PHB domain-containing protein

Overview
NamePHB domain-containing protein
Smed IDSMED30031031
Length (bp)1213
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PHB domain-containing protein (SMED30031031) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PHB domain-containing protein (SMED30031031) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031031

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30031031SMESG000022721.1 SmedASXL_003433SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30031031SMESG000022721.1 SmedASXL_001003SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30031031SMESG000022721.1 dd_Smed_v6_29891_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PHB domain-containing protein vs. Ensembl Human
Match: STOM (stomatin [Source:HGNC Symbol;Acc:HGNC:3383])

HSP 1 Score: 270.781 bits (691), Expect = 2.463e-88
Identity = 140/233 (60.09%), Postives = 190/233 (81.55%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCDSKH 1044
            ++I +Y+RA++FRLGR++   A GPGL  ++PC DS  ++D+RT++FD+P QE+LTKDSVT++V+ VVYYR+ N  ++V N+ +A+ +TRLLAQTTLRNVLGT +L  +L DREEIA +MQ  LD ATDAWG+KVERVEIKDV+LP QLQRAMAAEAEA+REA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTL++I+ EKNSTI+FPLP   ++M      +KH
Sbjct:   55 KIIKEYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDAWGIKVERVEIKDVKLPVQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQTLTTIAAEKNSTIVFPLP---IDMLQGIIGAKH 284          
BLAST of PHB domain-containing protein vs. Ensembl Human
Match: STOML3 (stomatin like 3 [Source:HGNC Symbol;Acc:HGNC:19420])

HSP 1 Score: 256.144 bits (653), Expect = 8.276e-83
Identity = 136/233 (58.37%), Postives = 185/233 (79.40%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCDSKH 1044
            ++I +Y+RAVVFRLGR+ + +A GPGLI+V+PC+D   ++DLRT+T ++P QE+LT+DSVT  V+ VVYYRI++ V +V NV D +++T LLAQTTLRNVLGT  L  +L  REEIA S+Q  LD AT+ WG++V RVEIKDVR+P QLQR+MAAEAEATREA+AKV+A+EGE  ++K+L+ A+  +++ PIA+QLRYLQTLS+++ EKNSTI+FPLPMN++          H
Sbjct:   43 KIIKEYERAVVFRLGRIQADKAKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDVHQATFLLAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQLQRSMAAEAEATREARAKVLAAEGEMNASKSLKSASMVLAESPIALQLRYLQTLSTVATEKNSTIVFPLPMNILEGIGGVSYDNH 275          
BLAST of PHB domain-containing protein vs. Ensembl Human
Match: STOML3 (stomatin like 3 [Source:HGNC Symbol;Acc:HGNC:19420])

HSP 1 Score: 256.144 bits (653), Expect = 1.313e-82
Identity = 136/233 (58.37%), Postives = 185/233 (79.40%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCDSKH 1044
            ++I +Y+RAVVFRLGR+ + +A GPGLI+V+PC+D   ++DLRT+T ++P QE+LT+DSVT  V+ VVYYRI++ V +V NV D +++T LLAQTTLRNVLGT  L  +L  REEIA S+Q  LD AT+ WG++V RVEIKDVR+P QLQR+MAAEAEATREA+AKV+A+EGE  ++K+L+ A+  +++ PIA+QLRYLQTLS+++ EKNSTI+FPLPMN++          H
Sbjct:   52 KIIKEYERAVVFRLGRIQADKAKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDVHQATFLLAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQLQRSMAAEAEATREARAKVLAAEGEMNASKSLKSASMVLAESPIALQLRYLQTLSTVATEKNSTIVFPLPMNILEGIGGVSYDNH 284          
BLAST of PHB domain-containing protein vs. Ensembl Human
Match: NPHS2 (NPHS2 stomatin family member, podocin [Source:HGNC Symbol;Acc:HGNC:13394])

HSP 1 Score: 184.111 bits (466), Expect = 1.341e-53
Identity = 101/230 (43.91%), Postives = 157/230 (68.26%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCD 1035
            +V+ +Y+R ++FRLG L+   A GPGL   +PCLD+  ++DLR  T ++P  E++TKD   + ++A+ YYR+ N  + + ++   +++ + L QTT++ +L    L  +L +R+ IA   + ALD  T  WG+KVER+EIKDVRLP  LQ ++A EAEA R+AK ++IA+E EK ++++LR AAE +S  P A+QLRYL TL S+S EK ST++ PLP +L+N  +S  +
Sbjct:  126 KVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEIVTKDMFIMEIDAICYYRMENASLLLSSLAHVSKAVQFLVQTTMKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSN 355          
BLAST of PHB domain-containing protein vs. Ensembl Human
Match: STOM (stomatin [Source:HGNC Symbol;Acc:HGNC:3383])

HSP 1 Score: 140.969 bits (354), Expect = 1.083e-39
Identity = 59/106 (55.66%), Postives = 87/106 (82.08%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDL 663
            ++I +Y+RA++FRLGR++   A GPGL  ++PC DS  ++D+RT++FD+P QE+LTKDSVT++V+ VVYYR+ N  ++V N+ +A+ +TRLLAQTTLRNVLGT +L
Sbjct:   55 KIIKEYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNVLGTKNL 160          
BLAST of PHB domain-containing protein vs. Ensembl Celegans
Match: mec-2 (Mechanosensory protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q27433])

HSP 1 Score: 280.411 bits (716), Expect = 3.393e-92
Identity = 146/225 (64.89%), Postives = 189/225 (84.00%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+ +Y+RAV+FRLGRL+   A GPG+  ++PC+D+ +++DLR L+F+VP QE+L+KDSVTVAV+AVVY+RI N  +SV NVEDA RST+LLAQTTLRN+LGT  L  +L DRE I+  MQ  LD AT+ WG+KVERVE+KDVRLP QLQRAMAAEAEA REA+AKVI +EGE+K+++AL+EAAE I++ P A+QLRYLQTL+SIS EKNSTIIFP P++L++ F
Sbjct:   67 KVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREAISHQMQTTLDEATEPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIVAEGEQKASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPFPIDLLSAF 291          
BLAST of PHB domain-containing protein vs. Ensembl Celegans
Match: mec-2 (Mechanosensory protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q27433])

HSP 1 Score: 282.722 bits (722), Expect = 4.539e-92
Identity = 146/225 (64.89%), Postives = 189/225 (84.00%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+ +Y+RAV+FRLGRL+   A GPG+  ++PC+D+ +++DLR L+F+VP QE+L+KDSVTVAV+AVVY+RI N  +SV NVEDA RST+LLAQTTLRN+LGT  L  +L DRE I+  MQ  LD AT+ WG+KVERVE+KDVRLP QLQRAMAAEAEA REA+AKVI +EGE+K+++AL+EAAE I++ P A+QLRYLQTL+SIS EKNSTIIFP P++L++ F
Sbjct:  142 KVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREAISHQMQTTLDEATEPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIVAEGEQKASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPFPIDLLSAF 366          
BLAST of PHB domain-containing protein vs. Ensembl Celegans
Match: mec-2 (Mechanosensory protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q27433])

HSP 1 Score: 279.641 bits (714), Expect = 1.156e-91
Identity = 146/225 (64.89%), Postives = 189/225 (84.00%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+ +Y+RAV+FRLGRL+   A GPG+  ++PC+D+ +++DLR L+F+VP QE+L+KDSVTVAV+AVVY+RI N  +SV NVEDA RST+LLAQTTLRN+LGT  L  +L DRE I+  MQ  LD AT+ WG+KVERVE+KDVRLP QLQRAMAAEAEA REA+AKVI +EGE+K+++AL+EAAE I++ P A+QLRYLQTL+SIS EKNSTIIFP P++L++ F
Sbjct:   83 KVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREAISHQMQTTLDEATEPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIVAEGEQKASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPFPIDLLSAF 307          
BLAST of PHB domain-containing protein vs. Ensembl Celegans
Match: mec-2 (Mechanosensory protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q27433])

HSP 1 Score: 279.256 bits (713), Expect = 1.541e-91
Identity = 146/225 (64.89%), Postives = 189/225 (84.00%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+ +Y+RAV+FRLGRL+   A GPG+  ++PC+D+ +++DLR L+F+VP QE+L+KDSVTVAV+AVVY+RI N  +SV NVEDA RST+LLAQTTLRN+LGT  L  +L DRE I+  MQ  LD AT+ WG+KVERVE+KDVRLP QLQRAMAAEAEA REA+AKVI +EGE+K+++AL+EAAE I++ P A+QLRYLQTL+SIS EKNSTIIFP P++L++ F
Sbjct:   75 KVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREAISHQMQTTLDEATEPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIVAEGEQKASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPFPIDLLSAF 299          
BLAST of PHB domain-containing protein vs. Ensembl Celegans
Match: sto-2 (Stomatin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q19958])

HSP 1 Score: 280.026 bits (715), Expect = 1.776e-91
Identity = 148/222 (66.67%), Postives = 189/222 (85.14%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLM 1011
            +V+ +Y+RAV+FRLGRL+   A GPG+  V+PC++S  ++DLRT++F VP QE+LTKDSVT +V+AV+YYRI N  +SV NVE+A+ STRLLAQTTLRN+LGT  L  +L DRE +AASMQ  LD AT++WG+KVERVEIKDVRLP QLQRAMAAEAEATREA+AKVIA+EGE+K+++ALR+AA  I++ P A+QLRYLQTL+S++ EKNSTIIFPLPM L+
Sbjct:  132 KVVQEYERAVIFRLGRLIGGGAKGPGIFFVLPCIESYTKVDLRTVSFSVPPQEILTKDSVTTSVDAVIYYRISNATVSVANVENAHHSTRLLAQTTLRNMLGTRSLSEILSDRETLAASMQTILDEATESWGIKVERVEIKDVRLPIQLQRAMAAEAEATREARAKVIAAEGEQKASRALRDAASVIAQSPAALQLRYLQTLNSVAAEKNSTIIFPLPMELV 353          
BLAST of PHB domain-containing protein vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0301096)

HSP 1 Score: 281.567 bits (719), Expect = 2.148e-91
Identity = 148/225 (65.78%), Postives = 187/225 (83.11%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+ +Y+RAV+FRLGRL+   A GPG+  ++PC+DS  R+DLRT T+DVP QEVLTKDSVTV+V+AVVYYR+ N  +S+ NVE+A+ STRLLAQTTLRN +GT  L  +L +R  I+ +MQ  LD ATDAWG+KVERVEIKDVRLP QLQRAMAAEAEA REA+AKVIA+EGE+K+++ALREA+E I   P A+QLRYLQTL++IS EKNSTI+FPLP++L+  F
Sbjct:   92 KVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYF 316          
BLAST of PHB domain-containing protein vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0344807)

HSP 1 Score: 281.182 bits (718), Expect = 3.398e-91
Identity = 148/225 (65.78%), Postives = 187/225 (83.11%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+ +Y+RAV+FRLGRL+   A GPG+  ++PC+DS  R+DLRT T+DVP QEVLTKDSVTV+V+AVVYYR+ N  +S+ NVE+A+ STRLLAQTTLRN +GT  L  +L +R  I+ +MQ  LD ATDAWG+KVERVEIKDVRLP QLQRAMAAEAEA REA+AKVIA+EGE+K+++ALREA+E I   P A+QLRYLQTL++IS EKNSTI+FPLP++L+  F
Sbjct:   99 KVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYF 323          
BLAST of PHB domain-containing protein vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0333584)

