RRM domain-containing protein

Overview
NameRRM domain-containing protein
Smed IDSMED30031010
Length (bp)2641
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RRM domain-containing protein (SMED30031010) t-SNE clustered cells

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30031010) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RRM domain-containing protein (SMED30031010) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30031010) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031010

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30031010SMESG000028681.1 SmedASXL_011428SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031010SMESG000028681.1 dd_Smed_v4_5327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031010SMESG000028681.1 dd_Smed_v4_5327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031010SMESG000028681.1 dd_Smed_v4_5327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031010SMESG000028681.1 dd_Smed_v4_5327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031010SMESG000028681.1 OX_Smed_1.0.09158ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynx musculatureSMED30031010SMESG000028681.1 dd_Smed_v4_5327_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30031010SMESG000028681.1 dd_Smed_v6_5327_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031010SMESG000028681.1 dd_Smed_v6_5327_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:9907])

HSP 1 Score: 99.7525 bits (247), Expect = 1.065e-21
Identity = 68/192 (35.42%), Postives = 105/192 (54.69%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE--------KLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            +++ SKTNLYI+GLP +  D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + S+  + GVGF R    + + E  E        K  +    +    +P+  KFAD      +KR+NP
Sbjct:   23 WDQLSKTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSAL--KASGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFAR----MESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQ---KKRQNP 201          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:9907])

HSP 1 Score: 99.7525 bits (247), Expect = 1.065e-21
Identity = 68/192 (35.42%), Postives = 105/192 (54.69%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE--------KLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            +++ SKTNLYI+GLP +  D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + S+  + GVGF R    + + E  E        K  +    +    +P+  KFAD      +KR+NP
Sbjct:   23 WDQLSKTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSAL--KASGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFAR----MESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQ---KKRQNP 201          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:9907])

HSP 1 Score: 99.7525 bits (247), Expect = 1.065e-21
Identity = 68/192 (35.42%), Postives = 105/192 (54.69%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE--------KLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            +++ SKTNLYI+GLP +  D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + S+  + GVGF R    + + E  E        K  +    +    +P+  KFAD      +KR+NP
Sbjct:   23 WDQLSKTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSAL--KASGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFAR----MESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQ---KKRQNP 201          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:9907])

HSP 1 Score: 99.7525 bits (247), Expect = 1.188e-21
Identity = 68/192 (35.42%), Postives = 105/192 (54.69%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE--------KLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            +++ SKTNLYI+GLP +  D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + S+  + GVGF R    + + E  E        K  +    +    +P+  KFAD      +KR+NP
Sbjct:   36 WDQLSKTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSAL--KASGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFAR----MESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQ---KKRQNP 214          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:9907])

