVSPYTD-------IWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTDLQRR-------DTIFRRKNDILLQVWKSKKEVSLIS---SIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSF----VVYNSITTKKIKYKRFLYDIAFEWTSDSIHE 1786
            W+ +D  P +ED        L +   + + + +LF ++   +F+V E+N+Y +Q    L           +T  E+K  +G++   G +   RR  +  T P          + R+RF  I+   HF DN ++ D SDR  K+RP+I      F+     ++  S  E +  + G    +  + GK ++ G  +   + S  GY+  FE   +QG       R ++   ++V  + D       + ++++ D  + SV     L +K ++  GT+++        K   + +       D       +I++  W     V++ S    I    +   H+     R ++ +P+ +  Y + + GV R DQ ++ Y +  +  KW      Y+I+ AL N++    +         + ++R++  +  E  +D+  +
Sbjct:  124 WTASD--PHIED--------LKSQELSPVGLFELFFDEGTINFIVNETNRYAWQKNVNL----------SLTAQELKCVLGILILSGYISYPRRRMFWETSPDSHHHLVADAIRRDRFELIFSYLHFADNNEL-DASDRFAKVRPLIIRMNCNFQKHAPLEEFYSFGESMCEYFGHRGSKQLHRGKPVRLGYKIWCGTTS-RGYLVWFE--PSQGTLFTKPDRSLDLGGSMVIKFVDALQERGFLPYHIFFDKVFTSVKLMSILRKKGVKATGTVREYRTERCPLKDPKELKKMKRGSFDYKVDESEEIIVCRWHDSSVVNICSNAVGIEPVRLTSRHSGAAKTRTQVHQPSLVKLYQEKVGGVGRMDQNIAKYKVKIRGMKWYSSFIGYVIDAALNNAWQLHRICCQDAQVDLLAFRRYIACVYLESNADTTSQ 534          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: CABZ01069162.1 (pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSDARG00000115161.1 transcript:ENSDART00000191202.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01069162.1)

HSP 1 Score: 158.303 bits (399), Expect = 5.997e-40
Identity = 110/401 (27.43%), Postives = 186/401 (46.38%), Query Frame = 2
Query:  650 TQMDVLKLFINDDFL---VIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNED--------ITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQ------GLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKK-----IEAYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSA------EMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWT 1768
            + + + +LF     L   +  SN Y  +     + Q     WK+I++ ++K ++ L+ FMGL++     +Y     V   P   + MS  +F  I  A H +D  D         T   DRL KI+P+ ++  +  +  Y P Q +S+DE ++  + R   + Y   K  K+G  + +L++S  GY   F +Y  +      GL     +  +   Y    + LY+DN+Y S      LL K+I  CGTI+       +   N    D  R    + R++D+L   WK  +EV + S+ H A      E K   N  +     +  P A++DYN++M GVD +D  + YY +L KT KW +    + ++ A+ N+F+++  +   + K +R L   AF  T
Sbjct:  220 SPLQLFQLFFTPSVLQTIMQHSNAYATK-----QRQGTDKSWKNISVEDLKSYLALVIFMGLLKVCALTDYWRRSDVYSVPLPTRIMSCRKFLNIANALHLSDPVDDEANEGRKGTAAYDRLGKIKPLYDNIRDACRAFYHPGQNISIDERMVASKARSGLKQYMKNKPTKWGYKLFVLADSQCGYTSEFFVYEGKRMSSPNGLSYESVMALIDEKYLGTGYKLYVDNFYTSPKLFRDLLSKRIYACGTIRPNRIGFPKMATNKLPQDAPRGSMRWIREDDLLFVEWKDTREVLMCSTFHKAYGGDIVERKSKDNDGQWSTVHVPIPGAVLDYNRFMGGVDLSDALICYYKVLHKTRKWYRTFFYHFVDIAVVNAFILHQKLA--RAKKERPLTQKAFRET 613          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: si:dkey-19f4.2 (si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-262])

HSP 1 Score: 151.754 bits (382), Expect = 2.748e-38
Identity = 102/380 (26.84%), Postives = 190/380 (50.00%), Query Frame = 2
Query:  725 NIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHF--------NDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIY-------AAQGLRLIETIQTVVSP-YTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKI-----EAYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQK---------IIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSIT----TKKIKYKRFLYDIAFE 1762
            N ++  S+ K + W+ +T     K++GL+ +M L++  R  +Y   D  L   F    M+R+RF  I R  H         ND +  T   D L +++P+     +  K++++P++Q+++DE ++  + ++  + Y   K IK+G+ + +L++S  GY  +F IY       ++QGL   + +  ++ P +    ++LY+DN+Y S      L       CGT K       E   NA  +   R    + R+N +L   W   +EVS+ S+IH A   +   V R +  K         I  P  ++DYNKYM GVD +DQ L YY++ +++ +W + +  + I+ A  NS++++  +     T  + + +F+ +++ E
Sbjct:  150 NAEKELSKGKKLAWEKLTSDTFLKYIGLLIYMALLKLPRVRDYWRRDSHLSVHFPVSVMTRDRFMAISRTVHLSNPDDDIENDRKKGTPDYDPLYRLKPLYITIKDTCKSMWQPRKQIAIDERMVATKAKIALKQYMKAKPIKWGVKLFVLADSSNGYTSDFTIYTGKSRFTSSQGLPY-DVVSNLIDPSFLGRGYHLYVDNFYTSPKLFRDLYASGFVACGTFKDSRKNVRETKQNALTSRSPRGSIRWIRQNKLLFVKWMDTREVSVCSTIHKAF--DGDTVTRNVHDKETGSWQIKNIASPRCVVDYNKYMGGVDLSDQLLQYYSVHKRSNRWYRTLLYHFIDIAATNSYILHKEMCLAAQTVAMSHGQFMEELSRE 526          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 145.976 bits (367), Expect = 3.416e-36
Identity = 117/446 (26.23%), Postives = 205/446 (45.96%), Query Frame = 2
Query:  737 LKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHF--------NDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQ-------GLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMR-----------QKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLS--MDMRKHVIAKIESKGKNKFVQRQCRVCSACKVRSETCFICN 1990
            ++ + +  KWKDIT+ ++K F+ ++ +MG+V+     +Y     V   P+  K MSR +F  I  A H         ND +  T   D L KI+P+     +  K  + P Q +S+DE ++  + R     Y   +  K+G  + +L++S   Y  +F IY  +       G+     +  +        + L++DN+Y S      LL KKI  CGTI+     +N  +T+  R +  + R++ +L   WK K++V + S+ H A     +N D + R           ++   P A++DYNK+M GVD +D  + YY +L KT KW +    + ++ A+ N+F+++  +   K K ++ +    F        E +++E     A          PP R +       H+   I  KG + F +R+C++C+       TC  C 
Sbjct:  180 MRHEARKRKWKDITVADLKSFIAMVIYMGIVKCFNLQDYWRMSDVYSLPYPAKIMSRIKFLTISWALHLSDPKVDAENDKKRGTPQYDPLCKIKPLYQDIRDACKASFHPHQNISIDERMVASKARHGLIQY-ISEPTKWGYKLFVLADSLCAYTWDFFIYEGKVKTEQRKGISYDSVMALIDERVLGTGYKLFVDNFYTSPTLFRDLLSKKIGACGTIRPNR--INHTETEAPRGNIRWFREDGLLFVEWKDKRDVLMCSTFHKA-----YNGDYIKRNVKGKGSVWGVKEFPVPGAVLDYNKHMGGVDVSDALIGYYTVLHKTKKWYRSFFYHFVDIAVVNAFILHQQMA--KSKNQKAMTQKVFR-------ETLVAELAGIRAGY--------PPAREAAIASTDNHLPKYI--KGDSTFGRRKCKLCT--HKTPITCVTCQ 596          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: pgbd4 (piggyBac transposable element derived 4 [Source:ZFIN;Acc:ZDB-GENE-091204-417])

HSP 1 Score: 138.658 bits (348), Expect = 1.016e-33
Identity = 110/455 (24.18%), Postives = 206/455 (45.27%), Query Frame = 2
Query:  737 LKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHF--------NDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQ-------GLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMR-----------QKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVC-------------SACKVRSETCFI 1984
            ++ + +  KWKDIT+ ++K F+ ++ +MG+V+     +Y     V   P+  K MSR +F  I  A H         ND +  T   D L KI+P+     +  K  + P Q +S+DE ++  + R     Y   +  K+G  + +L++S   Y  +F IY  +       G+     +  +        + L++DN+Y S      LL KKI  CGTI+     +N  +T+  R +  + R++ +L   WK K++V + S+ H A     +N D + R           ++   P A++DYNKY  G D ++  + YY + R+T KW +    + ++ A+ N+F+++  +   K K ++ +   AF        E +I+E       S   +  + P     + + +++       G +   +R+C++C             + C V +  C++
Sbjct:  180 MRHEARKRKWKDITVADLKSFIAMVIYMGIVKCFNLQDYWRMSDVYSLPYPAKIMSRIKFLTISWALHLSDPKVDAENDKKRGTPQYDPLCKIKPLYQDIRDACKASFHPHQNISIDERMVASKARHGLIQY-ISEPTKWGYKLFVLADSLCAYTWDFFIYEGKVKTEQRKGISYDSVMALIDERVLGTGYKLFVDNFYTSPTLFRDLLSKKIGACGTIRPNR--INHTETEAPRGNIRWFREDGLLFVEWKDKRDVLMCSTFHKA-----YNGDYIKRNVKGKGSVWGVKEFPVPGAVLDYNKYKGGEDVSNALIGYYTVFRQTKKWYRSFFYHFVDIAIVNAFILHQQMA--KSKNQKAMTQKAFR-------ETLITE--LTGIGSASTSTPKAPVPTTGLHLPRYI------SGDSTVGRRKCKLCQLKTPMICATCDVALCLVSNRNCYV 609          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: CABZ01072083.2 (dual specificity phosphatase 26 [Source:NCBI gene;Acc:570815])

HSP 1 Score: 111.309 bits (277), Expect = 5.483e-25
Identity = 86/356 (24.16%), Postives = 157/356 (44.10%), Query Frame = 2
Query:  755 GIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFN--DNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAA----------QGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIE-----AYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSIT----TKKIKYKR-FLYDIA 1756
            G  WKD+   +++ F+G++  +G+ R    +     D VL  P F  TM+   F    R   F   D E      D+L  I  + + +VE+   +Y P Q +++D+ ++P+RGR  F++Y   K  KYGI +  + +S + Y  N +I+            Q +R++  + + +       H +  D  + S      LL++ I + GT +        A L+     +      F   + ++    +  K V ++S++H  + + S            KP  ++DYN    GVD  D+  S Y   RKT  W   +   M++ + +N+FV++  +      +K   +R FL D+ 
Sbjct:  154 GAAWKDLDWTDLQAFIGILILIGVYRSKHESVDSLWDGVLGRPIFRATMALYTFKSWSRVICFRKRDPEPGQKSGDKLAPILNVWDKWVERLPLMYNPGQNLTVDKCLVPFRGRCPFKIYMQCKPAKYGIQIWAVCDSKSSYAWNMQIHTGKPADGKAEEDQAMRVVLDMTSALE-----GHNITCDQSFTSYALGEELLRRNITMIGTTRLSNPELPPALLSVKGRAINSSKFAFTDTHTLVSYHPRKNKNVLVMSTLHRDDAENSDEQS--------KPQMILDYNSTRGGVDNFDKLTSTYTCQRKTLHWPMVIFFNMLDVSAYNAFVLWMDLNPSWEAQKTNRRRIFLQDLG 496          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: pbk (PDZ binding kinase [Source:Xenbase;Acc:XB-GENE-1017083])