HSP 1 Score: 281.182 bits (718), Expect = 4.753e-91
Identity = 148/225 (65.78%), Postives = 187/225 (83.11%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+ +Y+RAV+FRLGRL+   A GPG+  ++PC+DS  R+DLRT T+DVP QEVLTKDSVTV+V+AVVYYR+ N  +S+ NVE+A+ STRLLAQTTLRN +GT  L  +L +R  I+ +MQ  LD ATDAWG+KVERVEIKDVRLP QLQRAMAAEAEA REA+AKVIA+EGE+K+++ALREA+E I   P A+QLRYLQTL++IS EKNSTI+FPLP++L+  F
Sbjct:  103 KVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYF 327          
BLAST of PHB domain-containing protein vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0333583)

HSP 1 Score: 280.411 bits (716), Expect = 5.207e-91
Identity = 148/225 (65.78%), Postives = 187/225 (83.11%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+ +Y+RAV+FRLGRL+   A GPG+  ++PC+DS  R+DLRT T+DVP QEVLTKDSVTV+V+AVVYYR+ N  +S+ NVE+A+ STRLLAQTTLRN +GT  L  +L +R  I+ +MQ  LD ATDAWG+KVERVEIKDVRLP QLQRAMAAEAEA REA+AKVIA+EGE+K+++ALREA+E I   P A+QLRYLQTL++IS EKNSTI+FPLP++L+  F
Sbjct:   87 KVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYF 311          
BLAST of PHB domain-containing protein vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0301097)

HSP 1 Score: 280.411 bits (716), Expect = 5.628e-91
Identity = 148/225 (65.78%), Postives = 187/225 (83.11%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+ +Y+RAV+FRLGRL+   A GPG+  ++PC+DS  R+DLRT T+DVP QEVLTKDSVTV+V+AVVYYR+ N  +S+ NVE+A+ STRLLAQTTLRN +GT  L  +L +R  I+ +MQ  LD ATDAWG+KVERVEIKDVRLP QLQRAMAAEAEA REA+AKVIA+EGE+K+++ALREA+E I   P A+QLRYLQTL++IS EKNSTI+FPLP++L+  F
Sbjct:   91 KVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYF 315          
BLAST of PHB domain-containing protein vs. Ensembl Zebrafish
Match: stoml3b (stomatin (EPB72)-like 3b [Source:ZFIN;Acc:ZDB-GENE-050417-366])

HSP 1 Score: 279.256 bits (713), Expect = 4.803e-92
Identity = 144/225 (64.00%), Postives = 192/225 (85.33%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RAV+FRLGR+ +R+A GPG+  +IPC DS  ++DLRT++FD+P QE+LTKDSVTV+V+ VVY+R+ +PV SV NV +A+ STRLLAQTTLRNVLGT +L  +L DRE I+ SMQ  LD ATD+WG+KVERVEIKDV+LP QLQRAMAAEAEA+REA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTL++I+ EKNSTI+FPLP+++MN F
Sbjct:   53 KIVKEYERAVIFRLGRITARKAKGPGIFFIIPCTDSFIKVDLRTVSFDIPPQEILTKDSVTVSVDGVVYFRVNDPVASVANVSNADYSTRLLAQTTLRNVLGTKNLAEVLSDREGISHSMQTTLDEATDSWGIKVERVEIKDVKLPQQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIVFPLPIDIMNHF 277          
BLAST of PHB domain-containing protein vs. Ensembl Zebrafish
Match: zgc:112408 (zgc:112408 [Source:ZFIN;Acc:ZDB-GENE-050417-63])

HSP 1 Score: 272.707 bits (696), Expect = 3.620e-89
Identity = 140/225 (62.22%), Postives = 190/225 (84.44%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+ +Y+RAV+FRLGRL+   A GPGL  +IPC+D+ +++DLRT++FD+P QEVLTKDSVT+ V+AVVYYRIFNP +S+  VE+AN +T++LAQTTLRN+LGT  L  +LKDREE++  M+  L  A+  WG+KVERVE+KDV+LPT LQRAMAAEAEA+R+A+AKVIA+EGE K+++AL+EAA  +S+ P A+QLRY+QTL+ I+ E+NSTIIFP+PM+LM+ F
Sbjct:   78 KVVQEYERAVIFRLGRLLG-GAKGPGLFWIIPCMDTFRKVDLRTVSFDIPAQEVLTKDSVTIMVDAVVYYRIFNPTVSITKVENANYATQMLAQTTLRNMLGTKSLADILKDREEMSEQMEAVLYSASKNWGIKVERVELKDVKLPTTLQRAMAAEAEASRDARAKVIAAEGEMKASRALKEAANVMSESPAALQLRYMQTLTEIASERNSTIIFPVPMDLMSGF 301          
BLAST of PHB domain-containing protein vs. Ensembl Zebrafish
Match: stom (stomatin [Source:ZFIN;Acc:ZDB-GENE-980526-486])

HSP 1 Score: 272.707 bits (696), Expect = 3.666e-89
Identity = 142/225 (63.11%), Postives = 187/225 (83.11%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RA++FRLGR++   A GPGL  ++PC DS   +D+RT+TFD+P QEVLTKDSVTV+V+ VVYYR+ N  ++V N+ +A+ +TRLLAQTTLRNVLGT +L  +L DREEIA SMQ  LD ATD WG+KVERVEIKDV+LP QLQRAMAAEAEA+REA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTL++I+ EKNSTIIFPLP+++M  F
Sbjct:   67 KIVKEYERAIIFRLGRILRGGAKGPGLFFILPCTDSFINVDMRTITFDIPPQEVLTKDSVTVSVDGVVYYRVQNATLAVANITNADAATRLLAQTTLRNVLGTKNLAEILSDREEIAHSMQSTLDDATDDWGIKVERVEIKDVKLPLQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPIDMMQSF 291          
BLAST of PHB domain-containing protein vs. Ensembl Zebrafish
Match: stom (stomatin [Source:ZFIN;Acc:ZDB-GENE-980526-486])

HSP 1 Score: 272.707 bits (696), Expect = 3.666e-89
Identity = 142/225 (63.11%), Postives = 187/225 (83.11%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RA++FRLGR++   A GPGL  ++PC DS   +D+RT+TFD+P QEVLTKDSVTV+V+ VVYYR+ N  ++V N+ +A+ +TRLLAQTTLRNVLGT +L  +L DREEIA SMQ  LD ATD WG+KVERVEIKDV+LP QLQRAMAAEAEA+REA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTL++I+ EKNSTIIFPLP+++M  F
Sbjct:   67 KIVKEYERAIIFRLGRILRGGAKGPGLFFILPCTDSFINVDMRTITFDIPPQEVLTKDSVTVSVDGVVYYRVQNATLAVANITNADAATRLLAQTTLRNVLGTKNLAEILSDREEIAHSMQSTLDDATDDWGIKVERVEIKDVKLPLQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPIDMMQSF 291          
BLAST of PHB domain-containing protein vs. Ensembl Zebrafish
Match: zgc:112408 (zgc:112408 [Source:ZFIN;Acc:ZDB-GENE-050417-63])

HSP 1 Score: 272.322 bits (695), Expect = 3.747e-89
Identity = 140/225 (62.22%), Postives = 190/225 (84.44%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+ +Y+RAV+FRLGRL+   A GPGL  +IPC+D+ +++DLRT++FD+P QEVLTKDSVT+ V+AVVYYRIFNP +S+  VE+AN +T++LAQTTLRN+LGT  L  +LKDREE++  M+  L  A+  WG+KVERVE+KDV+LPT LQRAMAAEAEA+R+A+AKVIA+EGE K+++AL+EAA  +S+ P A+QLRY+QTL+ I+ E+NSTIIFP+PM+LM+ F
Sbjct:   65 KVVQEYERAVIFRLGRLLG-GAKGPGLFWIIPCMDTFRKVDLRTVSFDIPAQEVLTKDSVTIMVDAVVYYRIFNPTVSITKVENANYATQMLAQTTLRNMLGTKSLADILKDREEMSEQMEAVLYSASKNWGIKVERVELKDVKLPTTLQRAMAAEAEASRDARAKVIAAEGEMKASRALKEAANVMSESPAALQLRYMQTLTEIASERNSTIIFPVPMDLMSGF 288          
BLAST of PHB domain-containing protein vs. Ensembl Xenopus
Match: myo10.2 (myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995373])

HSP 1 Score: 271.937 bits (694), Expect = 3.188e-89
Identity = 140/225 (62.22%), Postives = 187/225 (83.11%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RA++FRLGR++   A GPGL  V+PC DS   +D+RT++FD+P QE+LTKDSVTV+V+ VVYYR+ N  ++V N+ +A+ +TRLLAQTTLRNVLGT +L  +L DREEIA +MQ  LD+ATD WG+KVERVEIKDV+LP QLQRAMAAEAEA REA+AKVIA+EGE  +++AL+EA+  IS+ P A+QLRYLQTL++I+ EKNSTI+FPLP++L+  F
Sbjct:   37 KIVKEYERAIIFRLGRILRGGAKGPGLFFVLPCTDSFINVDMRTISFDIPPQEILTKDSVTVSVDGVVYYRVNNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDVATDDWGIKVERVEIKDVKLPVQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASIVISESPAALQLRYLQTLTTIASEKNSTIVFPLPLDLLKGF 261          
BLAST of PHB domain-containing protein vs. Ensembl Xenopus
Match: myo10.2 (myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995373])

HSP 1 Score: 271.552 bits (693), Expect = 6.332e-89
Identity = 140/225 (62.22%), Postives = 187/225 (83.11%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RA++FRLGR++   A GPGL  V+PC DS   +D+RT++FD+P QE+LTKDSVTV+V+ VVYYR+ N  ++V N+ +A+ +TRLLAQTTLRNVLGT +L  +L DREEIA +MQ  LD+ATD WG+KVERVEIKDV+LP QLQRAMAAEAEA REA+AKVIA+EGE  +++AL+EA+  IS+ P A+QLRYLQTL++I+ EKNSTI+FPLP++L+  F
Sbjct:   44 KIVKEYERAIIFRLGRILRGGAKGPGLFFVLPCTDSFINVDMRTISFDIPPQEILTKDSVTVSVDGVVYYRVNNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDVATDDWGIKVERVEIKDVKLPVQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASIVISESPAALQLRYLQTLTTIASEKNSTIVFPLPLDLLKGF 268          
BLAST of PHB domain-containing protein vs. Ensembl Xenopus
Match: myo10.2 (myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995373])