HSP 1 Score: 99.3673 bits (246), Expect = 2.084e-21
Identity = 68/192 (35.42%), Postives = 105/192 (54.69%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE--------KLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            +++ SKTNLYI+GLP +  D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + S+  + GVGF R    + + E  E        K  +    +    +P+  KFAD      +KR+NP
Sbjct:   56 WDQLSKTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSAL--KASGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFAR----MESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQ---KKRQNP 234          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 84.3445 bits (207), Expect = 1.596e-17
Identity = 56/156 (35.90%), Postives = 84/156 (53.85%), Query Frame = 1
Query: 1240 VPPPPIYERQ---------SKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFK-CKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAK--ENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            VP PP  + +         S TNLYI+GL  N ND+ L  +      I S KA +++    CKGYGF+DF + + A  A+  + T+  G  A+ AK  + E+D TNLY+ N+P ++T +    L++   KFG + S  I +    N++ GVGF R 
Sbjct:   86 VPLPPTSQHRASSNFNTTPSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTE--GVQAQMAKLQQQEQDPTNLYIANLPLDFTEQ---MLETELNKFGMVISTRI-LRTPDNQSRGVGFARM 235          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 84.3445 bits (207), Expect = 1.596e-17
Identity = 56/156 (35.90%), Postives = 84/156 (53.85%), Query Frame = 1
Query: 1240 VPPPPIYERQ---------SKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFK-CKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAK--ENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            VP PP  + +         S TNLYI+GL  N ND+ L  +      I S KA +++    CKGYGF+DF + + A  A+  + T+  G  A+ AK  + E+D TNLY+ N+P ++T +    L++   KFG + S  I +    N++ GVGF R 
Sbjct:   86 VPLPPTSQHRASSNFNTTPSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTE--GVQAQMAKLQQQEQDPTNLYIANLPLDFTEQ---MLETELNKFGMVISTRI-LRTPDNQSRGVGFARM 235          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 85.1149 bits (209), Expect = 2.975e-17
Identity = 56/156 (35.90%), Postives = 84/156 (53.85%), Query Frame = 1
Query: 1240 VPPPPIYERQ---------SKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFK-CKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAK--ENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            VP PP  + +         S TNLYI+GL  N ND+ L  +      I S KA +++    CKGYGF+DF + + A  A+  + T+  G  A+ AK  + E+D TNLY+ N+P ++T +    L++   KFG + S  I +    N++ GVGF R 
Sbjct:   86 VPLPPTSQHRASSNFNTTPSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTE--GVQAQMAKLQQQEQDPTNLYIANLPLDFTEQ---MLETELNKFGMVISTRI-LRTPDNQSRGVGFARM 235          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 85.1149 bits (209), Expect = 2.975e-17
Identity = 56/156 (35.90%), Postives = 84/156 (53.85%), Query Frame = 1
Query: 1240 VPPPPIYERQ---------SKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFK-CKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAK--ENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            VP PP  + +         S TNLYI+GL  N ND+ L  +      I S KA +++    CKGYGF+DF + + A  A+  + T+  G  A+ AK  + E+D TNLY+ N+P ++T +    L++   KFG + S  I +    N++ GVGF R 
Sbjct:   86 VPLPPTSQHRASSNFNTTPSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTE--GVQAQMAKLQQQEQDPTNLYIANLPLDFTEQ---MLETELNKFGMVISTRI-LRTPDNQSRGVGFARM 235          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 85.5001 bits (210), Expect = 3.172e-17
Identity = 56/156 (35.90%), Postives = 84/156 (53.85%), Query Frame = 1
Query: 1240 VPPPPIYERQ---------SKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFK-CKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAK--ENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            VP PP  + +         S TNLYI+GL  N ND+ L  +      I S KA +++    CKGYGF+DF + + A  A+  + T+  G  A+ AK  + E+D TNLY+ N+P ++T +    L++   KFG + S  I +    N++ GVGF R 
Sbjct:   86 VPLPPTSQHRASSNFNTTPSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTE--GVQAQMAKLQQQEQDPTNLYIANLPLDFTEQ---MLETELNKFGMVISTRI-LRTPDNQSRGVGFARM 235          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: shep (gene:FBgn0052423 transcript:FBtr0077172)

HSP 1 Score: 92.4337 bits (228), Expect = 5.628e-19
Identity = 60/170 (35.29%), Postives = 93/170 (54.71%), Query Frame = 1
Query: 1270 SKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQR--GEDYLLDCDKPIEAKFAD 1770
            SKTNLYI+GL +   D+ L ++      I S KA L++   KCKGYGF+DF     A+ A+  +Q K  G  A+ AK+ E+D TNLY+ N+P  +   D   L++   K+G + S  I+ ++  N + GVGF R    + + E  E++ +    + +     P+  KFAD
Sbjct:  229 SKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGK--GVQAQMAKQQEQDPTNLYIANLPPHFKETD---LEAMLSKYGQVVSTRILRDQQMN-SKGVGFAR----MESREKCEQIIQMFNGNTIPGAKDPLLVKFAD 388          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: shep (gene:FBgn0052423 transcript:FBtr0308859)

HSP 1 Score: 92.0485 bits (227), Expect = 7.032e-19
Identity = 60/170 (35.29%), Postives = 93/170 (54.71%), Query Frame = 1
Query: 1270 SKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQR--GEDYLLDCDKPIEAKFAD 1770
            SKTNLYI+GL +   D+ L ++      I S KA L++   KCKGYGF+DF     A+ A+  +Q K  G  A+ AK+ E+D TNLY+ N+P  +   D   L++   K+G + S  I+ ++  N + GVGF R    + + E  E++ +    + +     P+  KFAD
Sbjct:  241 SKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGK--GVQAQMAKQQEQDPTNLYIANLPPHFKETD---LEAMLSKYGQVVSTRILRDQQMN-SKGVGFAR----MESREKCEQIIQMFNGNTIPGAKDPLLVKFAD 400          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: shep (gene:FBgn0052423 transcript:FBtr0301599)