HSP 1 Score: 217.238 bits (552), Expect = 5.156e-61
Identity = 150/489 (30.67%), Postives = 233/489 (47.65%), Query Frame = 2
Query:  593 PVLEDFLGIPGITLNNPPKTQMDVLKLFINDDFL---VIESNKYYYQNI--DRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPS----DRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRL------------IETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTD--LQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYN-SITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSACKVRSETCFIC 1987
            P +  F  +PGI+++      +D   L+I +  L   V  +N Y  Q +  + L   ++   W    I E+K+F+ L   MGLV ++    Y  T+ VL  P F   M RNR+  + R  HFNDN     P+    DRL K+RP+I+   ++F  +Y P Q V +DE ++ ++GRL FR Y   K  +YG+    L ES TGY   F +Y  +   L             + +  +++P     ++LY+DN+Y S+    AL       CGT+ +    L     D  L+R +    R N++L   +   K V ++++IH   M   H      R    KP    +Y+K+M GVD++DQ   YYN  RKT  W K+ A+YMI  AL+NS+VVY  ++   ++ Y  +L  +        + EEV               P  D   R+   + KH IA+I    K  + QR+C+VC +  VR +  + C
Sbjct:  100 PEIPPFTAVPGISVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLASYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHALRSNELLAIKYSDTKVVFMLTTIHDETMIVQHRSGG--RPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYKAAVPGPRLSYYNYLLQLLPSLLFGDV-EEV------------PDMPGNDNVARM---VGKHFIAQIPPTPKKTYAQRKCKVCRSKGVRRDVRYYC 570          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: ENSXETT00000019443.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:30938263:30940062:1 gene:ENSXETG00000007374.1 transcript:ENSXETT00000019443.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 215.698 bits (548), Expect = 1.840e-60
Identity = 149/489 (30.47%), Postives = 233/489 (47.65%), Query Frame = 2
Query:  593 PVLEDFLGIPGITLNNPPKTQMDVLKLFINDDFL---VIESNKYYYQNI--DRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPS----DRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRL------------IETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTD--LQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYN-SITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSACKVRSETCFIC 1987
            P +  F  +PG++++      +D   L+I +  L   V  +N Y  Q +  + L   ++   W    I E+K+F+ L   MGLV ++    Y  T+ VL  P F   M RNR+  + R  HFNDN     P+    DRL K+RP+I+   ++F  +Y P Q V +DE ++ ++GRL FR Y   K  +YG+    L ES TGY   F +Y  +   L             + +  +++P     ++LY+DN+Y S+    AL       CGT+ +    L     D  L+R +    R N++L   +   K V ++++IH   M   H      R    KP    +Y+K+M GVD++DQ   YYN  RKT  W K+ A+YMI  AL+NS+VVY  ++   ++ Y  +L  +        + EEV               P  D   R+   + KH IA+I    K  + QR+C+VC +  VR +  + C
Sbjct:  100 PEIPPFTAVPGLSVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLASYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHALRSNELLAIKYSDTKVVFMLTTIHDETMIVQHRSGG--RPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYKAAVPGPRLSYYNYLLQLLPSLLFGDV-EEV------------PDMPGNDNVARM---VGKHFIAQIPPTPKKTYAQRKCKVCRSKGVRRDVRYYC 570          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: ENSXETT00000047457.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:68625695:68627807:-1 gene:ENSXETG00000017237.1 transcript:ENSXETT00000047457.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 215.698 bits (548), Expect = 3.161e-60
Identity = 149/489 (30.47%), Postives = 233/489 (47.65%), Query Frame = 2
Query:  593 PVLEDFLGIPGITLNNPPKTQMDVLKLFINDDFL---VIESNKYYYQNI--DRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPS----DRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRL------------IETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTD--LQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYN-SITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSACKVRSETCFIC 1987
            P +  F  +PG++++      +D   L+I +  L   V  +N Y  Q +  + L   ++   W    I E+K+F+ L   MGLV ++    Y  T+ VL  P F   M RNR+  + R  HFNDN     P+    DRL K+RP+I+   ++F  +Y P Q V +DE ++ ++GRL FR Y   K  +YG+    L ES TGY   F +Y  +   L             + +  +++P     ++LY+DN+Y S+    AL       CGT+ +    L     D  L+R +    R N++L   +   K V ++++IH   M   H      R    KP    +Y+K+M GVD++DQ   YYN  RKT  W K+ A+YMI  AL+NS+VVY  ++   ++ Y  +L  +        + EEV               P  D   R+   + KH IA+I    K  + QR+C+VC +  VR +  + C
Sbjct:  100 PEIPPFTAVPGLSVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLASYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYRSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHALRSNELLAIKYSDTKVVFMLTTIHDETMIVQHRSGG--RPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYKAAVPGPRLSYYNYLLQLLPSLLFGDV-EEV------------PDMPGNDNVARM---VGKHFIAQIPPTPKKTYAQRKCKVCRSKGVRRDVRYYC 570          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: ENSXETT00000004705.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:109335122:109336807:1 gene:ENSXETG00000000186.1 transcript:ENSXETT00000004705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.904 bits (507), Expect = 4.665e-55
Identity = 127/395 (32.15%), Postives = 196/395 (49.62%), Query Frame = 2
Query:  593 PVLEDFLGIPGITLNNPPKTQMDVLKLFINDDFL---VIESNKYYYQNI--DRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPS----DRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRL------------IETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTD--LQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNS 1708
            P +  F  +PG++++      +D   L+I +  L   V  +N Y  Q +  + L   ++   W    I E+K+F+ L   MGLV ++    Y  T+ VL  P F   M+RNR+  + R  HFNDN     P+    DRL K+RP+I+   ++F  +Y P Q V +DE ++ ++GRL FR Y   K  +YGI    L ES TGY   F +Y  +   L             + +  +++P     ++LY+DN+Y  +    AL       CGT+ +    L     D  L+R +    R N++L   +   K V ++++IH   M   H      R    KP    +Y+K+M GVD++DQ   YYN  RKT  W K+ A+YMI  AL+NS+VVY +
Sbjct:  100 PEIPPFTAVPGLSVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLASYWDTNTVLSIPLFSAVMARNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGIKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTGIPLFRALNSLDTPACGTVHRNRKGLPRELLDKKLKRGEVHALRSNELLAIKYSDTKVVLMLTTIHDETMIVQHRSGG--RPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYKA 492          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: sin3b (SIN3 transcription regulator family member B [Source:Xenbase;Acc:XB-GENE-480338])

HSP 1 Score: 199.904 bits (507), Expect = 4.891e-55
Identity = 128/395 (32.41%), Postives = 196/395 (49.62%), Query Frame = 2
Query:  593 PVLEDFLGIPGITLNNPPKTQMDVLKLFINDDFL---VIESNKYYYQNI--DRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPS----DRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRL------------IETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTD--LQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNS 1708
            P +  F  +PGI+++      +D   L+I +  L   V  +N Y  Q +  + L   ++   W    I E+K+F+ L   MGLV ++    Y  T+ VL  P F   M RNR+  + R  HFNDN     P+    DRL K+RP+I+   ++F  +Y P Q V +DE ++ ++GRL FR Y   K  +YG+    L ES TGY   F +Y  +   L             + +  +++P     ++LY+DN+Y S+    AL       CGT+ +    L     D  L+R +    R N++L   +   K V ++++IH   M   H      R    KP    +Y+K+M GVD++DQ   YYN  RKT  W K+ A+YMI  AL+NS+VVY +
Sbjct:  100 PEIPPFTAVPGISVDTTNFEIIDFFNLYITEAILQDMVRYTNLYAEQYLASNPLPGFSRAQAWYPTNINEIKRFLALTLAMGLVERNSLASYWDTNTVLSIPLFSAVMPRNRYQILLRFLHFNDNTTAVAPNEPGYDRLYKLRPLIDSLSQRFAEVYTPSQNVCVDESLLLFKGRLKFRQYIPSKRSRYGMKFYKLCESSTGYTSYFMLYEGKDTNLDPPGCPTDLTTSGKIVWELITPLLGRGYHLYVDNFYTSIPLFRALNSLDTPACGTVNRNRKGLPRELLDKKLKRGEVHALRSNELLAIKYSDTKVVFMLTTIHDETMIVQHRSGG--RPSKTKPLCSKEYSKHMGGVDKSDQIQHYYNATRKTRAWYKKAAIYMIQMALYNSYVVYKA 492          
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Match: sp|Q96DM1|PGBD4_HUMAN (PiggyBac transposable element-derived protein 4 OS=Homo sapiens OX=9606 GN=PGBD4 PE=2 SV=3)

HSP 1 Score: 155.992 bits (393), Expect = 1.014e-38
Identity = 123/498 (24.70%), Postives = 234/498 (46.99%), Query Frame = 2
Query:  605 DFLGIPGITLNNPPKTQ-MDVLKLFINDDFLVIESNKYYYQNIDRLKSQTKGIK-------WKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDR----LEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRLIET---------IQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYL-NA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTK-WTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRD--PPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSAC------KVRSETCFICNFVKFP 2005
            DF G PG  ++    T  +   +LF  ++ LV +  +        L S+  G K       WKD    E+K F  ++   G+V+K     + +T P+L+TP+  + M+  RF  ++R  HF +N  I+    +    L+KI+P+ +  V KF  +Y P + +++DE ++ ++G L  + Y   K +++G+ + +L ES +GY+ N  ++   G+ L ++         + T+V+      + +++DN+  S      L Q +    GT +     + N  K  + +  T+ R   +++   W   KEV+++S+ H+  + E +N +    +K  +P  ++DYN+ M  VD ADQ L+ Y   RK  K W K+   ++++  + NS++++     KK   +  +  I F     ++ E ++ +   P     +  P  D   P RLS    +H    I +    +    +C++C +       K+R ET + C     P
Sbjct:   87 DFTGTPGRKVDVSDITDPLQYFELFFTEE-LVSKITRETNAQAALLASKPPGPKGFSRMDKWKDTDNDELKVFFAVMLLQGIVQKPELEMFWSTRPLLDTPYLRQIMTGERFLLLFRCLHFVNNSSISAGQSKAQISLQKIKPVFDFLVNKFSTVYTPNRNIAVDESLMLFKGPLAMKQYLPTKRVRFGLKLYVLCESQSGYVWNALVHTGPGMNLKDSADGLKSSRIVLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKRIAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIEVNNRN---GKKTKRPRVIVDYNENMGAVDSADQMLTSYPSERKRHKVWYKKFFHHLLHITVLNSYILF-----KKDNPEHTMSHINFRL---ALIERMLEKHHKPGQQHLRGRPCSDDVTPLRLS---GRHFPKSIPATSGKQNPTGRCKICCSQYDKDGKKIRKETRYFCAECDVP 569          
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Match: sp|Q8N328|PGBD3_HUMAN (PiggyBac transposable element-derived protein 3 OS=Homo sapiens OX=9606 GN=PGBD3 PE=1 SV=3)