HSP 1 Score: 272.322 bits (695), Expect = 7.703e-89
Identity = 140/225 (62.22%), Postives = 187/225 (83.11%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RA++FRLGR++   A GPGL  V+PC DS   +D+RT++FD+P QE+LTKDSVTV+V+ VVYYR+ N  ++V N+ +A+ +TRLLAQTTLRNVLGT +L  +L DREEIA +MQ  LD+ATD WG+KVERVEIKDV+LP QLQRAMAAEAEA REA+AKVIA+EGE  +++AL+EA+  IS+ P A+QLRYLQTL++I+ EKNSTI+FPLP++L+  F
Sbjct:   76 KIVKEYERAIIFRLGRILRGGAKGPGLFFVLPCTDSFINVDMRTISFDIPPQEILTKDSVTVSVDGVVYYRVNNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDVATDDWGIKVERVEIKDVKLPVQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASIVISESPAALQLRYLQTLTTIASEKNSTIVFPLPLDLLKGF 300          
BLAST of PHB domain-containing protein vs. Ensembl Xenopus
Match: atp8b3 (ATPase, aminophospholipid transporter, class I, type 8B, member 3 [Source:Xenbase;Acc:XB-GENE-992174])

HSP 1 Score: 244.588 bits (623), Expect = 3.096e-78
Identity = 129/227 (56.83%), Postives = 181/227 (79.74%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNS 1026
            ++I +Y+RAVVFRLGR++S +A GPG++ V+PC D+  ++DLR ++F +P QE+LTKDSVT  V+ VVYY I + + +V NV + + +T+ LAQTTLRN+LGT  L ++L +REEIA ++Q  LD AT  WG+KV+RVE++DVRLP Q+QRAMAAEAEA REA+AKV+A+EGE  +++AL+EA+  I++ P A+QLRYLQTL++I+ E NSTI+FPLP+ LM  F S
Sbjct:   55 KIIQEYERAVVFRLGRIISGKAKGPGVMFVLPCTDTFIKVDLRVISFAIPPQEILTKDSVTTTVDGVVYYNIQSAIKAVANVNNVHIATQQLAQTTLRNILGTQTLANILANREEIAHNIQSILDHATHKWGVKVDRVEMRDVRLPVQMQRAMAAEAEAAREARAKVVAAEGEMNASRALKEASLVIAESPAALQLRYLQTLNTIAAENNSTIVFPLPIELMQGFLS 281          
BLAST of PHB domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000046764.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:22368844:22379341:1 gene:ENSXETG00000020360.1 transcript:ENSXETT00000046764.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 229.95 bits (585), Expect = 1.599e-73
Identity = 123/204 (60.29%), Postives = 170/204 (83.33%), Query Frame = 1
Query:  409 ALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            A GPG+  V+PC D++K +D+RT++F VP QEVLTKDSVT+ V+AVV+YR+FNP ++VV V++A+++T++LAQTTLRN+LGT  L  +L +REE+A  M + L  AT  WG++VERVEIKDV+LP  LQRAMAAEAEA+R+A+AKVIA+EGE  ++++L+EAA  +S+ P A+QLRYLQTLS IS EKNSTI+FP+PM++++M 
Sbjct:    3 AKGPGVFWVLPCADNIKIVDIRTVSFAVPPQEVLTKDSVTIMVDAVVFYRVFNPTVAVVKVDNASQATQMLAQTTLRNMLGTKSLTQILVEREEMAEQMSKILYEATRDWGIRVERVEIKDVKLPQSLQRAMAAEAEASRDARAKVIAAEGEMNASRSLKEAALIMSETPAALQLRYLQTLSHISAEKNSTIVFPVPMDIISML 206          
BLAST of PHB domain-containing protein vs. Ensembl Mouse
Match: Stom (stomatin [Source:MGI Symbol;Acc:MGI:95403])

HSP 1 Score: 265.388 bits (677), Expect = 1.601e-86
Identity = 134/222 (60.36%), Postives = 184/222 (82.88%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLM 1011
            +++ +Y+R ++FRLGR++   A GPGL  ++PC DS+ ++D+RT++FD+P QEVLTKDSVT++V+ VVYYR+ N  ++V N+ +A+ +TRLLAQTTLRN LGT +L  +L DREEIA  MQ  LD ATD WG+KVERVEIKDV+LP QLQRAMAAEAEA REA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTL++I+ EKNSTI+FPLP++++
Sbjct:   55 KIVKEYERVIIFRLGRILQGGAKGPGLFFILPCTDSLIKVDMRTISFDIPPQEVLTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNALGTKNLSQILSDREEIAHHMQSTLDDATDDWGIKVERVEIKDVKLPVQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQTLTTIAAEKNSTIVFPLPVDML 276          
BLAST of PHB domain-containing protein vs. Ensembl Mouse
Match: Stoml3 (stomatin (Epb7.2)-like 3 [Source:MGI Symbol;Acc:MGI:2388072])

HSP 1 Score: 254.218 bits (648), Expect = 4.574e-82
Identity = 133/222 (59.91%), Postives = 184/222 (82.88%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLM 1011
            ++I +Y+RAVVFRLGR+ + +A GPGLI+V+PC+D   ++DLRT+T ++P QE+LT+DSVT  V+ VVYYRI++ V +V NV D +++T LLAQTTLRNVLGT  L  +L  REEIA S+Q  LD AT+ WG++V RVEIKDVR+P QLQR+MAAEAEATREA+AKV+A+EGE  ++K+L+ A+  +++ P+A+QLRYLQTL++++ EKNSTI+FPLPMN++
Sbjct:   48 KIIKEYERAVVFRLGRIQADKAKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDVHQATFLLAQTTLRNVLGTQTLSQILSGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQLQRSMAAEAEATREARAKVLAAEGEMNASKSLKSASMVLAESPVALQLRYLQTLTTVATEKNSTIVFPLPMNIL 269          
BLAST of PHB domain-containing protein vs. Ensembl Mouse
Match: Nphs2 (nephrosis 2, podocin [Source:MGI Symbol;Acc:MGI:2157018])

HSP 1 Score: 199.134 bits (505), Expect = 1.902e-59
Identity = 102/227 (44.93%), Postives = 158/227 (69.60%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNS 1026
            +V+ +Y+R ++FRLG L+   A GPGL   +PCLD+  ++DLR  T ++P  EV+TKD   + ++AV YYR+ N  + + ++   +++ + L QTT++ +L    L  +L +R+ IA  ++ ALD  T  WG+KVER EIKDVRLP  LQ ++A EAEA R+AK +VIA+EGEK ++++LR AAE +S  P A+QLRYL TL S+S EK +T++ PLP +++++ +S
Sbjct:  128 KVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVVTKDMFIMEIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLLAHRSLTEILLERKSIAQDVKVALDAVTCIWGIKVERTEIKDVRLPAGLQHSLAVEAEAQRQAKVRVIAAEGEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPATVVLPLPFDMLSLLSS 354          
BLAST of PHB domain-containing protein vs. Ensembl Mouse
Match: Nphs2 (nephrosis 2, podocin [Source:MGI Symbol;Acc:MGI:2157018])

HSP 1 Score: 146.747 bits (369), Expect = 6.749e-41
Identity = 76/227 (33.48%), Postives = 127/227 (55.95%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNS 1026
            +V+ +Y+R ++FRLG L+   A GPGL   +PCLD+  ++DLR  T ++P  EV+TKD   + ++AV YYR+ N  + + ++   +++ + L QTT++ +L    L  +L +R+ IA                       +DV+                      VIA+EGEK ++++LR AAE +S  P A+QLRYL TL S+S EK +T++ PLP +++++ +S
Sbjct:   53 KVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVVTKDMFIMEIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLLAHRSLTEILLERKSIA-----------------------QDVK----------------------VIAAEGEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPATVVLPLPFDMLSLLSS 234          
BLAST of PHB domain-containing protein vs. Ensembl Mouse
Match: Stoml2 (stomatin (Epb7.2)-like 2 [Source:MGI Symbol;Acc:MGI:1913842])

HSP 1 Score: 109.383 bits (272), Expect = 3.041e-26
Identity = 64/176 (36.36%), Postives = 109/176 (61.93%), Query Frame = 1
Query:  352 IAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRI-DLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSA 876
            + Q +  VV R+GR      L PGL ++IP LD ++ +  L+ +  +VP Q  +T D+VT+ ++ V+Y RI +P  +   VED   +   LAQTT+R+ LG + L  + ++RE + A++ +A++ A D WG++  R EIKD+ +P +++ +M  + EA R  +A V+ SEG ++SA
Sbjct:   41 VPQQEAWVVERMGRF--HRILEPGLNVLIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNANIVDAINQAADCWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEGTRESA 214          
BLAST of PHB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q16TM5|BND7A_AEDAE (Band 7 protein AAEL010189 OS=Aedes aegypti OX=7159 GN=AAEL010189 PE=3 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 2.609e-92
Identity = 149/231 (64.50%), Postives = 191/231 (82.68%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCDS 1038
            +V+ +Y+RAV+FRLGRLV   A GPG+  ++PC+D+  R+DLRT T+DVP QEVLTKDSVTV+V+AVVYYR+ N  +S+ NVE+A+ STRLLAQTTLRN +GT  L  +L +R  I+ SMQ +LD AT+AWG+KVERVEIKDVRLP QLQRAMAAEAEA REA+AKVIA+EGE+K+++ALREA+E I   P A+QLRYLQTL++IS EKNSTI+FPLP++++  F  S +S
Sbjct:   59 KVVQEYERAVIFRLGRLVQGGAKGPGIFFILPCIDAYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGSMQLSLDEATEAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDILTYFMKSKES 289          
BLAST of PHB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7PPU9|BND7A_ANOGA (Band 7 protein AGAP004871 OS=Anopheles gambiae OX=7165 GN=AGAP004871 PE=3 SV=3)

HSP 1 Score: 279.641 bits (714), Expect = 3.397e-91
Identity = 150/246 (60.98%), Postives = 195/246 (79.27%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCDSKHVNSLKTSSMFVPS 1083
            +V+ +Y+RAV+FRLGRL+   A GPG+  ++PC+D+  R+DLRT T+DVP QEVLTKDSVTV+V+AVVYYR+ N  +S+ NVE+A+ STRLLAQTTLRN +GT  L  +L +R  I+ SMQ +LD AT+AWG+KVERVEIKDVRLP QLQRAMAAEAEA REA+AKVIA+EGE+K+++ALREA+E I   P A+QLRYLQTL++IS EKNSTI+FPLP++++  F           +K+   FVP+
Sbjct:   45 KVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDAYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGSMQLSLDEATEAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDILTYF-----------MKSKEAFVPN 279          
BLAST of PHB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q19958|STO2_CAEEL (Stomatin-2 OS=Caenorhabditis elegans OX=6239 GN=sto-2 PE=3 SV=4)