HSP 1 Score: 82.8037 bits (203), Expect = 2.080e-16
Identity = 60/181 (33.15%), Postives = 93/181 (51.38%), Query Frame = 1
Query: 1270 SKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAK-----------ENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQR--GEDYLLDCDKPIEAKFAD 1770
            SKTNLYI+GL +   D+ L ++      I S KA L++   KCKGYGF+DF     A+ A+  +Q K  G  A+ AK           + E+D TNLY+ N+P  +   D   L++   K+G + S  I+ ++  N + GVGF R    + + E  E++ +    + +     P+  KFAD
Sbjct:   19 SKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGK--GVQAQMAKVGIWVLHRPAIQQEQDPTNLYIANLPPHFKETD---LEAMLSKYGQVVSTRILRDQQMN-SKGVGFAR----MESREKCEQIIQMFNGNTIPGAKDPLLVKFAD 189          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: shep (gene:FBgn0052423 transcript:FBtr0333287)

HSP 1 Score: 82.8037 bits (203), Expect = 2.080e-16
Identity = 60/181 (33.15%), Postives = 93/181 (51.38%), Query Frame = 1
Query: 1270 SKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAK-----------ENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQR--GEDYLLDCDKPIEAKFAD 1770
            SKTNLYI+GL +   D+ L ++      I S KA L++   KCKGYGF+DF     A+ A+  +Q K  G  A+ AK           + E+D TNLY+ N+P  +   D   L++   K+G + S  I+ ++  N + GVGF R    + + E  E++ +    + +     P+  KFAD
Sbjct:   19 SKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGK--GVQAQMAKVGIWVLHRPAIQQEQDPTNLYIANLPPHFKETD---LEAMLSKYGQVVSTRILRDQQMN-SKGVGFAR----MESREKCEQIIQMFNGNTIPGAKDPLLVKFAD 189          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: shep (gene:FBgn0052423 transcript:FBtr0333289)

HSP 1 Score: 82.0333 bits (201), Expect = 3.887e-16
Identity = 60/179 (33.52%), Postives = 92/179 (51.40%), Query Frame = 1
Query: 1270 SKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKEN---------EKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQR--GEDYLLDCDKPIEAKFAD 1770
            SKTNLYI+GL +   D+ L ++      I S KA L++   KCKGYGF+DF     A+ A+  +Q K  G  A+ AK           E+D TNLY+ N+P  +   D   L++   K+G + S  I+ ++  N + GVGF R    + + E  E++ +    + +     P+  KFAD
Sbjct:   19 SKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGK--GVQAQMAKVGIWVLHRPAIEQDPTNLYIANLPPHFKETD---LEAMLSKYGQVVSTRILRDQQMN-SKGVGFAR----MESREKCEQIIQMFNGNTIPGAKDPLLVKFAD 187          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: rbms1a (RNA binding motif, single stranded interacting protein 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4967])

HSP 1 Score: 100.908 bits (250), Expect = 3.501e-22
Identity = 63/176 (35.80%), Postives = 94/176 (53.41%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE----KLQRGEDYLLDCDKPIEAKFAD 1770
            +E+ SKTNLYI+GLP    D  L  L     KI S KA L++   KCKGYGF+DF +   A+ A+  ++T   G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + +   + GVGF R          +     K  +    +L   +P+  KFAD
Sbjct:   51 WEQLSKTNLYIRGLPPGTTDHDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPVSAQKAVAALKTN--GVQAQMAKQQEQDPTNLYLSNLP---VSMDEQELENLLKPFGQVVSTRILRD-TNGMSRGVGFARMESTEKCDAVISHFNGKFIKSSSGMLGASEPLLCKFAD 220          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: rbms1b (RNA binding motif, single stranded interacting protein 1b [Source:ZFIN;Acc:ZDB-GENE-100812-3])

HSP 1 Score: 92.4337 bits (228), Expect = 1.188e-20
Identity = 54/139 (38.85%), Postives = 83/139 (59.71%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            +E+ SKTNLYI+GL  +  D  L  L     KI S KA L++   KCKGYGF+DF +   A+ A++ ++T   G  A+ AK+ E+D TNLY++N+P    + D  +L++  + FG + S  I+ + +   + GVGF R 
Sbjct:   51 WEQLSKTNLYIRGLLPSTTDHDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKTS--GVQAQMAKQQEQDPTNLYISNLP---LTMDEQELEAMLKPFGQVVSTRILRD-TNGASRGVGFARM 183          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: rbms2a (RNA binding motif, single stranded interacting protein 2a [Source:ZFIN;Acc:ZDB-GENE-030912-2])