HSP 1 Score: 105.531 bits (262), Expect = 3.263e-22
Identity = 112/474 (23.63%), Postives = 200/474 (42.19%), Query Frame = 2
Query:  647 KTQMDVLKLFINDDFLVIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQ-----------GLRLI-ETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKK-------IEAYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISS---IHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSA-CKVRSETCFICNFVK 1999
            +T  ++L+LF++D+  VIE    Y      L + +KG+    +T  E K F+G+I   G V   RR  +      +        M R+RF  I+   H  DN ++ DP D+  K+RP+I+   E+       +   S DE ++P+ GR   + +  GK I++G        +  GYIC F+ Y  +           G  L+ +  + +   +   +H+++ +N++ S+     L     +  GT++K       +E+ +   K +    D     K +I+ + W     V++ SS   IH   +   ++     + ++ +PN +  YN++M GVDRAD+ +  Y    +  KW     ++     L N++ ++ +   K + +  F   +   +     H         P      R   R+   R   D   HVI K   +GK    Q +C  C      R E C +   VK
Sbjct:  140 RTPTEILELFLDDE--VIELIVKY----SNLYACSKGVHL-GLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANL-DPVDKFSKLRPLISKLNERCMKFVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKF-WCGATCLGYICWFQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHPGQYHFVF-NNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKKKERGTFDYRIDGKGNIVCR-WNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQVQQPNMIKVYNQFMGGVDRADENIDKYRASIRGKKWYSSPLLFCFELVLQNAWQLHKTYDEKPVDFLEFRRRVVCHYLETHGHP--------PEPGQKGRPQKRNIDSR--YDGINHVIVK---QGK----QTRCAECHKNTTFRCEKCDVALHVK 585          
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Match: sp|P0DP91|ERPG3_HUMAN (Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 8.278e-21
Identity = 109/476 (22.90%), Postives = 201/476 (42.23%), Query Frame = 2
Query:  647 KTQMDVLKLFINDDF--LVIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQ-----------GLRLI-ETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKK-------IEAYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISS---IHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSA-CKVRSETCFICNFVK 1999
            +T  ++L+LF++D+   L+++ +  Y        + +KG+    +T  E K F+G+I   G V   RR  +      +        M R+RF  I+   H  DN ++ DP D+  K+RP+I+   E+       +   S DE ++P+ GR   + +  GK I++G        +  GYIC F+ Y  +           G  L+ +  + +   +   +H+++ +N++ S+     L     +  GT++K       +E+ +   K +    D     K +I+ + W     V++ SS   IH   +   ++     + ++ +PN +  YN++M GVDRAD+ +  Y    +  KW     ++     L N++ ++ +   K + +  F   +   +     H         P      R   R+   R   D   HVI K   +GK    Q +C  C      R E C +   VK
Sbjct:  608 RTPTEILELFLDDEVIELIVKYSNLY--------ACSKGVHL-GLTSSEFKCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANL-DPVDKFSKLRPLISKLNERCMKFVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKF-WCGATCLGYICWFQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHPGQYHFVF-NNFFTSIALLDKLSSMGHQATGTVRKDHIDRVPLESDVALKKKERGTFDYRIDGKGNIVCR-WNDNSVVTVASSGAGIHPLCLVSRYSQKLKKKIQVQQPNMIKVYNQFMGGVDRADENIDKYRASIRGKKWYSSPLLFCFELVLQNAWQLHKTYDEKPVDFLEFRRRVVCHYLETHGHP--------PEPGQKGRPQKRNIDSRY--DGINHVIVK---QGK----QTRCAECHKNTTFRCEKCDVALHVK 1053          
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Match: sp|Q6P3X8|PGBD2_HUMAN (PiggyBac transposable element-derived protein 2 OS=Homo sapiens OX=9606 GN=PGBD2 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.510e-16
Identity = 91/435 (20.92%), Postives = 184/435 (42.30%), Query Frame = 2
Query:  572 WSINDNPPVLEDFLGIPGITLNNPPKTQMDVLKLFIND---DFLVIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGL------RLIETIQTVVSPYTD-------IWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTDLQRR-------DTIFRRKNDILLQVWKSKKEVSLIS---SIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSF----VVYNSITTKKIKYKRFLYDIAFEWTSDSIHE 1786
            W+ +D  P +ED        L +   + + + +LF ++   +F+V E+N+Y +Q    L           +T  E+K  +G++   G +   RR  +  T P          + R+RF  I+   HF DN ++ D SDR  K+RP+I      F+     ++  S  E +  + G    +  + GK ++ G  +   + S  GY+  FE   +QG       R ++   ++V  + D       + ++++ D  + SV     L +K ++  GT+++        K   + +       D       +I++  W     V++ S    I    +   H+     R ++ +P+ +  Y + + GV R DQ ++ Y +  +  KW      Y+I+ AL N++    +         + ++R++  +  E  +D+  +
Sbjct:  124 WTASD--PHIED--------LKSQELSPVGLFELFFDEGTINFIVNETNRYAWQKNVNL----------SLTAQELKCVLGILILSGYISYPRRRMFWETSPDSHHHLVADAIRRDRFELIFSYLHFADNNEL-DASDRFAKVRPLIIRMNCNFQKHAPLEEFYSFGESMCEYFGHRGSKQLHRGKPVRLGYKIWCGTTS-RGYLVWFE--PSQGTLFTKPDRSLDLGGSMVIKFVDALQERGFLPYHIFFDKVFTSVKLMSILRKKGVKATGTVREYRTERCPLKDPKELKKMKRGSFDYKVDESEEIIVCRWHDSSVVNICSNAVGIEPVRLTSRHSGAAKTRTQVHQPSLVKLYQEKVGGVGRMDQNIAKYKVKIRGMKWYSSFIGYVIDAALNNAWQLHRICCQDAQVDLLAFRRYIACVYLESNADTTSQ 534          
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Match: sp|Q96JS3|PGBD1_HUMAN (PiggyBac transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=PGBD1 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.453e-14
Identity = 91/400 (22.75%), Postives = 167/400 (41.75%), Query Frame = 2
Query:  656 MDVLKLFINDD---FLVIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQV-SLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQ-------------GLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEA----YLNA*KTDLQRR---DTIFRRKNDILLQVWKSKKEVSLIS---SIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSI----TTKKIKYKRFLYDIAFE 1762
            +++ +LF +D+    +V E+N Y  Q    L          ++T+ EM+   G++   G +R  RR  Y       +       + R+RF  I+   HF DN  + D  D+  K+RP+I    + F  +Y P ++    D+ +        F     GK I+ G  +     +  GY+  FE Y  +             G  L+     V+       ++L  D+++ SV    AL +K +R  GTI++        +N       +R   D      N+I+L  W     +SL S    I         + D     +I +P+ +  Y++  +GV + DQ +S Y +  ++ KW   +  YMI+ A+ N++ ++ +     +   + ++RF+     E
Sbjct:  420 VELFELFFDDETFNLIVNETNNYASQKNVSL----------EVTVQEMRCVFGVLLLSGFMRHPRREMYWEVSDTDQN-LVRDAIRRDRFELIFSNLHFADNGHL-DQKDKFTKLRPLIKQMNKNFL-LYAPLEEYYCFDKSMCECFDSDQFL---NGKPIRIGYKI-WCGTTTQGYLVWFEPYQEESTMKVDEDPDLGLGGNLVMNFADVLLERGQYPYHLCFDSFFTSVKLLSALKKKGVRATGTIRENRTEKCPLMNVEHMKKMKRGYFDFRIEENNEIILCRWYGDGIISLCSNAVGIEPVNEVSCCDADNEEIPQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYSILVSYMIDVAMNNAWQLHRACNPGASLDPLDFRRFVAHFYLE 802          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4Y2L0H4 (PiggyBac transposable element-derived protein 4 OS=Araneus ventricosus OX=182803 GN=PGBD4_606 PE=4 SV=1)

HSP 1 Score: 470.7 bits (1210), Expect = 2.030e-154
Identity = 248/491 (50.51%), Postives = 326/491 (66.40%), Query Frame = 2
Query:  554 EEEVDGWSINDNPPVLEDFLGIPGI-TLNNPPKTQMDVLKLFINDDFL---VIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KT-DLQRRDTIFRRKNDILLQVW-KSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSR-DPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSACKVRSETCFICNFVKFP 2005
            E+  D WS ND   +LE F G  G+  + +  ++ MD++ LFI  D +   V ESN+Y+YQ +++ +  +K  KWKD+T+ EMKKF+GLI FMG V+KD   +Y +TDP +ETPFF K MSRNRF QI ++WHF +N DI+  S RL K++P+I++F EKF N+YKP QQ+SLDE +IPWRGRL  + YN  KI KYGILVR+LSE+ TGY+ NF +YAA G +L ET+ +V+ PY ++WH++Y DNYYNSV+     L+ K+R+CGTI+K        +T  L R    F R  +ILLQVW   K+ V++IS+IHSA+M ES N  R     I KP ++IDYNKYMKGVDRADQYLSYY+I RKT KWTKRV M+ INCALFNSF VY ++  +KI YK FL+  A     D   EE   + P    S   R  SR D PGRL+ +  KH +  I + G+ K   RQCRVC++ K  S T F C +   P
Sbjct:   61 EDNNDTWSTNDKSIILEPFEGSSGVKIMPSSSESVMDIVNLFIGSDLIEHFVRESNRYHYQIVEKYRITSKMKKWKDVTVTEMKKFLGLIIFMGQVKKDILYDYWSTDPSIETPFFSKVMSRNRFLQIMQSWHFCNNNDISPNSHRLVKVQPVIDYFKEKFNNVYKPDQQLSLDECVIPWRGRLSIKTYNPAKITKYGILVRVLSEARTGYVSNFCVYAADGKKLEETVLSVIGPYKNMWHHIYQDNYYNSVNIAKIFLKNKLRLCGTIRKNRGLPQILQTVKLSRGQHQFLRNGNILLQVWNNGKRNVNMISTIHSAQMVESRNRSRTSHCPIQKPISIIDYNKYMKGVDRADQYLSYYSIFRKTKKWTKRVVMFFINCALFNSFKVYTTLNGQKITYKNFLHKAALSLIEDCETEEQGKDLP---NSEPTRTTSRFDHPGRLA-NFGKHKLVNIVTSGQCKKPLRQCRVCASKKKLSRTGFACKYCNVP 547          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4Y2QJF8 (PiggyBac transposable element-derived protein 4 OS=Araneus ventricosus OX=182803 GN=PGBD4_386 PE=4 SV=1)

HSP 1 Score: 468.774 bits (1205), Expect = 1.203e-153
Identity = 247/491 (50.31%), Postives = 325/491 (66.19%), Query Frame = 2
Query:  554 EEEVDGWSINDNPPVLEDFLGIPGI-TLNNPPKTQMDVLKLFINDDFL---VIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KT-DLQRRDTIFRRKNDILLQVW-KSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSR-DPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSACKVRSETCFICNFVKFP 2005
            E+  D WS ND   +LE F G  G+  + +  ++ MD++ LFI  D +   V ESN+Y+YQ +++ +  +K  KWKD+T+ EMKKF+GLI  MG V+KD   +Y +TDP +ETPFF K MSRNRF QI ++WHF +N DI+  S RL K++P+I++F EKF N+YKP QQ+SLDE +IPWRGRL  + YN  KI KYGILVR+LSE+ TGY+ NF +YAA G +L ET+ +V+ PY ++WH++Y DNYYNSV+     L+ K+R+CGTI+K        +T  L R    F R  +ILLQVW   K+ V++IS+IHSA+M ES N  R     I KP ++IDYNKYMKGVDRADQYLSYY+I RKT KWTKRV M+ INCALFNSF VY ++  +KI YK FL+  A     D   EE   + P    S   R  SR D PGRL+ +  KH +  I + G+ K   RQCRVC++ K  S T F C +   P
Sbjct:   61 EDNNDTWSTNDKSIILEPFEGSSGVKIMPSSSESVMDIVNLFIGSDLIEHFVRESNRYHYQIVEKYRITSKTKKWKDVTVTEMKKFLGLIILMGQVKKDILYDYWSTDPSIETPFFSKVMSRNRFLQIMQSWHFCNNNDISPNSHRLVKVQPVIDYFKEKFNNVYKPDQQLSLDECVIPWRGRLSIKTYNPAKITKYGILVRVLSEARTGYVSNFCVYAADGKKLEETVLSVIGPYKNMWHHIYQDNYYNSVNIAKIFLKNKLRLCGTIRKNRGLPQILQTVKLSRGQHQFLRNGNILLQVWNNGKRNVNMISTIHSAQMVESRNRSRTSHCPIQKPISIIDYNKYMKGVDRADQYLSYYSIFRKTKKWTKRVVMFFINCALFNSFKVYTTLNGQKITYKNFLHKAALSLIEDCETEEQGKDLP---NSEPTRTTSRFDHPGRLA-NFGKHKLVNIVTSGQCKKPLRQCRVCASKKKLSRTGFACKYCNVP 547          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4Y2HLZ0 (PiggyBac transposable element-derived protein 4 OS=Araneus ventricosus OX=182803 GN=PGBD4_504 PE=4 SV=1)