HSP 1 Score: 279.641 bits (714), Expect = 5.463e-90
Identity = 148/222 (66.67%), Postives = 189/222 (85.14%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLM 1011
            +V+ +Y+RAV+FRLGRL+   A GPG+  V+PC++S  ++DLRT++F VP QE+LTKDSVT +V+AV+YYRI N  +SV NVE+A+ STRLLAQTTLRN+LGT  L  +L DRE +AASMQ  LD AT++WG+KVERVEIKDVRLP QLQRAMAAEAEATREA+AKVIA+EGE+K+++ALR+AA  I++ P A+QLRYLQTL+S++ EKNSTIIFPLPM L+
Sbjct:  149 KVVQEYERAVIFRLGRLIGGGAKGPGIFFVLPCIESYTKVDLRTVSFSVPPQEILTKDSVTTSVDAVIYYRISNATVSVANVENAHHSTRLLAQTTLRNMLGTRSLSEILSDRETLAASMQTILDEATESWGIKVERVEIKDVRLPIQLQRAMAAEAEATREARAKVIAAEGEQKASRALRDAASVIAQSPAALQLRYLQTLNSVAAEKNSTIIFPLPMELV 370          
BLAST of PHB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VZA4|BND7A_DROME (Band 7 protein CG42540 OS=Drosophila melanogaster OX=7227 GN=CG42540 PE=2 SV=2)

HSP 1 Score: 283.108 bits (723), Expect = 1.165e-89
Identity = 148/225 (65.78%), Postives = 187/225 (83.11%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+ +Y+RAV+FRLGRL+   A GPG+  ++PC+DS  R+DLRT T+DVP QEVLTKDSVTV+V+AVVYYR+ N  +S+ NVE+A+ STRLLAQTTLRN +GT  L  +L +R  I+ +MQ  LD ATDAWG+KVERVEIKDVRLP QLQRAMAAEAEA REA+AKVIA+EGE+K+++ALREA+E I   P A+QLRYLQTL++IS EKNSTI+FPLP++L+  F
Sbjct:  199 KVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYF 423          
BLAST of PHB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q27433|MEC2_CAEEL (Mechanosensory protein 2 OS=Caenorhabditis elegans OX=6239 GN=mec-2 PE=1 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 1.481e-89
Identity = 146/225 (64.89%), Postives = 189/225 (84.00%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+ +Y+RAV+FRLGRL+   A GPG+  ++PC+D+ +++DLR L+F+VP QE+L+KDSVTVAV+AVVY+RI N  +SV NVEDA RST+LLAQTTLRN+LGT  L  +L DRE I+  MQ  LD AT+ WG+KVERVE+KDVRLP QLQRAMAAEAEA REA+AKVI +EGE+K+++AL+EAAE I++ P A+QLRYLQTL+SIS EKNSTIIFP P++L++ F
Sbjct:  142 KVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREAISHQMQTTLDEATEPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIVAEGEQKASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPFPIDLLSAF 366          
BLAST of PHB domain-containing protein vs. TrEMBL
Match: A0A068X2I1 (Mechanosensory protein 2 OS=Echinococcus granulosus OX=6210 GN=EgrG_000382000 PE=4 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 1.802e-118
Identity = 207/296 (69.93%), Postives = 241/296 (81.42%), Query Frame = 1
Query:  166 NSKHKGQLKRTFSLVPERFDSDQNSNFSNKQ---------GIIICETXXXXXXXXXXXXXXXXXXXXXXRVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNS 1026
            +S  +  LKR FSLVPERF   Q +   N++         G +ICE LLK   + L+I++ P SL   LRVI QY+RAV+FRLGRL+S  ALGPGLI  +P LD M+R+DLRT TFDVPTQEVLTKDSVTVAVEAVVYYRIF+PVMSVVNVE+ANRSTRLLAQTTLRNVLGTVDL +LL DREEIAA MQE LD ATD WG+KVERVEIKDVRLP QLQRAMAAEAEATREA+AKVIA++GE+ S+K+L+ AA EIS CPIA+QLRYLQTL+ IS EKNSTI+FPLP++L+N+F  
Sbjct:    9 HSPVRKPLKRGFSLVPERFTDTQLAALRNRRVARESLSVIGALICERLLKILAIALVIISLPFSLLACLRVIPQYERAVIFRLGRLISSSALGPGLIFKLPFLDRMRRVDLRTFTFDVPTQEVLTKDSVTVAVEAVVYYRIFDPVMSVVNVENANRSTRLLAQTTLRNVLGTVDLYALLTDREEIAAMMQETLDTATDTWGVKVERVEIKDVRLPLQLQRAMAAEAEATREARAKVIAAKGEEDSSKSLKAAAMEISACPIALQLRYLQTLAGISAEKNSTIVFPLPIDLLNLFRG 304          
BLAST of PHB domain-containing protein vs. TrEMBL
Match: A0A0R3SW14 (PHB domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9816 PE=4 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 1.864e-118
Identity = 208/306 (67.97%), Postives = 246/306 (80.39%), Query Frame = 1
Query:  154 QIQLNSKHKGQLKRTFSLVPERFDSDQNSNFSNKQ---------GIIICETXXXXXXXXXXXXXXXXXXXXXXRVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCDSKH 1044
            +  ++S  +  LKR FSLVPERF   Q +   N++         G +ICE LLK   + L+I+ FP SL   LRVI QY+RAV+FRLGRL+S  ALGPGLI  +P LD M+R+DLRT TFDVPTQEVLTKDSVTVAVEAVVYYRIF+PVMSVVNVE+ANRSTRLLAQTTLRNVLGTVDL +LL DREEIAA MQE LD ATD WG+KVERVEIKDVRLP QLQRAMAAEAEATREA+AKVIA++GE+ ++K+L+ AA EIS CPIA+QLRYLQTL+ IS EKNSTI+FPLP++L+N+F  + + K 
Sbjct:    6 ETDVHSPSRKPLKRGFSLVPERFTDTQLAALRNRRVARESLSVIGTLICERLLKILTIALVIVGFPFSLLACLRVIPQYERAVIFRLGRLISSSALGPGLIFKLPFLDRMRRVDLRTFTFDVPTQEVLTKDSVTVAVEAVVYYRIFDPVMSVVNVENANRSTRLLAQTTLRNVLGTVDLYALLTDREEIAAMMQETLDTATDTWGVKVERVEIKDVRLPLQLQRAMAAEAEATREARAKVIAAKGEEDASKSLKAAALEISACPIALQLRYLQTLAGISAEKNSTIVFPLPIDLLNLFRGAENLKQ 311          
BLAST of PHB domain-containing protein vs. TrEMBL
Match: A0A068XWD3 (Mechanosensory protein 2 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000382000 PE=4 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 4.168e-118
Identity = 206/296 (69.59%), Postives = 241/296 (81.42%), Query Frame = 1
Query:  166 NSKHKGQLKRTFSLVPERFDSDQNSNFSNKQ---------GIIICETXXXXXXXXXXXXXXXXXXXXXXRVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNS 1026
            +S  +  LKR FSLVPERF   Q +   N++         G +ICE LLK   + L+I++ P SL   LRVI QY+RAV+FRLGRL+S  ALGPGLI  +P LD M+R+DLRT TFDVPTQEVLTKDSVTVAVEAVVYYRIF+PVMSVVNVE+ANRSTRLLAQTTLRNVLGTVDL +LL DREEIAA MQE LD ATD WG+KVERVEIKDVRLP QLQRAMAAEAEATREA+AKVIA++GE+ ++K+L+ AA EIS CPIA+QLRYLQTL+ IS EKNSTI+FPLP++L+N+F  
Sbjct:    9 HSPVRKPLKRGFSLVPERFTDTQLAALRNRRVARESLSVIGALICERLLKILAIALVIISLPFSLLACLRVIPQYERAVIFRLGRLISSSALGPGLIFKLPFLDRMRRVDLRTFTFDVPTQEVLTKDSVTVAVEAVVYYRIFDPVMSVVNVENANRSTRLLAQTTLRNVLGTVDLYALLTDREEIAAMMQETLDTATDTWGVKVERVEIKDVRLPLQLQRAMAAEAEATREARAKVIAAKGEEDASKSLKAAAMEISACPIALQLRYLQTLAGISAEKNSTIVFPLPIDLLNLFRG 304          
BLAST of PHB domain-containing protein vs. TrEMBL
Match: W6URQ5 (Band 7 protein OS=Echinococcus granulosus OX=6210 GN=EGR_09059 PE=4 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 4.260e-118
Identity = 206/296 (69.59%), Postives = 241/296 (81.42%), Query Frame = 1
Query:  166 NSKHKGQLKRTFSLVPERFDSDQNSNFSNKQ---------GIIICETXXXXXXXXXXXXXXXXXXXXXXRVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNS 1026
            +S  +  LKR FSLVPERF   Q +   N++         G +ICE LLK   + L+I++ P SL   LRVI QY+RAV+FRLGRL+S  ALGPGLI  +P LD M+R+DLRT TFDVPTQEVLTKDSVTVAVEAVVYYRIF+PVMSVVNVE+ANRSTRLLAQTTLRNVLGTVDL +LL DREEIAA MQE LD ATD WG+KVERVEIKDVRLP QLQRAMAAEAEATREA+AKVIA++GE+ ++K+L+ AA EIS CPIA+QLRYLQTL+ IS EKNSTI+FPLP++L+N+F  
Sbjct:    9 HSPVRKPLKRGFSLVPERFTDTQLAALRNRRVARESLSVIGALICERLLKILAIALVIISLPFSLLACLRVIPQYERAVIFRLGRLISSSALGPGLIFKLPFLDRMRRVDLRTFTFDVPTQEVLTKDSVTVAVEAVVYYRIFDPVMSVVNVENANRSTRLLAQTTLRNVLGTVDLYALLTDREEIAAMMQETLDTATDTWGVKVERVEIKDVRLPLQLQRAMAAEAEATREARAKVIAAKGEEDASKSLKAAAMEISACPIALQLRYLQTLAGISAEKNSTIVFPLPIDLLNLFRG 304          
BLAST of PHB domain-containing protein vs. TrEMBL
Match: A0A0X3P2L8 (PHB domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR142696 PE=4 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 1.862e-117
Identity = 207/321 (64.49%), Postives = 255/321 (79.44%), Query Frame = 1
Query:  163 LNSKHKGQLKRTFSLVPERFDSDQNSNFSNKQG-----IIICETXXXXXXXXXXXXXXXXXXXXXXRVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCDSKHVNSLKTSSMFVPSTHQKPDEIE 1110
            LNS+ + Q+KR FSLVPERF +    +FS + G     +++CE +LK    + +++ FP SL    RVI QY+RAV+FRLGRL+S  A+GPGLI  +P LD M+R+DLRT TFDVPTQEVLTKDSVTVAVEAVVYYRIF+P+M+VVNVE+ANRSTRLLAQTTLRNVLGTVDL SLL D EEIAA MQE LD ATD WG+KVERVEIKDVRLP QLQRAMAAEAEATREA+AKVIA++GE+ ++++L+ AA+EI+ CPIA+QLRYLQTL+SIS EKNSTI+FPLPM+L+++F S+   + V S   S+   P  +   D  E
Sbjct:   11 LNSRRR-QMKRGFSLVPERFSTPLPEHFSTRGGFSVAAMLLCEEVLKFLSTVFVLVAFPFSLLFCFRVIPQYERAVIFRLGRLISSSAVGPGLIFKLPFLDRMRRVDLRTFTFDVPTQEVLTKDSVTVAVEAVVYYRIFDPIMAVVNVENANRSTRLLAQTTLRNVLGTVDLYSLLTDLEEIAAMMQETLDSATDTWGVKVERVEIKDVRLPLQLQRAMAAEAEATREARAKVIAAKGEEDASRSLKLAAQEIAICPIALQLRYLQTLASISAEKNSTIVFPLPMDLLSLFRSALLRRCVTSPPPSNRLPPGKNGGDDLAE 330          
BLAST of PHB domain-containing protein vs. Ensembl Cavefish
Match: stom (stomatin [Source:NCBI gene;Acc:103034070])