HSP 1 Score: 95.9005 bits (237), Expect = 1.576e-20
Identity = 56/138 (40.58%), Postives = 82/138 (59.42%), Query Frame = 1
Query: 1261 ERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            E+ SKTNLYI+GL     D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A+T +  K+ G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + +   + GVGF R 
Sbjct:   50 EQLSKTNLYIRGLHPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVTAL--KSTGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELEAMLKSFGQVISTRILRD-ANGTSRGVGFARM 181          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: rbms2a (RNA binding motif, single stranded interacting protein 2a [Source:ZFIN;Acc:ZDB-GENE-030912-2])

HSP 1 Score: 95.9005 bits (237), Expect = 1.767e-20
Identity = 56/138 (40.58%), Postives = 82/138 (59.42%), Query Frame = 1
Query: 1261 ERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            E+ SKTNLYI+GL     D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A+T +  K+ G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + +   + GVGF R 
Sbjct:   48 EQLSKTNLYIRGLHPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVTAL--KSTGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELEAMLKSFGQVISTRILRD-ANGTSRGVGFARM 179          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: rbms3 (RNA binding motif, single stranded interacting protein [Source:ZFIN;Acc:ZDB-GENE-060929-244])

HSP 1 Score: 91.2781 bits (225), Expect = 1.872e-20
Identity = 55/138 (39.86%), Postives = 82/138 (59.42%), Query Frame = 1
Query: 1261 ERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            E+ SKTNLYI+GLP    D+ L  L     KI S KA L+++  +CKGYGF+DF +   A+ A+  +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + +   + GVGF R 
Sbjct:   17 EQLSKTNLYIRGLPPGTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVASL--KASGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELENMLKPFGHVISTRILRD-ANGVSRGVGFARM 148          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit [Source:Xenbase;Acc:XB-GENE-5846020])

HSP 1 Score: 99.7525 bits (247), Expect = 7.402e-22
Identity = 73/197 (37.06%), Postives = 105/197 (53.30%), Query Frame = 1
Query: 1255 IYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEK----LQRGEDYLLDC-------DKPIEAKFADKHNPETRKRRNPS 1809
            I E+ SKTNLYI+GLP    D+ L  L     KI S KA L+++  +CKGYGF+DF T   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + S   + GVGF R        E+ EK    +Q      L          +P+  KFAD      +KR+NPS
Sbjct:   46 IGEQLSKTNLYIRGLPPCTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDTPAAAQKAVSSL--KASGVQAQMAKQQEQDPTNLYISNLP---ISMDEQELENMLKPFGHVISTRILRDAS-GVSRGVGFARM-------ESTEKCEVVIQHFNGKYLKTPPGVPAPSEPLLCKFADGGQ---KKRQNPS 226          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit [Source:Xenbase;Acc:XB-GENE-5846020])

HSP 1 Score: 99.7525 bits (247), Expect = 7.695e-22
Identity = 73/197 (37.06%), Postives = 105/197 (53.30%), Query Frame = 1
Query: 1255 IYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEK----LQRGEDYLLDC-------DKPIEAKFADKHNPETRKRRNPS 1809
            I E+ SKTNLYI+GLP    D+ L  L     KI S KA L+++  +CKGYGF+DF T   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + S   + GVGF R        E+ EK    +Q      L          +P+  KFAD      +KR+NPS
Sbjct:   41 IGEQLSKTNLYIRGLPPCTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDTPAAAQKAVSSL--KASGVQAQMAKQQEQDPTNLYISNLP---ISMDEQELENMLKPFGHVISTRILRDAS-GVSRGVGFARM-------ESTEKCEVVIQHFNGKYLKTPPGVPAPSEPLLCKFADGGQ---KKRQNPS 221          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit [Source:Xenbase;Acc:XB-GENE-5846020])

HSP 1 Score: 99.7525 bits (247), Expect = 1.380e-21
Identity = 73/197 (37.06%), Postives = 105/197 (53.30%), Query Frame = 1
Query: 1255 IYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEK----LQRGEDYLLDC-------DKPIEAKFADKHNPETRKRRNPS 1809
            I E+ SKTNLYI+GLP    D+ L  L     KI S KA L+++  +CKGYGF+DF T   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + S   + GVGF R        E+ EK    +Q      L          +P+  KFAD      +KR+NPS
Sbjct:   52 IGEQLSKTNLYIRGLPPCTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDTPAAAQKAVSSL--KASGVQAQMAKQQEQDPTNLYISNLP---ISMDEQELENMLKPFGHVISTRILRDAS-GVSRGVGFARM-------ESTEKCEVVIQHFNGKYLKTPPGVPAPSEPLLCKFADGGQ---KKRQNPS 232          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit [Source:Xenbase;Acc:XB-GENE-5846020])