HSP 1 Score: 468.774 bits (1205), Expect = 1.326e-153
Identity = 247/491 (50.31%), Postives = 325/491 (66.19%), Query Frame = 2
Query:  554 EEEVDGWSINDNPPVLEDFLGIPGI-TLNNPPKTQMDVLKLFINDDFL---VIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KT-DLQRRDTIFRRKNDILLQVW-KSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSR-DPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSACKVRSETCFICNFVKFP 2005
            E+  D WS ND   +LE F G  G+  + +  ++ MD++ LFI  D +   V ESN+Y+YQ +++ +  +K  KWKD+T+ EMKKF+GLI  MG V+KD   +Y +TDP +ETPFF K MSRNRF QI ++WHF +N DI+  S RL K++P+I++F EKF N+YKP QQ+SLDE +IPWRGRL  + YN  KI KYGILVR+LSE+ TGY+ NF +YAA G +L ET+ +V+ PY ++WH++Y DNYYNSV+     L+ K+R+CGTI+K        +T  L R    F R  +ILLQVW   K+ V++IS+IHSA+M ES N  R     I KP ++IDYNKYMKGVDRADQYLSYY+I RKT KWTKRV M+ INCALFNSF VY ++  +KI YK FL+  A     D   EE   + P    S   R  SR D PGRL+ +  KH +  I + G+ K   RQCRVC++ K  S T F C +   P
Sbjct:   61 EDNNDTWSTNDKSIILEPFEGSSGVKIMPSSSESVMDIVNLFIGSDLIEHFVRESNRYHYQIVEKYRITSKTKKWKDVTVTEMKKFLGLIILMGQVKKDILYDYWSTDPSIETPFFSKVMSRNRFLQIMQSWHFCNNNDISPNSHRLVKVQPVIDYFKEKFNNVYKPDQQLSLDECVIPWRGRLSIKTYNPAKITKYGILVRVLSEARTGYVSNFCVYAADGKKLEETVLSVIGPYKNMWHHIYQDNYYNSVNIAKIFLKNKLRLCGTIRKNRGLPQILQTVKLSRGQHQFLRNGNILLQVWNNGKRNVNMISTIHSAQMVESRNRSRTSHCPIQKPISIIDYNKYMKGVDRADQYLSYYSIFRKTKKWTKRVVMFFINCALFNSFKVYTTLNGQKITYKNFLHKAALSLIEDCETEEQGKDLP---NSEPTRTTSRFDHPGRLA-NFGKHKLVNIVTSGQCKKPLRQCRVCASKKKLSRTGFACKYCNVP 547          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4Y2QCV4 (PiggyBac transposable element-derived protein 4 OS=Araneus ventricosus OX=182803 GN=PGBD4_139 PE=4 SV=1)

HSP 1 Score: 464.537 bits (1194), Expect = 5.966e-152
Identity = 246/491 (50.10%), Postives = 324/491 (65.99%), Query Frame = 2
Query:  554 EEEVDGWSINDNPPVLEDFLGIPGI-TLNNPPKTQMDVLKLFINDDFL---VIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KT-DLQRRDTIFRRKNDILLQVW-KSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSR-DPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSACKVRSETCFICNFVKFP 2005
            E+  D WS ND   +LE F G  G+  + +  ++ MD++ LFI  D +   V ESN+Y+YQ +++ +  +K  KWKD+T+ EMKKF+GLI  MG V+KD   +Y +TDP +ETPFF K MSRNRF QI ++WHF +N DI+  S RL K++P+I++F EKF N+YKP QQ+SLDE +IPWRGRL  + YN  KI KYGILVR+LSE+ TGY+ NF +YAA G +L ET+ +V+ PY ++WH++Y DNYYNSV+     L+ K+R+CGTI+K        +T  L R    F R  +ILLQVW   K+ V++IS+IHSA+M  S N  R     I KP ++IDYNKYMKGVDRADQYLSYY+I RKT KWTKRV M+ INCALFNSF VY ++  +KI YK FL+  A     D   EE   + P    S   R  SR D PGRL+ +  KH +  I + G+ K   RQCRVC++ K  S T F C +   P
Sbjct:   61 EDNNDTWSTNDKSIILEPFEGSSGVKIMPSSSESVMDIVNLFIGSDLIEHFVRESNRYHYQIVEKYRITSKTKKWKDVTVTEMKKFLGLIILMGQVKKDILYDYWSTDPSIETPFFSKVMSRNRFLQIMQSWHFCNNNDISPNSHRLVKVQPVIDYFKEKFNNVYKPDQQLSLDECVIPWRGRLSIKTYNPAKITKYGILVRVLSEARTGYVSNFCVYAADGKKLEETVLSVIGPYKNMWHHIYQDNYYNSVNIAKIFLKNKLRLCGTIRKNRGLPQILQTVKLSRGLHQFLRNGNILLQVWNNGKRNVNMISTIHSAQMVVSRNRSRTSHCPIQKPISIIDYNKYMKGVDRADQYLSYYSIFRKTKKWTKRVVMFFINCALFNSFKVYTTLNGQKITYKNFLHKAALSLIEDCETEEQGKDLP---NSEPTRTTSRFDHPGRLA-NFGKHKLVNIVTSGQCKKPLRQCRVCASKKKLSRTGFACKYCNVP 547          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A4Y2J6B7 (PiggyBac transposable element-derived protein 4 OS=Araneus ventricosus OX=182803 GN=PGBD4_143 PE=4 SV=1)

HSP 1 Score: 460.299 bits (1183), Expect = 2.739e-150
Identity = 246/491 (50.10%), Postives = 323/491 (65.78%), Query Frame = 2
Query:  554 EEEVDGWSINDNPPVLEDFLGIPGI-TLNNPPKTQMDVLKLFINDDFL---VIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KT-DLQRRDTIFRRKNDILLQVW-KSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSR-DPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSACKVRSETCFICNFVKFP 2005
            E+  D WS ND   +LE F G  G+  + +  ++ MD+  LFI  D +   V ESN+Y+YQ +++ +  +K  KWKD+T+ EMKKF+GLI  MG V+KD   +Y +TDP +ETPFF K MSRNRF QI ++WHF +N DI+  S RL K++P+I++F EKF N+YKP QQ+SLDE +IPWR RL  + YN  KI KYGILVR+LSE+ TGY+ NF +YAA G +L ET+ +V+ PY ++WH++Y DNYYNSV+     L+ K+R+CGTI+K        +T  L R    F R  +ILLQVW   K+ V++IS+IHSA+M ES N  R     I KP ++IDYNKYMKGVDRADQYLSYY+I RK TKWTKRV M+ INCALFNSF VY ++  +KI YK FL+  A     D   EE   + P    S   R  SR D PGRL+ +  KH +  I + G+ K   RQCRVC++ K  S T F C +   P
Sbjct:   61 EDNNDTWSTNDKSIILEPFEGSSGVKIMPSSSESVMDIANLFIGSDLIEHFVRESNRYHYQIVEKYRITSKTKKWKDVTVTEMKKFLGLIILMGQVKKDILYDYWSTDPSIETPFFSKVMSRNRFLQIMQSWHFCNNNDISPNSHRLVKVQPVIDYFKEKFNNVYKPDQQLSLDECVIPWRDRLSIKTYNPAKITKYGILVRVLSEARTGYVSNFCVYAADGKKLEETVLSVIGPYKNMWHHIYQDNYYNSVNIAKIFLKNKLRLCGTIRKNRGLPQILQTVKLSRGQHQFLRNGNILLQVWNNGKRNVNMISTIHSAQMVESRNRSRTSHCPIQKPISIIDYNKYMKGVDRADQYLSYYSIFRK-TKWTKRVVMFFINCALFNSFKVYTTLNGQKITYKNFLHKAALSLIEDCETEEQGKDLP---NSEPTRTTSRFDHPGRLA-NFGKHKLVNIVTSGQCKKPLRQCRVCASKKKLSRTGFACKYCNVP 546          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000057483.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:107197084])

HSP 1 Score: 163.696 bits (413), Expect = 5.377e-42
Identity = 127/503 (25.25%), Postives = 234/503 (46.52%), Query Frame = 2
Query:  620 PGITLN-NPPKTQMDVLKLFINDDF---LVIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFND------NEDI-TDPS-DRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIY-------AAQGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKI-----EAYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMR--------QKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSIT----TKKIKYKRFLYDIAFEWT-----SDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSACKVRSETCFICNFVKFP 2005
            PG+ L+     +  ++ +LF + +    L I +NKY      R   +    +WKD+   EM  F+ +I +MGL++     +    D +   PF    M+  R+  I    H +D      N+ +  +P  D L +++P+    +   +  Y+P Q +S+DE ++  + R+  + Y   K  K+G ++ +L++S +GY CNF +Y       + +GL     +  +  P     + +Y+DN+Y S      L +     CGTI++      +  +NA   D  R D  + R   +L   W+  ++V++ S++H A   +S  V R +R        Q+I  P  +  YNK+M GVD +D  + YY++ +KT +W  ++ ++ ++ A+ NSF+++  +      K +  K F   +  E         SI  EV SE    S+SS  +     P G   +      ++++ ++ + K  Q + R C  CK++  T F+C     P
Sbjct:  142 PGVQLDFQTDYSASEIFQLFFSKEVIRTLCINTNKY----AARRSEEGMKKQWKDVNADEMLHFLSIIIYMGLLKPSAVRDLWRKDRLHSHPFPASVMAGYRYGDIAAYLHMSDPDSDAKNDQLRGEPEYDGLFRLKPLQEQILSACRAYYQPHQNLSIDERMVATKARIGMKQYMKNKPTKWGYMLFVLADSSSGYTCNFSVYEGKARKPSGKGLSFDAVVSLLHVPSLGTGYTVYVDNFYTSSLLFHHLHRIGFGACGTIRETRIGFPKTTVNALPKDANRGDMRWIRDGSLLFVKWRDTRDVTVCSTVHKAYSGQS--VQRRIRIKNGTWSTQQIPVPEPVKAYNKFMGGVDLSDALIKYYSVTQKTRRWYVKLFLHFVDIAVVNSFIIHKEMALARKQKPLSQKSFREVLCMELADVGQPQVSIPAEVPSET---SSSSVPQDKELKPKGCFPVP-----VSEVSAENRMKATQGR-RKCVQCKMK--TAFMCRSCSTP 627          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000020723.2 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:103038461])