HSP 1 Score: 273.478 bits (698), Expect = 8.102e-90
Identity = 143/225 (63.56%), Postives = 186/225 (82.67%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RA++FRLGR++   A GPGL  ++PC DS   +D+RT+TFD+P QEVLTKDSVTV+V+ VVYYR+ N  ++V N+ +A+ +TRLLAQTTLRNVLGT +L  +L DREEIA SMQ  LD ATD WG+KVERVEIKDV+LP QLQRAMAAEAEA REA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTL++I+ EKNSTIIFPLPM++M  F
Sbjct:   57 KIVKEYERAIIFRLGRILRGGAKGPGLFFILPCTDSFINVDMRTITFDIPPQEVLTKDSVTVSVDGVVYYRVQNATLAVANITNADAATRLLAQTTLRNVLGTKNLAEILSDREEIAHSMQSTLDEATDDWGIKVERVEIKDVKLPLQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPMDMMQSF 281          
BLAST of PHB domain-containing protein vs. Ensembl Cavefish
Match: stom (stomatin [Source:NCBI gene;Acc:103034070])

HSP 1 Score: 273.863 bits (699), Expect = 8.936e-90
Identity = 143/225 (63.56%), Postives = 186/225 (82.67%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RA++FRLGR++   A GPGL  ++PC DS   +D+RT+TFD+P QEVLTKDSVTV+V+ VVYYR+ N  ++V N+ +A+ +TRLLAQTTLRNVLGT +L  +L DREEIA SMQ  LD ATD WG+KVERVEIKDV+LP QLQRAMAAEAEA REA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTL++I+ EKNSTIIFPLPM++M  F
Sbjct:   65 KIVKEYERAIIFRLGRILRGGAKGPGLFFILPCTDSFINVDMRTITFDIPPQEVLTKDSVTVSVDGVVYYRVQNATLAVANITNADAATRLLAQTTLRNVLGTKNLAEILSDREEIAHSMQSTLDEATDDWGIKVERVEIKDVKLPLQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPMDMMQSF 289          
BLAST of PHB domain-containing protein vs. Ensembl Cavefish
Match: stom (stomatin [Source:NCBI gene;Acc:103034070])

HSP 1 Score: 273.863 bits (699), Expect = 9.641e-90
Identity = 143/225 (63.56%), Postives = 186/225 (82.67%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RA++FRLGR++   A GPGL  ++PC DS   +D+RT+TFD+P QEVLTKDSVTV+V+ VVYYR+ N  ++V N+ +A+ +TRLLAQTTLRNVLGT +L  +L DREEIA SMQ  LD ATD WG+KVERVEIKDV+LP QLQRAMAAEAEA REA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTL++I+ EKNSTIIFPLPM++M  F
Sbjct:   63 KIVKEYERAIIFRLGRILRGGAKGPGLFFILPCTDSFINVDMRTITFDIPPQEVLTKDSVTVSVDGVVYYRVQNATLAVANITNADAATRLLAQTTLRNVLGTKNLAEILSDREEIAHSMQSTLDEATDDWGIKVERVEIKDVKLPLQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPMDMMQSF 287          
BLAST of PHB domain-containing protein vs. Ensembl Cavefish
Match: stoml3b (stomatin (EPB72)-like 3b [Source:ZFIN;Acc:ZDB-GENE-050417-366])

HSP 1 Score: 273.863 bits (699), Expect = 4.217e-89
Identity = 139/225 (61.78%), Postives = 191/225 (84.89%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RAV+FRLGR+ +R+A GPG+  ++PC DS  ++D+RT++FD+P QE+LTKDSVTV+V+ VVY+R+ +P+ SV NV +A+ STRLLAQTTLRNVLGT +L  +L DRE I+ SMQ  LD ATD+WG+KVERVEIKDV+LP QLQRAMAAEAEA+REA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTL++I+ EKNST+IFP+PM+++  F
Sbjct:  116 KIVQEYERAVIFRLGRITARKAKGPGIFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTVSVDGVVYFRVSDPIASVANVTNADYSTRLLAQTTLRNVLGTKNLAEVLSDREGISHSMQSTLDEATDSWGIKVERVEIKDVKLPQQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTVIFPVPMDILGHF 340          
BLAST of PHB domain-containing protein vs. Ensembl Cavefish
Match: stoml3a (stomatin (EPB72)-like 3a [Source:ZFIN;Acc:ZDB-GENE-070620-18])

HSP 1 Score: 266.544 bits (680), Expect = 8.176e-88
Identity = 139/224 (62.05%), Postives = 186/224 (83.04%), Query Frame = 1
Query:  349 VIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            ++ +Y+RAV+FRLGR++ R+  GPG+  ++PC D+M ++DLR  +FD+P QE+LTKDSVTV V+ VVY+R+ +P+MSV NV +A+ STRLLAQTTLRNVLGT  L  +L DRE I+ +MQ +LD AT  WG+KVERVEIKDV+LP QLQRAMAAEAEA+REA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTL++I+ EKNSTIIFPLPM+++  F
Sbjct:    5 IVQEYERAVIFRLGRILDRKPKGPGMFFLLPCTDTMTKVDLRAKSFDIPPQEILTKDSVTVCVDGVVYFRVSDPIMSVANVVNADMSTRLLAQTTLRNVLGTKSLAEVLSDRESISHNMQISLDEATHPWGIKVERVEIKDVKLPQQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVIAESPSALQLRYLQTLNTIASEKNSTIIFPLPMDMLQPF 228          
BLAST of PHB domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008297.1 (pep scaffold:Pmarinus_7.0:GL485275:4696:10707:1 gene:ENSPMAG00000007488.1 transcript:ENSPMAT00000008297.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 264.618 bits (675), Expect = 6.759e-87
Identity = 137/228 (60.09%), Postives = 187/228 (82.02%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSS 1029
            +++ +Y+RAV+F LGR+    A GPGL  ++PC D+  ++D+RT+ FD+P QE+LTKDSVTV+V+ VVYYR+ N ++SV N+ +AN +T+LLAQTTLRNVLGT +L  +L DREEIA +MQ  LD ATD WG+K+ERV+IKDV+LP QLQRAMAAEAEATREA+AKVI++EGE  +++AL+EAA+ + + P A+QLRYLQTL++I+ E+NSTIIFPLPM+L+    +S
Sbjct:   55 KIVQEYERAVIFTLGRIKPGGAKGPGLFWIVPCTDNFVKVDMRTVNFDIPPQEILTKDSVTVSVDGVVYYRVQNAILSVANITNANSATQLLAQTTLRNVLGTKNLAEILSDREEIAHTMQLTLDEATDNWGIKLERVDIKDVKLPQQLQRAMAAEAEATREARAKVISAEGEMNASRALKEAAQVMGEAPAAMQLRYLQTLNTIAAERNSTIIFPLPMDLLQGMGAS 282          
BLAST of PHB domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006522.1 (pep scaffold:Pmarinus_7.0:GL477331:35910:45947:-1 gene:ENSPMAG00000005879.1 transcript:ENSPMAT00000006522.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 251.906 bits (642), Expect = 3.910e-82
Identity = 134/231 (58.01%), Postives = 189/231 (81.82%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCDS 1038
            +V+ +Y+RAVVFRLG+L+   A+GPGL +V+PC+D+  ++D+RT+TFDVP QE+LT+DSVTVAV+AVVYYR+ +   +V NV  A+ +TRLLAQT LRNVLGT  L  ++ +RE IA SMQ +LD AT+ WG+KV+RVEIKDVRLP+Q+QRAMAAEAEA REA+AKV+++EGE  ++++L+EAA  + +   A+QLRYLQTL++I+ E+NSTIIFP+P+++++   S+  S
Sbjct:   46 KVVREYERAVVFRLGKLLPGGAIGPGLFLVLPCIDTFVKVDMRTVTFDVPPQEILTRDSVTVAVDAVVYYRVHDATAAVTNVVFADGATRLLAQTALRNVLGTRSLSDIVSEREVIARSMQTSLDEATEPWGIKVQRVEIKDVRLPSQMQRAMAAEAEAIREARAKVVSAEGEMNASRSLKEAAIVLGESSGALQLRYLQTLNNIAAERNSTIIFPIPIDILSALRSNSSS 276          
BLAST of PHB domain-containing protein vs. Ensembl Sea Lamprey
Match: NPHS2 (NPHS2 stomatin family member, podocin [Source:HGNC Symbol;Acc:HGNC:13394])

HSP 1 Score: 151.369 bits (381), Expect = 9.308e-44
Identity = 86/205 (41.95%), Postives = 135/205 (65.85%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSI 960
            +V+ +Y+RAV+FRLGRL+S  A GPGL  ++PCLD+ +++DLR  T +VP  EV+T DS++V V    +YR+    +  V+V     +  L+ Q  +R ++   DL  +L+ R E+A   +E LD    +WG+KVER EI DVR+P +LQ+++  EA+A R A+A++IA++ EK++A  L  AA  ++  P A+ LRYL TL ++
Sbjct:   29 QVVYEYERAVIFRLGRLLSVRANGPGLFFILPCLDTYQKVDLRMRTLEVPLHEVITSDSLSVRVSVACHYRVERASIWAVSVAQPLEALGLVLQAKVRALVAKKDLSYILQHRPELAQHTKECLDAVVGSWGIKVERAEINDVRIPLELQKSVCVEADANRAARARLIAAQAEKQTALELSGAARVLAAVPGALSLRYLHTLDAL 233          
BLAST of PHB domain-containing protein vs. Ensembl Sea Lamprey
Match: stoml2 (stomatin (EPB72)-like 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1139])

HSP 1 Score: 105.916 bits (263), Expect = 4.110e-26
Identity = 53/142 (37.32%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  373 VVFRLGRLVSREALGPGLIIVIPCLDSMKRI-DLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQ 795
            ++ R+GR      L PGL ++IP +D +K +  L+ +  D+P Q  +T D+VT+ ++ V+Y RI +P  +   VED   +   LAQTT+R+ LG + L S+ K+RE + A++ E ++ A + WG++  R EIKD+ LPT+++
Sbjct:   57 IIERMGRF--HRVLRPGLNLLIPIIDRIKYVQSLKEIVIDIPEQSAITLDNVTLQLDGVLYLRIMDPFKASYGVEDPEYAVTQLAQTTMRSELGKIALDSVFKERESLNANIVEVINGAAEVWGIRCLRYEIKDMELPTRVK 196          
BLAST of PHB domain-containing protein vs. Ensembl Sea Lamprey
Match: stoml1 (stomatin (EPB72)-like 1 [Source:ZFIN;Acc:ZDB-GENE-070209-241])