HSP 1 Score: 162.54 bits (410), Expect = 1.372e-41
Identity = 125/467 (26.77%), Postives = 221/467 (47.32%), Query Frame = 2
Query:  560 EVDGWSINDN---PPVLEDF--LGIPGITLNNPPK-TQMDVLKLFINDDFLVI---ESNKYYYQNIDRLKSQTKGIK--WKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFND-NEDI-------TDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIY-------AAQGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKI-----EAYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMR--------QKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKK----IKYKRF-------LYDIAFE-WTSDSIHEEVISEDP 1807
            E D W   D     P+L  F     PG+ L++  + T + + +LF++   ++     +NKY  Q       Q KGIK  W  +T  EM +F+ ++ + GLV+     +    D +   PF    ++  R+  I+   H +D  ED+       T   DRL ++RP+++      K  Y+P Q +S+DE ++  + R+ F+ Y   K IK+G  + +L++S  GY C F IY       + +GL     +  + +      +++Y+DN+Y S      L   +   CGTI++      +   NA      R D  + R+  +L   W   +EV++ S+IH A    +  V R ++        Q +  P  +  YN+YM GVD +D  + Y+++ +KT KW K++ ++ ++ A+ NS+V++  ++  K    +  K+F       L D+  E  T  +  E  I E+P
Sbjct:  100 EQDRWRSRDEEDVTPILHPFSPARTPGVQLDSHQQYTPLQLFQLFMSSSTIITLCQNTNKYAAQR------QEKGIKTPWHPVTDMEMYQFLSVVIYCGLVKPSTVRDLWRKDRLHTFPFPASVIAGYRYEAIFWNLHMSDIEEDVKNDGLKGTSKHDRLGRLRPLMDDIQIACKAYYQPDQNLSIDERMVATKSRIGFKQYMRDKPIKWGFKLFVLADSKNGYTCGFNIYQGRSPSPSGKGLGYDAVMDLLSAASVGTGYHIYVDNFYTSSTLFCELHNMRFEACGTIRESCVGYPKHKENALPKKASRGDIRWIREGPLLYVKWMDTREVTVCSTIHKAYCGST--VQRRVKSRDGTWSLQSVPVPEPVRAYNRYMGGVDLSDALIKYFSVTQKTMKWYKKLFLHFVDIAVVNSYVIHRELSLAKQQKPLTQKKFREALCLQLADLGSERATEPAASEPKIKEEP 558          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000043919.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002039.1:240413:244210:1 gene:ENSAMXG00000040755.1 transcript:ENSAMXT00000043919.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.836 bits (390), Expect = 4.183e-39
Identity = 101/351 (28.77%), Postives = 179/351 (51.00%), Query Frame = 2
Query:  752 KGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNED--------ITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIY-------AAQGLRLIETIQTVVSPYTDIWH--YLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTD-----LQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQK--------IIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSIT 1714
            K +KW  +T+ E   F+GL+ +MGLV+     +  +   + +  F    MS  RF  I    H +D E+         T   DRL KI+P+    +    + ++P++++S+DE ++  + R   + Y   K  K+G  + IL++S +GY  NF +Y       + +GL   +T++T++  Y+ + H   +YMDN+Y S      LLQ+    CGT++  +  L+  K +      +R D  + R+  +L   W   +EV++ S++H A   +   V R ++ K        +  P A+ DYNK+M GVD +D  + YY++L K+ KW K    + I+ A+ NSF+++  + 
Sbjct:  208 KKLKWTPVTVKEFYAFIGLVVYMGLVKVKSIMDLWSKKQLYQFQFPSMVMSSKRFTAISSNLHLSDPEEDAENMKKKGTPDYDRLFKIKPLYTDILSACHSFFQPRRELSIDERMVASKARTGLKQYMKAKPTKWGFKLFILADSASGYTWNFFVYEGKSPFASGKGLSY-DTVKTLLD-YSLLGHGYMVYMDNFYTSPTLLSDLLQENTLACGTLRTNQLGLSLPKNNELPKRAERGDIRWYRQGKLLYVKWMDTREVTMCSTMHKAY--KGDTVKRKVKSKEGVWDITTVPIPAAVKDYNKHMGGVDLSDALIGYYHVLHKSRKWYKTFFFHFIDIAIVNSFILHQQLA 554          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000025849.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:20558813:20568326:-1 gene:ENSAMXG00000025123.2 transcript:ENSAMXT00000025849.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 2.703e-36
Identity = 117/492 (23.78%), Postives = 225/492 (45.73%), Query Frame = 2
Query:  650 TQMDVLKLFINDDFLVIESNKYYYQNIDR--LKSQTKG--IKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDI--------TDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIY-------AAQGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKK-----IEAYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQ--------KIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSACKVRSETCFICNFVKFP-YTGANVL 2026
            T +++ KLF        E+ +   QN ++   K+Q+ G   KW D+ + +  K+ GL+ +M LV+ D  ++Y   D +       + MSR+R+  I    H +D +++        T   D+L +++P+++      K+ Y P + +++DE ++  + +     Y   K IK+G  + +L++S  GY  +F +Y       +  GL     +  V   Y    +++YMDN+Y+S     AL + K   CGT +       +  +NA     +R    + R   I+   W   +EVS+ S+IH A   E       M+Q         I  P  +  YN++M GVD +DQ + YY+   KT +W +++  + ++ A  NSF+++  +   + K          + TS+     ++++       S  ++P+   P  +S +++    +   + G+     R+C  C +   R +T + C+    P Y   N++
Sbjct:   77 TPLELFKLF-----FPFETVQTMCQNTNKQAAKNQSMGKKYKWTDLDVEDFYKYCGLVLYMSLVKVDSISDYWRQDHLFSLSLPAQIMSRDRYRTISWNLHLSDPDEVVKNNRKKGTAEHDKLFQLKPLMDTIKNACKSFYHPHKNLAVDERMVASKAKNVMTQYMKAKPIKWGFKLFVLADSRNGYTVDFSVYTGKSDIPSGHGLSYDVVMSLVQPGYLGTGYHIYMDNFYSSPKLFRALHECKFSACGTYRDNRKGCPQTDVNALTKRSERGSIRWIRDGPIVYVKWMDTREVSVCSTIHPAHSGEI--AQSRMKQDDGSWAKVSIPCPTPVKQYNQHMGGVDLSDQLIQYYSAQHKTMRWYRKMFYHFLDIATTNSFILHKELCLAQEKQPLTQRAFLEKLTSELCGRPLLTK-------SSAKSPADHVPVAIS-NLQSATPSDKATTGR-----RRCEHCQSQGRRKDTPWKCSKFSGPTYHSQNIV 548          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Match: ENSAMXT00000030524.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:5821371:5823572:-1 gene:ENSAMXG00000031777.1 transcript:ENSAMXT00000030524.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 2.972e-36
Identity = 113/471 (23.99%), Postives = 220/471 (46.71%), Query Frame = 2
Query:  650 TQMDVLKLFI---NDDFLVIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFND-NEDI-------TDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIY-------AAQGLRLIETIQTVVSP-YTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKK-----IEAYLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQK--------IIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYN----SITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSA 1954
            T +D+ KLF        L   +NK   +N+    S+ K  KW D+   E  K+ GL+ +M L++ D  ++Y   D +       + MSR+R+  +    H +D +ED+       T   D+L +++P++       K  Y P +++++DE ++  + +     Y   K  K+G  + +L++S  GY  +F +Y       +  GL   + + ++V P Y    +++YMDN+Y+S     AL + K   CGT ++      +  +NA     +R    + R   I+   W   + VS+ S+IH A   E+  V R ++++        +  P  + +YNK+M GVD +DQ +  Y+   KT +W +++  + ++ A  NSF+++     +   + + +K FL  +    TS+     +++            +P+R P G + + +     +   S+ +    +R+C  C +
Sbjct:  185 TPLDLFKLFFPVQTVQTLCQNTNKQAAKNL----SEGKKYKWTDLDAEEFYKYCGLVLYMALIKVDSVSDYWRQDHLFSLSLPSQIMSRDRYRTVSWNIHLSDPDEDVHNDQKKGTAQHDKLFRLKPLMETIKNACKAFYHPHKELAVDERMVASKAKTGMTQYMKSKPTKWGFKLFVLADSRNGYTVDFSVYTGKSDIPSGHGLSY-DVVMSLVQPGYLGTGYHIYMDNFYSSPKLFRALHECKFSACGTYRENRKGCPQTDVNALTKRSERGSIRWIRDGPIVYVKWMDTRAVSMCSTIHPAHSGET--VQRRVKREDGSWTKTSVPCPTPVAEYNKHMGGVDLSDQLIQCYSAQHKTMRWYRKLFYHFLDIATTNSFILHKEHCVAHQQQHLTHKAFLEKL----TSELCGRPLLT------------SPARSPAGHVPVPITSSPQSADPSE-RATTGRRRCEFCQS 631          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002004.1 (pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gene:ENSPMAG00000001819.1 transcript:ENSPMAT00000002004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 233.032 bits (593), Expect = 1.002e-68
Identity = 160/492 (32.52%), Postives = 253/492 (51.42%), Query Frame = 2
Query:  605 DFLGIPGITLNNP-PKTQMDVLKLFINDDFLVI---ESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDIT-DPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTDLQR-------RDTI-FRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDR------------MMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSACKVRSETCFICNFVKFP 2005
            DF  +PG  +  P P T +  ++LFI  + L+    E+N Y    +   KS  +   W+ + + ++  ++GL   MG+        Y +T      P F +TMS  RF  I R ++ +++  +  D +DRL ++R ++ +F  KFK +Y P +++SLDE  + W+GRL F+VYN  K  KYGI   IL+E+ TGY+ NF+IY      +   +  ++ P  D  + LYMDNYYNSV  T  L +  +  CGT++           DLQ        RD+I FRRK +  +  W + + V+LI++IH+A   ++HN  R            + R ++ +PNA+ DY  +M+GV   DQ + YY+  RKT KWTK++ +Y +  AL N++V+Y   +T + K    L  +AF    + +   +I  DP      W  A S D   +L+  + +H +  I         QR+CRVC     R +T + CN  K P
Sbjct:    1 DFTAVPG--MQTPVPATPLGFIQLFITRELLMFFTNETNSYANCALAN-KSAEERAGWEGVNLMDIANYLGLTMAMGVASLPEIPMYWSTGKPYSMPAFRETMSCKRFKSIGRFFNCHNSCAVPRDNTDRLLQVRTVMEYFQSKFKALYAPNRELSLDEATLEWKGRLPFKVYNPQKPEKYGIKFYILAEAQTGYVFNFDIYVGIEKSIRNIVFGLMGPLLDKGYQLYMDNYYNSVKLTEELYEHGVHTCGTLRLSRGA----PKDLQALAKMKIPRDSIHFRRKGNTFVICWMNTRLVTLITNIHNA---DTHNFVRQQKTRKRDGTALLSRIELQRPNAIADYMDHMRGVVHFDQMIQYYHFTRKTHKWTKKIVLYFLQMALHNAYVLYKKYSTDEKK----LTLLAFH---EVLFNALIHFDP----QEW--AVSVDVTPQLT-QVTEHAMTSIMPS------QRRCRVCYRNGRRRDTTWECNVCKIP 462          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007705.1 (pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene:ENSPMAG00000006959.1 transcript:ENSPMAT00000007705.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.91 bits (385), Expect = 3.069e-41
Identity = 98/339 (28.91%), Postives = 167/339 (49.26%), Query Frame = 2
Query:  764 WKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPS------DRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQG-------LRLIETIQTVVSPYTDIW---HYLYMDNYYNSVDNTVALLQK-----KIRVCGTIKKIEAYLNA*KTDL-----QRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVY 1702
            W   T  EMK F  +   MG+    R   Y + +P L   +   TM+  R++++ +  H  +N  +  P+      D + K+R ++      F   Y P++++S+DEG+IP++GRLFF+ +   K  K+G+ V  L E+ TGY  NF+IY  +               + V+S     W   H+LY D Y++S     ALL+          CGT+      L     ++      R D  F +K  ++L VW+ K+ V+ +S+     M       R + +  IKP  ++ YN++M GVDR+DQY SYY + R + KW + +  +++N ++ N +++Y
Sbjct:    1 WSPTTSREMKAFFAVAIMMGIKDLPRVWCYWSGNPALRCEWVSGTMTHTRYSKVSQYLHARNN--VGTPARGQRGYDPIYKVRNVVEEVRANFSRHYSPRRELSVDEGMIPFKGRLFFKQHMPAKPTKWGVKVWELCEAQTGYCLNFDIYTGRSAYGAATTAAAALGYRVVMSLTRSYWHRNHHLYFDRYFSS----PALLEDLRSRCGTYACGTVSLSRRGLPPPAREVASLLRHRGDFAFFQKGGLVLSVWRDKRVVATLSTNQDPRMV------RPVDEGPIKPAPVVHYNRFMGGVDRSDQYRSYYAVGRASKKWWRYIVWFLLNLSIVNGWLLY 327          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001816.1 (pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-1 gene:ENSPMAG00000001650.1 transcript:ENSPMAT00000001816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 1.451e-27
Identity = 104/411 (25.30%), Postives = 180/411 (43.80%), Query Frame = 2
Query:  599 LEDFLGIPGITLNNPPKTQ-MDVLKLFINDDFL---VIESNKYYYQNIDRLKSQTKGI-----KWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPS----DRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYA-------AQGL----------------RLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTD--LQRRDTIFRRKNDILLQVWKSKKE-VSLISSIHSAE----MKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVY 1702
            LE+F G PG     P  +Q +D  KLF+ D+ L   V E+N++  +    +     G      + + +T   +  F+G++  MG+        +   D  L   F  +++S  RF+ + R  H +D+E          D L KIRP+++H +  F   + P + + LDE +  ++ R           I+ G+ V I S + TGY+ +  ++A       A GL                RL E +  V        H++Y    + S       LQ+    CG ++           D  LQ  DT FR+   ++  + K+  E +++I+S    E     +  HN D    QK   P+ L++YN  M  VD A Q  +++ + R+  KW K +  +++N A+ NS+++Y
Sbjct:    2 LEEFQGSPGPVHALPAGSQPLDYFKLFLTDEMLDRIVTETNRHAARCGANMHLTGPGPGSVSGEGRPVTRSSLSTFLGVVLIMGINMLPALPYHWADDDSLGNQFIRRSISHKRFSFLQRYLHISDDEKAPSRGRIGYDPLHKIRPLLDHLLGAFSRHFVPFRDMRLDEVLSKFKDRHDALPCVPANPIRCGVKVFICSCASTGYVHSLLVHAGGHDIVVAGGLWRRRNKSFPLGYRAAMRLTERLHGV-------HHHVYFGKLFGSARLLSDFLQRGTYGCGLVRPNSRGFPKELRDSRLQPGDTKFRQSGQLVACIHKANTENMAIIASNSRPESERMQRRFHNYDVEGSQK---PHPLLNYNMCMGKVDIASQLQTWFELGREGRKWWKYMFFFLLNTAVVNSYILY 402          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Nematostella
Match: EDO31061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ00])

HSP 1 Score: 59.3066 bits (142), Expect = 2.537e-10
Identity = 36/87 (41.38%), Postives = 54/87 (62.07%), Query Frame = 2
Query: 1385 DLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQK---IIKPNAL---IDYNKYMKGVDRADQYLSYYNILR 1627
            +L+R ++IF +K +++  +WK KK V+ IS+    E K +  V+R  RQK   I+K + L     YNK+M GVD+ADQY  YY + R
Sbjct:   53 NLRRGESIFHQKGNVVFTIWKDKKAVAFIST--QCEAKGTETVNR--RQKDGSIVKVDFLPVVTIYNKFMGGVDKADQYWQYYEVTR 135          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Nematostella
Match: EDO32958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STK1])

HSP 1 Score: 57.7658 bits (138), Expect = 5.837e-9
Identity = 43/115 (37.39%), Postives = 64/115 (55.65%), Query Frame = 2
Query: 1313 LLQKKIRVCGTI---KKIEAYLNA*KT--DLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQK---IIKPNAL---IDYNKYMKGVDRADQYLSYYNIL 1624
            LL+ KI + GT    K   A L       +L+R ++IF +K +++  +WK KK V+ IS+    E K +  V+R  RQK   I+K + L     YNK++ GVD+ADQY  YY + 
Sbjct:  201 LLKDKIYLSGTTSNRKDFPAKLKGAAVIKNLRRGESIFHQKGNVVCTIWKDKKAVAFIST--QCEAKGTETVNR--RQKDGSIVKVDFLPVVTIYNKFIGGVDKADQYWQYYEVF 311          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000021107.2 (piggyBac transposable element-derived protein 4 [Source:NCBI gene;Acc:101163734])

HSP 1 Score: 139.813 bits (351), Expect = 2.978e-34
Identity = 116/466 (24.89%), Postives = 208/466 (44.64%), Query Frame = 2
Query:  566 DGWSINDNP----PVLEDFLG--IPGITLNNPPKTQMDVLKLFINDDFLVIESNKYYYQNIDRL----KSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFND------NED--ITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVY-NAGKIIKYGILVRILSESDTGYICNFEIYAAQ-------GLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAY-----LNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKES------HNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITT----KKIKYKRFLYDIAFEWTSDSIHE--EVISEDPWPSASSWKR 1834
            D W   D+P    P    FL    PG+    PP T        I   F   E  K   +N +      K   K   WKD+T  E+ K++GL+ +M +    R  +Y   + +    +    MSR+RF  I    HF+D      NE    T+  D L+++R ++     + K  Y P+Q +S+ E ++  +GRL  + + +A K  K+G+   +L++ + GY  ++ +++ +       GL      + V   Y    + +Y D++Y S      L+Q+    CG  K+         LNA     +R    + R +D+L   W   +E+SL +++H     E+          R  R  + +P A+ ++NKYM GVD + Q L+  ++ RKT +W   V  ++++ A+ NS+++   +++    K +  + F   +  E     + E  +   +  +PS +S  R
Sbjct:   92 DAWKTEDDPDTANPGPPTFLPKRTPGV---QPPLTTGKQTPGAIFSQFFDAEVLKILCENTNSFAQKKKETGKPFPWKDLTPQELTKYLGLLLYMSVCNFPRITDYWRKNSIFHVSYPAAVMSRDRFLTISSHLHFSDPDVDAVNEQKMGTEEYDPLQRVRCLLEMISSRCKAAYHPRQHISVGERMVATKGRLQIKEHVDADKPTKWGLNFFVLADVN-GYTIDYMLHSGEKQRASGKGLAFDVVAELVNREYLGSGYIVYCDSFYTSPVLFRHLIQQGFGACGMYKQGRTGVPTTKLNALNRKSKRGSIRWIRDSDLLYVRWMDTREMSLCTTVHPVHGGETIVRWQKTEDGRSQRAPLPRPTAVSEFNKYMGGVDTSGQMLTTNSVHRKTRRWDVTVFQHLLDIAVTNSYIIQKELSSALEQKPLSRQDFQEQLCAELLGVPLAEPPQTTGDGHFPSPTSKGR 553          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000029842.1 (piggyBac transposable element-derived protein 4 [Source:NCBI gene;Acc:101157644])

HSP 1 Score: 122.094 bits (305), Expect = 3.535e-28
Identity = 115/461 (24.95%), Postives = 196/461 (42.52%), Query Frame = 2
Query:  689 FLVIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TT--DPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITD--PSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYA---AQGLRLIETIQTVVSPYTDIWHY--LYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTDLQRRDTIFRR-----KNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVCSACK-----VRSETCF--ICNFVKFPY 2008
             ++I +N++       LK+       K +   E++ +VGL+   G+ R   R E   +  +P    P FG TMS   F Q      F+D         SDRL  +R +   + ++   +Y    +V++DE ++P++GR  FR Y   K  KYG+ + +  ++ T Y    + Y    A G R       VVS  T    +  +  DN++ S      LL++ I + GTIK  +  L       + R+ +  R         L  V K  K V L+S+ HS        V+    ++  KP  ++DYNK   GVD  D+ L+ Y+  R T +W   +   MI+ + +N++V++  +    + + R    I  E     +   ++           KR P   P   L + M++       S+GK K    +C++C   K     +  ++C   IC     P+
Sbjct:  385 LILIATNRHSADKAHALKTP------KPMDEIELRAYVGLLILAGVYRS--RGEALVSLWEPECGRPIFGATMSLRSFYQRSATLRFDDRSTRASRSASDRLAAVREVWEEWCDRLPRLYDIGPEVTVDERMVPFKGRCSFRQYIPSKPTKYGLKLWVACDARTSYAWRVQPYMGKLASGARETNLASRVVSDLTRGLEHRNVTCDNFFTSYALATELLKRNITLLGTIKSNKPELPPELASARGREALSSRFAFTDCAAALSYVPKKNKNVLLLSTKHS-------RVEICHERRDKKPEMILDYNKTKGGVDNLDKLLATYSCRRMTKRWPLAMFHNMIDMSAYNAYVIWREMHPDWMPWNRNRRRIFLEQLGKDLVRPLVLRR--------KRVPRARPAYDLMVSMQEAGGTSARSEGKRK----RCQICPRSKDTKTLISCKSCGKSICRGCTVPF 818          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000037833.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:101160710])

HSP 1 Score: 113.235 bits (282), Expect = 9.832e-26
Identity = 82/335 (24.48%), Postives = 153/335 (45.67%), Query Frame = 2
Query:  761 KWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDIT---DPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAA----------QGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTDLQRRDT-----IFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSI 1711
            KWK +   ++  ++G++   G+ R          +     P F  TMS   F+ I R   F DN D       SD+L  IR + + +VE    +Y P   V++DE ++P+RGR  FR Y   K  KYGI +    ++ + Y    ++Y            QG+R++  +   +       H +  DN++ S      L ++K+ + GT+++ +  L +    +Q R        F  K  ++    K  K V ++S++H+           +  +  +KP  ++DYN    GVD  D+  + Y+  RKT +W   +   +++ + +N++V+++ I
Sbjct:  152 KWKSLDQTDLNAYIGILILAGVYRSKGEATSSLWNEENGRPIFRATMSLETFHMISRVIRF-DNRDTRVGRRESDKLAAIRDVWDKWVEILPLLYNPGPHVTVDERLVPFRGRCPFRQYMPNKPAKYGIKIWAACDAKSSYAWKMQVYTGKSPGGAPEKNQGMRVVLEMSEGLQG-----HNITCDNFFTSYRLGEELQKRKLTMLGTVRRNKPELPSEILKIQGRPMHSSIFAFTEKATVVSYCPKRNKNVLVMSTMHTDA--------SLSTRDDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTARWPMAIFFNIVDVSAYNAYVLWSEI 472          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000047092.1 (piggyBac transposable element-derived protein 2-like [Source:NCBI gene;Acc:111948922])