HSP 1 Score: 105.916 bits (263), Expect = 1.303e-25
Identity = 54/140 (38.57%), Postives = 85/140 (60.71%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEI 765
            +++ Q++R VVFRLGRL  R  LGPG+ +V+PC+D  +R+D R   F+VP    +T+D   V+V A V  R+  PV+ +   +D NRS+R  A T L ++L    L  L  +  ++A  +   +   T+ WG++VERVE+
Sbjct:   75 KIVPQHERIVVFRLGRL--RAPLGPGVALVLPCIDRWRRVDTRPRAFNVPPCRAMTRDGALVSVGADVRVRVHCPVLLLTAAQDVNRSSRSAAHTALASLLPRHSLHELQSESAKMADELALEVTKVTEPWGLEVERVEL 212          
BLAST of PHB domain-containing protein vs. Ensembl Nematostella
Match: EDO43326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ15])

HSP 1 Score: 276.944 bits (707), Expect = 1.301e-91
Identity = 143/223 (64.13%), Postives = 190/223 (85.20%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMN 1014
            +++ +Y+RAV+FRLGRL+   A GPGL  ++PC+DS +++DLR ++FDVP QE+LTKDSVTVAV+AVVY+RI N  MS+ NVE+AN STRLLAQTTLRN LGT +L  +L  R+EI+ +MQ +LD ATD WG+KVER+E+KDVRLP QLQRAMAAEAEATREA+AK+IA+EGE  ++++L+EA++ IS+ P A+QLRYLQTL++IS EKNSTIIFPLP++ ++
Sbjct:   54 KIVQEYERAVIFRLGRLLKGGAKGPGLFFILPCIDSYQKVDLRVVSFDVPPQEILTKDSVTVAVDAVVYFRIANATMSITNVENANASTRLLAQTTLRNTLGTKNLTEILSQRDEISQTMQSSLDEATDPWGVKVERIEVKDVRLPQQLQRAMAAEAEATREARAKIIAAEGEMNASRSLKEASDIISESPQALQLRYLQTLTTISAEKNSTIIFPLPIDFLS 276          
BLAST of PHB domain-containing protein vs. Ensembl Nematostella
Match: EDO31853 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWR9])

HSP 1 Score: 266.544 bits (680), Expect = 7.079e-88
Identity = 141/225 (62.67%), Postives = 186/225 (82.67%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+++Y+RAV+FR+GR++S  A GPG+  V+PC+D  +++D+RT++FDVP QEVLTKDSVTV V+AVVY+R+ N  +S+ NVE+A  ST+LLAQTTLRN++G+  LC +L +R+ I+A+M+  LD AT  WG++VERVE+KDVRLP QLQRAMAAEAEA REAKAK I +EGE KS+ AL+ AAE +   P A+QLRYLQTL++IS EKNSTIIFPLPMNL+N F
Sbjct:   29 KVVSEYERAVIFRIGRILSGGARGPGIFFVLPCIDEFRKVDIRTVSFDVPPQEVLTKDSVTVTVDAVVYFRVENATVSITNVENAFGSTKLLAQTTLRNMMGSKLLCEILSERDNISATMKGMLDEATGPWGVRVERVEMKDVRLPVQLQRAMAAEAEAHREAKAKFIVAEGEMKSSHALKNAAEVLDGSPSALQLRYLQTLNTISAEKNSTIIFPLPMNLLNRF 253          
BLAST of PHB domain-containing protein vs. Ensembl Nematostella
Match: EDO28629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5Y2])

HSP 1 Score: 218.394 bits (555), Expect = 4.691e-69
Identity = 125/225 (55.56%), Postives = 166/225 (73.78%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +V+++Y+RAV+FR+GR++S  A GPG+  V+PC+D  +++D+RT++FDVP QEVLTKDSVTV V+AVVY+R+ N  +S+ NVE+A  S    AQ   R       L +    + +  + ++     AT  WG++VERVE+KDVRLP QLQRAMAAEAEA REAKAK I +EGE KS+ AL+ AAE +   P A+QLRYLQTL++IS EKNSTIIFPLPMNL+N F
Sbjct:   29 KVVSEYERAVIFRIGRILSGGARGPGIFFVLPCIDEFRKVDIRTVSFDVPPQEVLTKDSVTVTVDAVVYFRVENATVSITNVENAFDSVTPSAQAFARQHPRAYWLPAFFHPQGK-QSYLKNLCPQATGPWGVRVERVEMKDVRLPVQLQRAMAAEAEAHREAKAKFIVAEGEMKSSHALKNAAEVLDGSPSALQLRYLQTLNTISAEKNSTIIFPLPMNLLNRF 252          
BLAST of PHB domain-containing protein vs. Ensembl Nematostella
Match: EDO43325 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ14])

HSP 1 Score: 218.009 bits (554), Expect = 7.169e-69
Identity = 110/225 (48.89%), Postives = 156/225 (69.33%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RAV+FRLGRL+   A GPG+  ++PC+DS +++DLRT++FDVP QE+LTKDSVTVAV+AVVY+RI N  MS+ NVE+ANRSTRLLAQTTLRN+LGT  L  +L +R+ I+ +M E          +    + +  +         +             VIA+EGE  +++AL+EA++ IS+ P A+QLRYLQTL++IS EKNSTIIFPLP++ +  F
Sbjct:   28 KIVQEYERAVIFRLGRLLEGGAKGPGMFFILPCIDSYQKVDLRTVSFDVPPQEILTKDSVTVAVDAVVYFRIANATMSITNVENANRSTRLLAQTTLRNILGTKSLSEILSERDNISHTM-ELTTPRLTPLTLPPLVLPLLTLPHLVLPLLILPHLVLPLLTLPHLVIAAEGEMNASRALKEASDIISESPQALQLRYLQTLTTISAEKNSTIIFPLPIDFIAKF 251          
BLAST of PHB domain-containing protein vs. Ensembl Nematostella
Match: EDO43324 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ13])

HSP 1 Score: 176.407 bits (446), Expect = 1.621e-53
Identity = 108/225 (48.00%), Postives = 149/225 (66.22%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RAV+FRLGRL+   A GPG+I   P LD                                                +AN STRLLAQTTLRN+LGT +L  +L  R+EI+ +MQ  LD ATD WG+KVER+E+KDVRLP Q+QRAMAAEAEA+R+A+AK+IA+EGE  ++++L++A++ +S+ P AIQLRYLQTL++IS EKNSTIIFPLP+++++ F
Sbjct:   31 KIVQEYERAVIFRLGRLLQGGAKGPGMI---PRLDP-----------------------------------------------NANGSTRLLAQTTLRNILGTKNLTEILSQRDEISQTMQSTLDEATDPWGVKVERIEVKDVRLPQQMQRAMAAEAEASRDARAKIIAAEGEMNASRSLKDASDILSESPQAIQLRYLQTLTTISAEKNSTIIFPLPIDMLSHF 205          
BLAST of PHB domain-containing protein vs. Ensembl Medaka
Match: stom (stomatin [Source:NCBI gene;Acc:101167971])

HSP 1 Score: 275.789 bits (704), Expect = 1.037e-90
Identity = 144/225 (64.00%), Postives = 188/225 (83.56%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RA++FRLGR+V   A GPGL  ++PC DS   +D+RT+TFD+P QE+LTKDSVTV+V+ VVYYR+ N  ++V N+ +A+ +TRLLAQTTLRNVLGT +L  +L DREEIA SMQ +LD ATDAWG+KVERVEIKDV+LP QLQRAMAAEAEATREA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTL++I+ EKNSTIIFPLP+ +M  F
Sbjct:   57 KIVKEYERAIIFRLGRIVKGGAKGPGLFFILPCTDSFINVDMRTITFDIPPQEILTKDSVTVSVDGVVYYRVQNATLAVANITNADAATRLLAQTTLRNVLGTKNLAEILSDREEIAHSMQSSLDDATDAWGIKVERVEIKDVKLPLQLQRAMAAEAEATREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPLEMMQGF 281          
BLAST of PHB domain-containing protein vs. Ensembl Medaka
Match: STOML3 (erythrocyte band 7 integral membrane protein-like [Source:NCBI gene;Acc:101171931])

HSP 1 Score: 275.018 bits (702), Expect = 2.907e-90
Identity = 144/225 (64.00%), Postives = 190/225 (84.44%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RAV+FRLGR+V R+  GPGL  V+PC D+  ++DLRT++FD+P QE+LTKDSVTV+V+ VVY+RI  P+ SV NV +A+ STRLLAQTTLRNVLGT +L  LL DRE I+ SMQE+LD AT+ WG+KVERVEIKDV LP QLQRAMAAEAEA+REA+AK+IA+EGE K+++AL+EA+  +++ P A+QLRYLQTLS+I+ EKNSTIIFPLP++++  F
Sbjct:   60 KIVKEYERAVIFRLGRIVDRKPKGPGLFFVLPCTDNFVKVDLRTVSFDIPPQEILTKDSVTVSVDGVVYFRIHCPISSVANVSNAHSSTRLLAQTTLRNVLGTKNLSELLSDREGISLSMQESLDDATEPWGIKVERVEIKDVTLPQQLQRAMAAEAEASREARAKIIAAEGEMKASRALKEASLVMAEAPSALQLRYLQTLSTIAAEKNSTIIFPLPIDMLQSF 284          
BLAST of PHB domain-containing protein vs. Ensembl Medaka
Match: stoml3b (erythrocyte band 7 integral membrane protein [Source:NCBI gene;Acc:101162729])

HSP 1 Score: 273.863 bits (699), Expect = 4.472e-90
Identity = 142/225 (63.11%), Postives = 189/225 (84.00%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            +++ +Y+RAV+FRLGR++ ++  GPG+  ++PC DS+ ++DLR ++FD+P QE+LTKDSVTV+V+ VVY+R+ +P+ SV NV +AN STRLLAQTTLRNVLGT +L  +L DRE IA SMQ  LD ATD WG+KVERVEIKDV+LP QLQRAMAAEAEA REA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTLS+I+ EKNSTIIFPLPM++++ F
Sbjct:   47 KIVQEYERAVIFRLGRIIDKKPKGPGIFFILPCTDSLVKVDLRIISFDIPPQEILTKDSVTVSVDGVVYFRVSDPIASVANVTNANYSTRLLAQTTLRNVLGTKNLAEVLSDREGIAHSMQSNLDEATDNWGIKVERVEIKDVKLPHQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLSTIAAEKNSTIIFPLPMDVISHF 271          
BLAST of PHB domain-containing protein vs. Ensembl Medaka
Match: stoml3b (erythrocyte band 7 integral membrane protein-like [Source:NCBI gene;Acc:101173000])

HSP 1 Score: 270.781 bits (691), Expect = 6.228e-89
Identity = 142/225 (63.11%), Postives = 188/225 (83.56%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            + + +Y+RAV+FRLGR+  R+  GPG+  ++PC DS+ ++DLRT++FD+P QE+LTKDSVTV+V+ VVY+R+ +P+ SV NV +A+ STRLLAQTTLRNVLGT +L  +L DRE IA SMQ  LD ATD WG+KVERVEIKDV+LP QLQRAMAAEAEA REA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTL++I+ EKNSTIIFPLPM++++ F
Sbjct:   43 KTVQEYERAVIFRLGRITDRKPKGPGIFFILPCTDSLVKVDLRTVSFDIPPQEILTKDSVTVSVDGVVYFRVSDPIASVANVTNADFSTRLLAQTTLRNVLGTKNLAEVLSDREGIAHSMQSNLDEATDNWGIKVERVEIKDVKLPFQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPMDVISHF 267          
BLAST of PHB domain-containing protein vs. Ensembl Medaka
Match: stoml3b (erythrocyte band 7 integral membrane protein [Source:NCBI gene;Acc:101162729])