HSP 1 Score: 105.531 bits (262), Expect = 3.459e-23
Identity = 100/387 (25.84%), Postives = 177/387 (45.74%), Query Frame = 2
Query:  623 GITLNNPPKTQMDVLKLFINDDFL--VIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNE-DITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRLIETIQTVVSPYTDIW----------HYLYMDNYYNSVDNTVALLQKKIRVCGTIK--KIEAYLNA*KTDLQRRD-TIFRRKNDILLQV------WKSKKEVSLISSIHSAEMKESHNVDR--MMRQKIIK---PNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVY 1702
            G+  ++  K+  +  KLF ++D L  V+E +  Y         Q    K  ++T  E+++F+G   +M L        +   +          TMS NR+  I +  HFN+NE    +  D L KIRP++ H   K + I    +++++DE ++P++GR   + Y   K  K+G  + +L+ SD G   NFEIY  + ++  E      S    +           H L+ DN+Y SV   + L Q+ I   GT++  ++         +L+R     F +K  ++ +       W   + VSL+S    A      +VDR    ++K+I+   P  + +YNK M GVD  D  ++ Y    ++ KW  R+  + I+     ++++Y
Sbjct:   92 GLPKSDDIKSPYEYFKLFFSEDILEVVVEQSNLY-------AIQCNTNKPLNLTTKELEQFMGTAVYMSLFGLPGTRMF--WNKATRVSQVADTMSLNRWEFIKKCLHFNNNEVRQGENVDPLHKIRPLVTHLTSKLQTIPM-GEKLAVDEQMVPFKGRNRLKQYLPAKPKKWGYKILVLAGSD-GVQHNFEIYTGRVVQPPELPDVGASGNVVLRLAQPIPKHQKHKLFFDNWYTSVPLILTLAQQGIHCAGTVRSNRLPGVSMMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRPVSLLSDYIGAH--PVTDVDRWDGKQKKVIRVPCPAVVREYNKNMGGVDLLDSLIALYRTKIRSKKWYHRLMFHFIDMTTVTAWLLY 465          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000038522.1 (pep primary_assembly:ASM223467v1:10:9345195:9347118:-1 gene:ENSORLG00000027882.1 transcript:ENSORLT00000038522.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 7.247e-23
Identity = 98/387 (25.32%), Postives = 177/387 (45.74%), Query Frame = 2
Query:  623 GITLNNPPKTQMDVLKLFINDDFL--VIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNE-DITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRLIETIQTVVSPYTDIW----------HYLYMDNYYNSVDNTVALLQKKIRVCGTIK--KIEAYLNA*KTDLQRRD-TIFRRKNDILLQV------WKSKKEVSLISSIHSAEMKESHNVDR--MMRQKIIK---PNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVY 1702
            G+  ++  K+  +  K+F ++D L  V+E +  Y         Q    K  ++T  E+++F+G   +M L        +   +          TMS NR+  I +  HFN+NE    +  D L KIRP++ H   K + I    +++++DE ++P++GR   + Y   K  K+G  + +L+ SD G   NFEIY  + ++  E      S    +           H L+ DN++ SV   + L Q+ I   GT++  ++         +L+R     F +K  ++ +       W   + VSL+S    A      +VDR    ++K+I+   P  + +YNK M GVD  D  ++ Y    ++ KW  R+  + I+     ++++Y
Sbjct:   92 GLPKSDDIKSPYEYFKMFFSEDILEVVVEQSNLY-------AIQCNTNKPLNLTTKELEQFMGTAVYMSLFGLPGTRMF--WNKATRVSQVADTMSLNRWEFIKKCLHFNNNEVRQGENVDHLHKIRPLVTHLTSKLQTIPM-GEKLAVDEQMVPFKGRNRLKQYLPAKPKKWGYKILVLAGSD-GVPHNFEIYTGRVVQPPELPDVGASGNVVLRLAQPIPKHQKHKLFFDNWFTSVPLILTLAQQGIHCAGTVRSNRLPGVSMMCDAELKRTGRGSFDQKTAMVGETTLHAVKWYDNRPVSLLSDYIGAH--PVTDVDRWDGKQKKVIRVPCPAVVREYNKNMGGVDLLDSLIALYRTKIRSNKWYHRLMFHFIDMTTVTAWLLY 465          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000047155.1 (SMESG000047155.1)

HSP 1 Score: 187.578 bits (475), Expect = 5.923e-51
Identity = 128/425 (30.12%), Postives = 221/425 (52.00%), Query Frame = 2
Query:  746 QTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAA-----QGLRLIET-IQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYL--NA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKI---ESKGKNKFVQRQCRVCSACKVRSETCFIC 1987
             ++   +K+  + EM+KF+GL      ++     +  + D +   P F   MS  RF QI R +   + E+  DP   L KI+  ++  ++KF N Y P + +SLDE ++ +RGRL+FR Y  GK  KYGI    L  S  GY+ N E+Y       + +  IE+ +  ++  Y +  H+L+MDNYYNS+  +  LL KK  V GT++     L     +  L++ + ++RR+N   +  WK K++V  +++ +   M  + N     +Q+  KP  +++YN+ M GVDRADQ +SYY+  RKT +W K+V  ++++ A++NSF ++   T  ++KY  +   I    T       + ++    +   +KRA  +     ++ +  +H   KI   E+  +  + QR C+ C    +R ET + C
Sbjct:  130 HSRKANFKNTDMIEMRKFLGLCLLQSQLKFSSIRKLFSIDALHYHPAFPSQMSGRRFEQILRCFCVEE-ENSNDP---LRKIKIFLDLLIQKFANAYAPNEALSLDESLLLFRGRLYFRTYMKGKKAKYGIKFYELC-SAQGYVLNIEVYKGHRENDENMTTIESLVMRLMQSYLNKGHHLFMDNYYNSLPLSNKLLSKKTHVTGTLRVNRKGLPQEITRRKLRKGEHVWRRQNQTYVSKWKDKRDVLCLTTAYHPSMINTAN---RRQQEKRKPIEIVNYNQNMSGVDRADQMMSYYSCPRKTIRWYKKVIFHLLDVAVWNSFYIFKEKTGSQMKYIEYREAIIRSLTG------IDNKRDGRTLVQFKRAQIQ--TNEINNNGTQHFPEKISPPENYQRKTYFQR-CKQCYKQGIRKETSYCC 537          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000071608.1 (SMESG000071608.1)

HSP 1 Score: 159.458 bits (402), Expect = 3.478e-41
Identity = 120/404 (29.70%), Postives = 208/404 (51.49%), Query Frame = 2
Query:  605 DFLGIPGITLNNPPK-TQMDVLKLFINDD---FLVIESNKYYYQNIDRLKS--QTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYL--NA*KTDLQRRDTIFRR-KNDILLQVWKSKKEVSLISSIHSAEMKESH-NVDRMMRQK-IIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAM-YMINCALFNSFVVYNSITTKK-IKYKRFLYDIAFEWTSDS 1777
            DF+G  G+ L+ P   +  D   LF +++    +VIE+N Y  Q I+R ++    +  KW      E++KF GL  +MGLVR  +   Y +   + +       MSR+RF  + R  HF++NE+   P DRL KI+P+++    K+K ++ P +   +DE ++PWRGRL FR Y   K  KYGI +  L  S+ GY    ++Y+ +          +    + +   +Y  N+Y S    +  L++K  V  T++  + ++       +L++ + I R  KN I++  W   + V ++ + H+ E+   + N     RQK   KP  + +YNK   G+D +DQ  SY   LRK  KW +++A+ Y++  ++ N++++ N I  K  I  ++F  ++  E  S S
Sbjct:   96 DFIGKSGLQLDLPKNISAFDTFMLFFDEEVINLIVIETNIYAEQTIERTRTSRHNRLNKWHPANSEEIRKFFGLFMWMGLVRMGKITSYWSNKDIYKNSTALSIMSRSRFEILLRLLHFSNNENAI-PGDRLAKIKPLLDLLEAKYKKVFVPGENHVIDETLVPWRGRLVFRQYIPNKAHKYGIKLFKLCTSE-GYTWASKMYSGKS--------EIYDKNSGLAAKVY--NFYTSYPLALDFLRQKTHVVSTVRANKKFMPKEVMNANLKKGEMIAREYKNGIVVLNWLDTRYVRVLKTKHAPEIVNINVNSPSTSRQKNKQKPLTVCEYNKGKAGIDISDQMGSYATTLRKGIKWYRKLAIEYVLGISVVNAYII-NKINNKSNIGIRQFQENLVTEMLSLS 486          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000020543.1 (SMESG000020543.1)

HSP 1 Score: 136.732 bits (343), Expect = 8.298e-35
Identity = 113/388 (29.12%), Postives = 178/388 (45.88%), Query Frame = 2
Query:  818 MGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQ--------GLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEAYLNA*KTDLQRRDTIFRRKN--DILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAM-YMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEVISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCRVC 1948
            MGLVR  +   Y +             M RNRF  + R  HF++NE+  DP ++L K+ PIINH    FK  YKP + + +DE ++P+RGR+ FR Y   K  +Y I V  L     GY  +F IY  +        G +  E +  +        H +  DN+Y SVD    L+ K+ ++ GT++K                  +RR N  +++ Q  K K++V ++S+ HS EM     ++        KP  + +YN     VD +DQ ++Y + LR+T KW K++A+  ++N  + NS V++  +T K      F   +A    + S ++ +         S  KR  SR           +H   KI     N  V+R C+ C
Sbjct:    1 MGLVRLPKIKLYWSKYEGYNLTLPRTIMPRNRFELLLRFVHFSNNEE-NDPKNKLSKVDPIINHLNNNFKIYYKPDEVLCVDESLMPFRGRIVFRQYIKQKRHRYVIKVFKLY-IGPGYTYSFRIYTCKDENTNEISGNKSTEIVMALCQDILGKGHTICTDNWYTSVDLAERLIDKRTQLLGTLRK------------------YRRGNPKEVVAQKLKHKRDVLMLSTKHSTEMTIIQKINFSKE----KPKMVFEYNLGKSAVDLSDQMVAYSSPLRRTIKWYKKLAIELLLNTCIENSIVLFKQVTRKNTAIPDFRMKLAMHLMNCSDNDCI---------SPNKRVQSRP----------RHEFKKIPGNSPN--VRRFCKEC 343          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000067117.1 (SMESG000067117.1)

HSP 1 Score: 135.961 bits (341), Expect = 2.030e-34
Identity = 95/275 (34.55%), Postives = 141/275 (51.27%), Query Frame = 2
Query:  572 WSINDN-PPVLEDFLGIPGITLNNPPKTQ-MDVLKLFINDDFL---VIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAAQGLRLI---------ETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKK 1354
            WS   N  P L  F   PG         Q +D  + FI+ +F+   V E+N   YQ    L SQ K  KW D+T  E+  F  ++   GLV K+   +Y + DP+L TP F KT +RNRF QI R  HF +NE  T+  D+L KI  ++N   EKFKN+  P + + +DE ++ W+GRL F+ Y   K  ++GI +  + +  T  I NF IY  +  +             +  +++ + D  H LY++N+Y+S      L  KK   CGT++K
Sbjct:   39 WSKEGNFVPKLHQFQEKPGPKNFRVENEQPIDYFEWFIDSEFMDYVVKETN--LYQQQHPLPSQKKMAKWFDVTSNELSVFFAIVMLTGLVSKNELKDYWSVDPLLNTPIFPKTFTRNRFLQIMRFLHFANNEQKTN--DKLFKIGNVVNMVKEKFKNVIIPDRLICIDESLMLWKGRLSFKQYIPLKRHRFGIKLFEMVDCTTQCILNFIIYTGKSTKFRFHELLGISGSIVMELMNMHLDKGHVLYVENWYSSPPLFEILHYKKTGACGTLRK 309          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000081807.1 (SMESG000081807.1)

HSP 1 Score: 115.161 bits (287), Expect = 8.591e-27
Identity = 85/328 (25.91%), Postives = 153/328 (46.65%), Query Frame = 2
Query:  770 DITIPEMKKFVGLIKFMGLVRKDRRNEY*TTDPVLETPFFGKTMSRNRFNQIWRAWHFNDNEDITD--PSDRLEKIRPIINHFVEKFKNIYKPKQQVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYAA---------QGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTIKKIEA-----YLNA*KTDLQRRDTIFRRKNDILLQVWKSKKEVSLISSIHSAEMKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKWTKRVAMYMINCALFNSFVVYN 1705
            D TI EMK  VG++  +G++   + +       V   P    T+  NRF     +  F+D     D   +D+   IR + +HFV+  + +Y P   + +DE  + +RG   FRVY   K  +YGI V  L ++ T Y+ N ++Y           QG R+++ +   + P  +    +  DN++ S D    LL + I + GT++K        +L+  + + + +   F +   ++       + V L+S++H+  +       R       KP  ++DYN     VD  DQ +S+Y+   KT +W  R+  ++I+ +  N+FV+ N
Sbjct:   31 DFTIVEMKAAVGIMILVGVMCSKKESLNQLWFEVYGRPLLRTTIPLNRFRIFLSSARFDDKTTRNDRQKTDKFAAIRELFDHFVDNRQELYTPSPYLCVDETQVEFRGGCPFRVYIPSKPDRYGIKVWSLCDNGTHYVTNLQVYLGKKGQSPKHQQGTRVVKQL---MLPLYNSGRNVTTDNFFTSYDLGQFLLSQNITLLGTMRKSRTEIPPEFLSKSREEFESK-FAFTKDTALVSYAPPKNRTVVLLSTMHNRPVVFDDGRGR-------KPYMVLDYNMTKGAVDAFDQEVSFYSFAHKTRQWPMRLFYFIIDASCLNAFVLLN 347          
The following BLAST results are available for this feature:
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGBD42.112e-3924.70piggyBac transposable element derived 4 [Source:HG... [more]
ERCC66.795e-2323.63ERCC excision repair 6, chromatin remodeling facto... [more]
ERCC61.724e-2122.90ERCC excision repair 6, chromatin remodeling facto... [more]
ERCC61.724e-2122.90ERCC excision repair 6, chromatin remodeling facto... [more]
PGBD23.144e-1720.92piggyBac transposable element derived 2 [Source:HG... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01069162.15.997e-4027.43pep scaffold:GRCz11:KN149950.1:74:5493:1 gene:ENSD... [more]
si:dkey-19f4.22.748e-3826.84si:dkey-19f4.2 [Source:ZFIN;Acc:ZDB-GENE-121214-26... [more]
pgbd43.416e-3626.23piggyBac transposable element derived 4 [Source:ZF... [more]
pgbd41.016e-3324.18piggyBac transposable element derived 4 [Source:ZF... [more]
CABZ01072083.25.483e-2524.16dual specificity phosphatase 26 [Source:NCBI gene;... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pbk5.156e-6130.67PDZ binding kinase [Source:Xenbase;Acc:XB-GENE-101... [more]
ENSXETT00000019443.11.840e-6030.47pep primary_assembly:Xenopus_tropicalis_v9.1:2:309... [more]
ENSXETT00000047457.13.161e-6030.47pep primary_assembly:Xenopus_tropicalis_v9.1:4:686... [more]
ENSXETT00000004705.14.665e-5532.15pep primary_assembly:Xenopus_tropicalis_v9.1:1:109... [more]
sin3b4.891e-5532.41SIN3 transcription regulator family member B [Sour... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96DM1|PGBD4_HUMAN1.014e-3824.70PiggyBac transposable element-derived protein 4 OS... [more]
sp|Q8N328|PGBD3_HUMAN3.263e-2223.63PiggyBac transposable element-derived protein 3 OS... [more]
sp|P0DP91|ERPG3_HUMAN8.278e-2122.90Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=96... [more]
sp|Q6P3X8|PGBD2_HUMAN1.510e-1620.92PiggyBac transposable element-derived protein 2 OS... [more]
sp|Q96JS3|PGBD1_HUMAN2.453e-1422.75PiggyBac transposable element-derived protein 1 OS... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2L0H42.030e-15450.51PiggyBac transposable element-derived protein 4 OS... [more]
A0A4Y2QJF81.203e-15350.31PiggyBac transposable element-derived protein 4 OS... [more]
A0A4Y2HLZ01.326e-15350.31PiggyBac transposable element-derived protein 4 OS... [more]
A0A4Y2QCV45.966e-15250.10PiggyBac transposable element-derived protein 4 OS... [more]
A0A4Y2J6B72.739e-15050.10PiggyBac transposable element-derived protein 4 OS... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000057483.15.377e-4225.25piggyBac transposable element-derived protein 4-li... [more]
ENSAMXT00000020723.21.372e-4126.77piggyBac transposable element-derived protein 4-li... [more]
ENSAMXT00000043919.14.183e-3928.77pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000025849.22.703e-3623.78pep primary_assembly:Astyanax_mexicanus-2.0:6:2055... [more]
ENSAMXT00000030524.12.972e-3623.99pep primary_assembly:Astyanax_mexicanus-2.0:8:5821... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002004.11.002e-6832.52pep scaffold:Pmarinus_7.0:GL490362:1254:2954:1 gen... [more]
ENSPMAT00000007705.13.069e-4128.91pep scaffold:Pmarinus_7.0:GL484572:34:4229:-1 gene... [more]
ENSPMAT00000001816.11.451e-2725.30pep scaffold:Pmarinus_7.0:GL492440:267714:269431:-... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO310612.537e-1041.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329585.837e-937.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021107.22.978e-3424.89piggyBac transposable element-derived protein 4 [S... [more]
ENSORLT00000029842.13.535e-2824.95piggyBac transposable element-derived protein 4 [S... [more]
ENSORLT00000037833.19.832e-2624.48piggyBac transposable element-derived protein 4-li... [more]
ENSORLT00000047092.13.459e-2325.84piggyBac transposable element-derived protein 2-li... [more]
ENSORLT00000038522.17.247e-2325.32pep primary_assembly:ASM223467v1:10:9345195:934711... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047155.15.923e-5130.12SMESG000047155.1[more]
SMESG000071608.13.478e-4129.70SMESG000071608.1[more]
SMESG000020543.18.298e-3529.12SMESG000020543.1[more]
SMESG000067117.12.030e-3434.55SMESG000067117.1[more]
SMESG000081807.18.591e-2725.91SMESG000081807.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031043 ID=SMED30031043|Name=PiggyBac transposable element-derived protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2303bp
ACGTTAAAATGCGGGTTCCAATATACTTGAGTTTTCGCTATATAGCGTCT
GTAGGGTTGTAGCCATGCAGGTAAAAACCTTTTGAGAACAATAGATGGGG
TGTACGGTGGGTACCGAGGTAGTGTTATTCATCACAAAAATAGTCGAAAA
TAACGGTACATATAACGGTCTACATGCAACACTAAGACGAAGAATAATAA
TTTTTTTAGTTTATTTCACTACTCTTTGGTAGTCGGACGTTGCTAAAAGC
TAAATATCGAGTACATAGATATTATATATATATTACGTATATATTTACAT
TTTATTTTAGTGTTTAAAAGTTAAAATACTTTTGATAAATTTTCGATGAA
ACAGACATTTTTACCAAGATTGTGATTGAAAAAAAATGTCTCACCACAAT
GAAGATAGTGACCAAGAAATATACGCCGACAATTTATCCGACACATCATG
TGAAAGTGATTTTGATAGTGATGATAGCGATCTAGTTAATAATGAAGATA
TTATTCCACTGCCTACAACATTTACCCGCAGAACCATTTCGTCCAGTTCT
GACGAAGAAGAGGTTGATGGTTGGTCTATAAATGATAATCCCCCAGTTCT
TGAAGATTTTTTGGGTATTCCTGGAATTACCTTGAATAATCCTCCAAAAA
CGCAGATGGATGTGTTGAAATTGTTCATAAACGACGATTTTTTGGTTATC
GAATCCAACAAATATTATTATCAAAACATCGACCGACTAAAATCACAAAC
CAAAGGTATCAAATGGAAAGATATCACCATTCCGGAAATGAAAAAGTTTG
TAGGTCTCATAAAATTCATGGGGCTAGTACGGAAAGATAGACGGAATGAA
TATTGAACCACAGATCCTGTTTTAGAAACTCCGTTTTTCGGTAAAACAAT
GTCAAGAAATAGGTTTAACCAAATATGGCGCGCTTGGCATTTCAATGACA
ATGAAGATATTACTGACCCATCTGATCGTCTGGAAAAAATAAGACCTATA
ATCAATCACTTCGTTGAAAAGTTCAAAAACATCTACAAGCCAAAACAGCA
AGTCTCATTGGATGAAGGCATAATACCATGGAGAGGAAGACTATTCTTCA
GGGTGTACAATGCTGGAAAAATCATAAAGTACGGGATTCTCGTGAGAATA
TTATCCGAGAGTGATACAGGATATATCTGTAATTTTGAAATTTACGCTGC
GCAAGGACTACGATTGATTGAAACAATCCAAACTGTAGTTTCGCCATATA
CTGATATCTGGCACTATTTGTATATGGATAACTATTATAATAGTGTTGAC
AATACTGTTGCGCTTTTACAAAAGAAAATAAGGGTTTGTGGAACCATTAA
AAAAATAGAGGCTTACCTGAATGCCTAAAAAACGGATTTACAGAGAAGAG
ATACAATATTCCGTCGGAAAAATGATATATTGTTACAAGTTTGGAAATCC
AAGAAAGAGGTATCTCTCATATCTTCTATCCATTCTGCAGAAATGAAGGA
GAGCCATAACGTCGACCGAATGATGCGACAAAAGATTATCAAGCCAAATG
CCCTTATTGATTACAATAAGTATATGAAAGGCGTCGATCGTGCCGATCAA
TATTTATCGTATTACAATATTTTGAGAAAAACCACGAAATGGACAAAACG
TGTGGCAATGTATATGATAAATTGTGCCTTATTCAATTCTTTTGTTGTAT
ACAACTCCATTACAACTAAAAAGATTAAATATAAAAGATTTTTATATGAC
ATTGCCTTCGAATGGACTTCCGATTCGATTCATGAAGAAGTTATTTCTGA
AGATCCATGGCCATCGGCATCTTCGTGGAAAAGGGCTCCTTCTCGTGACC
CTCCTGGAAGGCTTTCCATGGACATGCGCAAACATGTGATAGCCAAAATT
GAAAGCAAGGGAAAGAATAAATTTGTTCAAAGGCAATGTCGTGTCTGTTC
AGCGTGCAAGGTGCGTAGTGAAACATGCTTCATATGCAATTTTGTGAAGT
TCCCCTACACAGGGGCAAATGTTTTGAAAGATATCACACCCTAAAACAAT
ACTAATTTTTATTTTAAATTTAGAAATAATTTTTGTGTATAATTTGTAAA
ATAAAGGATGTTATGTAAAAAAATATTATTTTTTTCAAAACTTTCCTGCT
TTATGTGAAATTCTGCACTAGTTTAACGATGAAGAATACATTTCTAAATA
TAATAAAATAAAATGAAATAAAATAAATAATTTGCAAAAAGAATTATTGA
AATCAAACAAATATTTTTGAAGTTATCGTAATTTTTCTAGAGGTCTACGT
TAG
back to top

protein sequence of SMED30031043-orf-1

>SMED30031043-orf-1 ID=SMED30031043-orf-1|Name=SMED30031043-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=160bp
MSRNRFNQIWRAWHFNDNEDITDPSDRLEKIRPIINHFVEKFKNIYKPKQ
QVSLDEGIIPWRGRLFFRVYNAGKIIKYGILVRILSESDTGYICNFEIYA
AQGLRLIETIQTVVSPYTDIWHYLYMDNYYNSVDNTVALLQKKIRVCGTI
KKIEAYLNA*
back to top

protein sequence of SMED30031043-orf-2

>SMED30031043-orf-2 ID=SMED30031043-orf-2|Name=SMED30031043-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=157bp
MSHHNEDSDQEIYADNLSDTSCESDFDSDDSDLVNNEDIIPLPTTFTRRT
ISSSSDEEEVDGWSINDNPPVLEDFLGIPGITLNNPPKTQMDVLKLFIND
DFLVIESNKYYYQNIDRLKSQTKGIKWKDITIPEMKKFVGLIKFMGLVRK
DRRNEY*
back to top

protein sequence of SMED30031043-orf-3

>SMED30031043-orf-3 ID=SMED30031043-orf-3|Name=SMED30031043-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=184bp
MKESHNVDRMMRQKIIKPNALIDYNKYMKGVDRADQYLSYYNILRKTTKW
TKRVAMYMINCALFNSFVVYNSITTKKIKYKRFLYDIAFEWTSDSIHEEV
ISEDPWPSASSWKRAPSRDPPGRLSMDMRKHVIAKIESKGKNKFVQRQCR
VCSACKVRSETCFICNFVKFPYTGANVLKDITP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029526PGBD
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0005044scavenger receptor activity
GO:0005515protein binding
GO:0042802identical protein binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006898receptor-mediated endocytosis