HSP 1 Score: 245.743 bits (626), Expect = 4.769e-79
Identity = 130/209 (62.20%), Postives = 174/209 (83.25%), Query Frame = 1
Query:  346 RVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEK 972
            +++ +Y+RAV+FRLGR++ ++  GPG+  ++PC DS+ ++DLR ++FD+P QE+LTKDSVTV+V+ VVY+R+ +P+ SV NV +AN STRLLAQTTLRNVLGT +L  +L DRE IA SMQ  LD ATD WG+KVERVEIKDV+LP QLQRAMAAEAEA REA+AKVIA+EGE  +++AL+EA+  I++ P A+QLRYLQTLS+I+ E+
Sbjct:   56 KIVQEYERAVIFRLGRIIDKKPKGPGIFFILPCTDSLVKVDLRIISFDIPPQEILTKDSVTVSVDGVVYFRVSDPIASVANVTNANYSTRLLAQTTLRNVLGTKNLAEVLSDREGIAHSMQSNLDEATDNWGIKVERVEIKDVKLPHQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLSTIAAER 264          
BLAST of PHB domain-containing protein vs. Planmine SMEST
Match: SMESG000022721.1 (SMESG000022721.1)

HSP 1 Score: 635.95 bits (1639), Expect = 0.000e+0
Identity = 354/354 (100.00%), Postives = 354/354 (100.00%), Query Frame = 1
Query:   73 MSSAVHFNLYSLQDKNSCNLFNEIERRQIQLNSKHKGQLKRTFSLVPERFDSDQNSNFSNKQGIIICETXXXXXXXXXXXXXXXXXXXXXXRVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCDSKHVNSLKTSSMFVPSTHQKPDEIENSECDFTV 1134
            MSSAVHFNLYSLQDKNSCNLFNEIERRQIQLNSKHKGQLKRTFSLVPERFDSDQNSNFSNKQGIIICETLLKSAVLLLLILTFPLSLFLSLRVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQRAMAAEAEATREAKAKVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCDSKHVNSLKTSSMFVPSTHQKPDEIENSECDFTV
Sbjct:    1 MSSAVHFNLYSLQDKNSCNLFNEIERRQIQLNSKHKGQLKRTFSLVPERFDSDQNSNFSNKQGIIICETLLKSAVLLLLILTFPLSLFLSLRVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQRAMAAEAEATREAKAKVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCDSKHVNSLKTSSMFVPSTHQKPDEIENSECDFTV 354          
BLAST of PHB domain-containing protein vs. Planmine SMEST
Match: SMESG000011117.1 (SMESG000011117.1)

HSP 1 Score: 394.045 bits (1011), Expect = 1.136e-135
Identity = 230/346 (66.47%), Postives = 280/346 (80.92%), Query Frame = 1
Query:   73 MSSAVHFNLYSLQDKNSCNLFNEIERRQIQLNSKHKGQLKRTFSLVPERFDSDQNSNFSNKQGIIICETXXXXXXXXXXXXXXXXXXXXXXRVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCDSKH--------VNSLKTSSMFVPST 1086
            MS+ V FNL S  + N+ +  N+     I+    +K  LKR+FSLVPER D+   +N  N+Q +  CE +L+   ++L+++ FP SL  SL+VIAQYQRAVVFRLG+L+SR  LGPGLI ++PCLDSMKRIDLRTLTFDVPTQEVLT+DSVTVAV+AVVYYRIF+PVMSVVNVEDANRSTRLLAQTTLRNVLGTVDL SLL DRE+IA+SMQE LD+ATDAWGMKVERVE+KDVRLP QLQRAMAAEAEATREAKAKVIA+EGE+KS+KALR AAEE+ KCPI++QLRYLQTL+SIS EKNSTIIFPLP++++  F    ++++         NS+ +S ++ P T
Sbjct:    1 MSATVQFNLGS--NHNTSDESND--NPPIRPAKHNKAHLKRSFSLVPERLDTKAKNNVCNEQLLTGCEIILEVVSIILVVVLFPFSLIFSLKVIAQYQRAVVFRLGKLISRGPLGPGLIFILPCLDSMKRIDLRTLTFDVPTQEVLTRDSVTVAVDAVVYYRIFDPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLYSLLTDREDIASSMQETLDVATDAWGMKVERVEVKDVRLPMQLQRAMAAEAEATREAKAKVIAAEGEQKSSKALRLAAEELYKCPISLQLRYLQTLNSISAEKNSTIIFPLPIDILTYFQDQNNNQNSFIPPNSPANSVHSSKVYNPPT 342          
BLAST of PHB domain-containing protein vs. Planmine SMEST
Match: SMESG000011117.1 (SMESG000011117.1)

HSP 1 Score: 359.762 bits (922), Expect = 1.943e-122
Identity = 217/346 (62.72%), Postives = 267/346 (77.17%), Query Frame = 1
Query:   73 MSSAVHFNLYSLQDKNSCNLFNEIERRQIQLNSKHKGQLKRTFSLVPERFDSDQNSNFSNKQGIIICETXXXXXXXXXXXXXXXXXXXXXXRVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSSCDSKH--------VNSLKTSSMFVPST 1086
            MS+ V FNL S  + N+ +  N+     I+    +K  LKR+FSLVPER D+   +N  N+Q +  CE +L+   ++L+++ FP SL  SL+VIAQYQRAVVFRLG+L+SR  LGPGLI ++PCLDSMKRIDLRTLTFDVPTQEVLT+DSVTVAV+AVVYYRIF+PVMSVVNVEDANRSTRLLAQTTL               RE+IA+SMQE LD+ATDAWGMKVERVE+KDVRLP QLQRAMAAEAEATREAKAKVIA+EGE+KS+KALR AAEE+ KCPI++QLRYLQTL+SIS EKNSTIIFPLP++++  F    ++++         NS+ +S ++ P T
Sbjct:    1 MSATVQFNLGS--NHNTSDESND--NPPIRPAKHNKAHLKRSFSLVPERLDTKAKNNVCNEQLLTGCEIILEVVSIILVVVLFPFSLIFSLKVIAQYQRAVVFRLGKLISRGPLGPGLIFILPCLDSMKRIDLRTLTFDVPTQEVLTRDSVTVAVDAVVYYRIFDPVMSVVNVEDANRSTRLLAQTTLH--------------REDIASSMQETLDVATDAWGMKVERVEVKDVRLPMQLQRAMAAEAEATREAKAKVIAAEGEQKSSKALRLAAEELYKCPISLQLRYLQTLNSISAEKNSTIIFPLPIDILTYFQDQNNNQNSFIPPNSPANSVHSSKVYNPPT 328          
BLAST of PHB domain-containing protein vs. Planmine SMEST
Match: SMESG000059569.1 (SMESG000059569.1)

HSP 1 Score: 332.413 bits (851), Expect = 6.102e-112
Identity = 190/279 (68.10%), Postives = 231/279 (82.80%), Query Frame = 1
Query:  193 RTFSLVPERFDSDQNSNFSNKQGIIICETXXXXXXXXXXXXXXXXXXXXXXRVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMFNSS 1029
            R FSLV E  + +Q         +  CE+ +++   L   +TFP SLF  L+V+AQY+RAV+FRLGRL+S++  GPGL+ V+PCLDSMK +DLRT TF+VPTQEVLTKDSVTVAV+AVVYYRIFNP+MSVVNVEDANRSTRLLAQTTLRNVLGTVDL  LL +RE+IA++MQ  LD AT+ WG+KVERV+IKDVRLP QLQRAMAAEAEA REAKAKVIA+EGEK+++ AL+ AA +IS CPIA+QLRYLQTL SIS EKNSTIIFP+P++ +N+F+ S
Sbjct:   72 RGFSLVFENVE-NQTGEKGYNSAMSGCESAIQAMSYLTAAITFPFSLFACLKVVAQYERAVIFRLGRLISKQPKGPGLVFVLPCLDSMKLVDLRTFTFNVPTQEVLTKDSVTVAVDAVVYYRIFNPIMSVVNVEDANRSTRLLAQTTLRNVLGTVDLYQLLAEREQIASNMQGCLDTATETWGVKVERVDIKDVRLPIQLQRAMAAEAEAAREAKAKVIAAEGEKRASVALKAAAIQISDCPIALQLRYLQTLRSISDEKNSTIIFPIPIDFLNLFSDS 349          
BLAST of PHB domain-containing protein vs. Planmine SMEST
Match: SMESG000076275.1 (SMESG000076275.1)

HSP 1 Score: 330.102 bits (845), Expect = 4.659e-111
Identity = 195/303 (64.36%), Postives = 242/303 (79.87%), Query Frame = 1
Query:  127 NLFNEIERRQIQLNSKHKGQLKRT-----FSLVPERFDSDQNSNFSNKQGIIICETXXXXXXXXXXXXXXXXXXXXXXRVIAQYQRAVVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDSVTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSLLKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQXXXXXXXXXXXXXXXXVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEKNSTIIFPLPMNLMNMF 1020
            N   E+E  Q QL    +   K T     FSLVP++ ++D+     +   + +CETL+++    L ++TFP S+F  L+V+AQY+RAV+FRLGRL+S +  GPGL+ ++PCLDS+K +DLRT TF+VPTQEVLTKDSVTVAV+AVVYYRIF P+MSVVNVEDANRSTRLLAQTTLRNVLGTVDL  LL  RE+IA +MQ+ LD AT+ WG+KVERV+IKDVRLP QLQRAMAAEAEA REAKAKVIA+EGE+K++ AL+ AA +I  CPIA+QLRYLQTLSSIS EKNSTIIFP+PM+L+ +F
Sbjct:   12 NWNEEVELTQPQLYGAFRHPSKNTDSSHVFSLVPKK-NADKVVAEESNMIMSVCETLMRALAYALAVMTFPFSMFACLKVVAQYERAVIFRLGRLISSQPKGPGLVFILPCLDSVKLVDLRTFTFNVPTQEVLTKDSVTVAVDAVVYYRIFEPIMSVVNVEDANRSTRLLAQTTLRNVLGTVDLYQLLCGREQIAHNMQDCLDAATETWGVKVERVDIKDVRLPIQLQRAMAAEAEAAREAKAKVIAAEGEQKASVALKAAAVQIGGCPIALQLRYLQTLSSISDEKNSTIIFPIPMDLIRLF 313          
The following BLAST results are available for this feature:
BLAST of PHB domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STOM2.463e-8860.09stomatin [Source:HGNC Symbol;Acc:HGNC:3383][more]
STOML38.276e-8358.37stomatin like 3 [Source:HGNC Symbol;Acc:HGNC:19420... [more]
STOML31.313e-8258.37stomatin like 3 [Source:HGNC Symbol;Acc:HGNC:19420... [more]
NPHS21.341e-5343.91NPHS2 stomatin family member, podocin [Source:HGNC... [more]
STOM1.083e-3955.66stomatin [Source:HGNC Symbol;Acc:HGNC:3383][more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mec-23.393e-9264.89Mechanosensory protein 2 [Source:UniProtKB/Swiss-... [more]
mec-24.539e-9264.89Mechanosensory protein 2 [Source:UniProtKB/Swiss-... [more]
mec-21.156e-9164.89Mechanosensory protein 2 [Source:UniProtKB/Swiss-... [more]
mec-21.541e-9164.89Mechanosensory protein 2 [Source:UniProtKB/Swiss-... [more]
sto-21.776e-9166.67Stomatin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q1995... [more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG425402.148e-9165.78gene:FBgn0260657 transcript:FBtr0301096[more]
CG425403.398e-9165.78gene:FBgn0260657 transcript:FBtr0344807[more]
CG425404.753e-9165.78gene:FBgn0260657 transcript:FBtr0333584[more]
CG425405.207e-9165.78gene:FBgn0260657 transcript:FBtr0333583[more]
CG425405.628e-9165.78gene:FBgn0260657 transcript:FBtr0301097[more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stoml3b4.803e-9264.00stomatin (EPB72)-like 3b [Source:ZFIN;Acc:ZDB-GENE... [more]
zgc:1124083.620e-8962.22zgc:112408 [Source:ZFIN;Acc:ZDB-GENE-050417-63][more]
stom3.666e-8963.11stomatin [Source:ZFIN;Acc:ZDB-GENE-980526-486][more]
stom3.666e-8963.11stomatin [Source:ZFIN;Acc:ZDB-GENE-980526-486][more]
zgc:1124083.747e-8962.22zgc:112408 [Source:ZFIN;Acc:ZDB-GENE-050417-63][more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo10.23.188e-8962.22myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995... [more]
myo10.26.332e-8962.22myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995... [more]
myo10.27.703e-8962.22myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995... [more]
atp8b33.096e-7856.83ATPase, aminophospholipid transporter, class I, ty... [more]
ENSXETT00000046764.11.599e-7360.29pep primary_assembly:Xenopus_tropicalis_v9.1:2:223... [more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stom1.601e-8660.36stomatin [Source:MGI Symbol;Acc:MGI:95403][more]
Stoml34.574e-8259.91stomatin (Epb7.2)-like 3 [Source:MGI Symbol;Acc:MG... [more]
Nphs21.902e-5944.93nephrosis 2, podocin [Source:MGI Symbol;Acc:MGI:21... [more]
Nphs26.749e-4133.48nephrosis 2, podocin [Source:MGI Symbol;Acc:MGI:21... [more]
Stoml23.041e-2636.36stomatin (Epb7.2)-like 2 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of PHB domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16TM5|BND7A_AEDAE2.609e-9264.50Band 7 protein AAEL010189 OS=Aedes aegypti OX=7159... [more]
sp|Q7PPU9|BND7A_ANOGA3.397e-9160.98Band 7 protein AGAP004871 OS=Anopheles gambiae OX=... [more]
sp|Q19958|STO2_CAEEL5.463e-9066.67Stomatin-2 OS=Caenorhabditis elegans OX=6239 GN=st... [more]
sp|Q9VZA4|BND7A_DROME1.165e-8965.78Band 7 protein CG42540 OS=Drosophila melanogaster ... [more]
sp|Q27433|MEC2_CAEEL1.481e-8964.89Mechanosensory protein 2 OS=Caenorhabditis elegans... [more]
back to top
BLAST of PHB domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068X2I11.802e-11869.93Mechanosensory protein 2 OS=Echinococcus granulosu... [more]
A0A0R3SW141.864e-11867.97PHB domain-containing protein OS=Hymenolepis dimin... [more]
A0A068XWD34.168e-11869.59Mechanosensory protein 2 OS=Echinococcus multilocu... [more]
W6URQ54.260e-11869.59Band 7 protein OS=Echinococcus granulosus OX=6210 ... [more]
A0A0X3P2L81.862e-11764.49PHB domain-containing protein OS=Schistocephalus s... [more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stom8.102e-9063.56stomatin [Source:NCBI gene;Acc:103034070][more]
stom8.936e-9063.56stomatin [Source:NCBI gene;Acc:103034070][more]
stom9.641e-9063.56stomatin [Source:NCBI gene;Acc:103034070][more]
stoml3b4.217e-8961.78stomatin (EPB72)-like 3b [Source:ZFIN;Acc:ZDB-GENE... [more]
stoml3a8.176e-8862.05stomatin (EPB72)-like 3a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008297.16.759e-8760.09pep scaffold:Pmarinus_7.0:GL485275:4696:10707:1 ge... [more]
ENSPMAT00000006522.13.910e-8258.01pep scaffold:Pmarinus_7.0:GL477331:35910:45947:-1 ... [more]
NPHS29.308e-4441.95NPHS2 stomatin family member, podocin [Source:HGNC... [more]
stoml24.110e-2637.32stomatin (EPB72)-like 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
stoml11.303e-2538.57stomatin (EPB72)-like 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PHB domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO433261.301e-9164.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318537.079e-8862.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286294.691e-6955.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433257.169e-6948.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433241.621e-5348.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stom1.037e-9064.00stomatin [Source:NCBI gene;Acc:101167971][more]
STOML32.907e-9064.00erythrocyte band 7 integral membrane protein-like ... [more]
stoml3b4.472e-9063.11erythrocyte band 7 integral membrane protein [Sour... [more]
stoml3b6.228e-8963.11erythrocyte band 7 integral membrane protein-like ... [more]
stoml3b4.769e-7962.20erythrocyte band 7 integral membrane protein [Sour... [more]
back to top
BLAST of PHB domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022721.10.000e+0100.00SMESG000022721.1[more]
SMESG000011117.11.136e-13566.47SMESG000011117.1[more]
SMESG000011117.11.943e-12262.72SMESG000011117.1[more]
SMESG000059569.16.102e-11268.10SMESG000059569.1[more]
SMESG000076275.14.659e-11164.36SMESG000076275.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031031 ID=SMED30031031|Name=PHB domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1213bp
ACTAATGTTAAAATACCGATTTGATTTTTTTTATTTTTATGACTTTTGAA
ATAATTTTTTAAATGAATTATTATGTCTAGTGCAGTGCATTTTAATCTTT
ATTCTTTGCAGGACAAAAATAGCTGTAATTTATTTAATGAAATCGAACGA
AGACAAATACAATTGAATTCCAAACACAAGGGTCAACTTAAACGAACCTT
TTCTTTGGTTCCCGAAAGGTTTGATTCCGATCAAAATAGTAATTTTTCCA
ACAAACAAGGAATTATAATATGTGAAACATTACTAAAAAGTGCAGTTTTA
TTATTGCTTATTCTGACTTTCCCATTGTCATTGTTTTTATCCTTGCGAGT
TATTGCTCAGTATCAACGAGCTGTGGTCTTTAGATTAGGTAGATTAGTAT
CAAGAGAGGCGTTGGGTCCAGGATTAATTATTGTTATTCCATGTTTGGAC
AGTATGAAAAGAATTGATCTTCGAACCCTTACGTTTGATGTTCCAACTCA
AGAAGTTCTAACAAAAGACTCAGTTACTGTAGCTGTAGAAGCAGTAGTTT
ATTATAGAATTTTCAATCCAGTTATGTCTGTCGTCAATGTGGAAGATGCA
AACAGATCTACTCGTCTTTTAGCACAAACCACTTTGAGAAATGTCCTGGG
AACTGTAGATTTATGCTCATTGCTCAAAGATAGAGAAGAAATCGCAGCCA
GTATGCAAGAAGCTCTTGATATAGCTACTGATGCATGGGGAATGAAAGTT
GAAAGAGTGGAAATTAAAGATGTCCGATTACCAACTCAACTTCAACGAGC
AATGGCTGCGGAAGCTGAAGCTACCAGAGAAGCAAAAGCCAAAGTTATTG
CATCAGAAGGTGAGAAAAAATCAGCCAAAGCCTTAAGAGAAGCCGCTGAA
GAGATATCAAAATGCCCAATAGCTATCCAGTTGAGATATTTACAAACATT
AAGTAGCATTTCGATGGAAAAGAATTCAACAATCATTTTTCCATTACCAA
TGAACTTAATGAATATGTTCAACTCTTCTTGTGACTCAAAACATGTTAAT
TCTTTGAAAACTAGTTCAATGTTTGTTCCTAGTACCCATCAAAAGCCAGA
TGAAATTGAAAATTCTGAATGTGATTTTACAGTATAATTTTTATTACGTT
TATTGCATCGCAAAACATTACTTTCAACATTATCCTTTCATTTTTATTCA
ACTTTTCAAACAT
back to top

protein sequence of SMED30031031-orf-1

>SMED30031031-orf-1 ID=SMED30031031-orf-1|Name=SMED30031031-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=355bp
MSSAVHFNLYSLQDKNSCNLFNEIERRQIQLNSKHKGQLKRTFSLVPERF
DSDQNSNFSNKQGIIICETLLKSAVLLLLILTFPLSLFLSLRVIAQYQRA
VVFRLGRLVSREALGPGLIIVIPCLDSMKRIDLRTLTFDVPTQEVLTKDS
VTVAVEAVVYYRIFNPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLCSL
LKDREEIAASMQEALDIATDAWGMKVERVEIKDVRLPTQLQRAMAAEAEA
TREAKAKVIASEGEKKSAKALREAAEEISKCPIAIQLRYLQTLSSISMEK
NSTIIFPLPMNLMNMFNSSCDSKHVNSLKTSSMFVPSTHQKPDEIENSEC
DFTV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043202Band-7_stomatin-like
IPR036013Band_7/SPFH_dom_sf
IPR001972Stomatin_HflK_HflKC_fam
IPR001107Band_7
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001972Stomatin/HflK/HflC familyPRINTSPR00721STOMATINcoord: 180..197
score: 69.44
coord: 268..291
score: 56.85
coord: 145..166
score: 61.69
coord: 200..223
score: 50.89
coord: 243..264
score: 72.73
coord: 224..242
score: 70.3
coord: 96..118
score: 52.8
IPR001107Band 7 domainSMARTSM00244PHB_4coord: 89..248
e-value: 4.4E-62
score: 222.2
IPR001107Band 7 domainPFAMPF01145Band_7coord: 93..265
e-value: 4.0E-31
score: 108.4
NoneNo IPR availableGENE3DG3DSA:3.30.479.30coord: 119..250
e-value: 7.7E-53
score: 180.0
NoneNo IPR availablePANTHERPTHR10264:SF114BAND 7 PROTEIN CG42540coord: 48..318
NoneNo IPR availableTMHMMTMhelixcoord: 73..95
IPR043202Band-7 stomatin-likePANTHERPTHR10264BAND 7 PROTEIN-RELATEDcoord: 48..318
IPR036013Band 7/SPFH domain superfamilySUPERFAMILYSSF117892Band 7/SPFH domaincoord: 122..254