HSP 1 Score: 99.7525 bits (247), Expect = 1.678e-21
Identity = 73/197 (37.06%), Postives = 105/197 (53.30%), Query Frame = 1
Query: 1255 IYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEK----LQRGEDYLLDC-------DKPIEAKFADKHNPETRKRRNPS 1809
            I E+ SKTNLYI+GLP    D+ L  L     KI S KA L+++  +CKGYGF+DF T   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + S   + GVGF R        E+ EK    +Q      L          +P+  KFAD      +KR+NPS
Sbjct:   52 IGEQLSKTNLYIRGLPPCTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDTPAAAQKAVSSL--KASGVQAQMAKQQEQDPTNLYISNLP---ISMDEQELENMLKPFGHVISTRILRDAS-GVSRGVGFARM-------ESTEKCEVVIQHFNGKYLKTPPGVPAPSEPLLCKFADGGQ---KKRQNPS 232          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: naa40 (N(alpha)-acetyltransferase 40, NatD catalytic subunit [Source:Xenbase;Acc:XB-GENE-5846020])

HSP 1 Score: 99.3673 bits (246), Expect = 1.740e-21
Identity = 73/197 (37.06%), Postives = 105/197 (53.30%), Query Frame = 1
Query: 1255 IYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEK----LQRGEDYLLDC-------DKPIEAKFADKHNPETRKRRNPS 1809
            I E+ SKTNLYI+GLP    D+ L  L     KI S KA L+++  +CKGYGF+DF T   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + S   + GVGF R        E+ EK    +Q      L          +P+  KFAD      +KR+NPS
Sbjct:   52 IGEQLSKTNLYIRGLPPCTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDTPAAAQKAVSSL--KASGVQAQMAKQQEQDPTNLYISNLP---ISMDEQELENMLKPFGHVISTRILRDAS-GVSRGVGFARM-------ESTEKCEVVIQHFNGKYLKTPPGVPAPSEPLLCKFADGGQ---KKRQNPS 232          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Rbms1 (RNA binding motif, single stranded interacting protein 1 [Source:MGI Symbol;Acc:MGI:1861774])

HSP 1 Score: 99.3673 bits (246), Expect = 9.451e-22
Identity = 67/192 (34.90%), Postives = 105/192 (54.69%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE--------KLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            +++ SKTNLYI+GLP N  D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A++ ++    G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  ++ + S+  + GVGF R    + + E  E        K  +    +    +P+  KFAD      +KR+NP
Sbjct:   23 WDQLSKTNLYIRGLPPNTTDQDLVKLCQPYGKIVSTKAILDKATNKCKGYGFVDFDSPAAAQKAVSALKAN--GVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRVLRD-SSGASRGVGFAR----MESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQ---KKRQNP 201          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Rbms1 (RNA binding motif, single stranded interacting protein 1 [Source:MGI Symbol;Acc:MGI:1861774])

HSP 1 Score: 99.7525 bits (247), Expect = 9.852e-22
Identity = 67/192 (34.90%), Postives = 105/192 (54.69%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE--------KLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            +++ SKTNLYI+GLP N  D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A++ ++    G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  ++ + S+  + GVGF R    + + E  E        K  +    +    +P+  KFAD      +KR+NP
Sbjct:   56 WDQLSKTNLYIRGLPPNTTDQDLVKLCQPYGKIVSTKAILDKATNKCKGYGFVDFDSPAAAQKAVSALKAN--GVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRVLRD-SSGASRGVGFAR----MESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQ---KKRQNP 234          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Rbms1 (RNA binding motif, single stranded interacting protein 1 [Source:MGI Symbol;Acc:MGI:1861774])

HSP 1 Score: 100.138 bits (248), Expect = 9.970e-22
Identity = 67/192 (34.90%), Postives = 105/192 (54.69%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE--------KLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            +++ SKTNLYI+GLP N  D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A++ ++    G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  ++ + S+  + GVGF R    + + E  E        K  +    +    +P+  KFAD      +KR+NP
Sbjct:   54 WDQLSKTNLYIRGLPPNTTDQDLVKLCQPYGKIVSTKAILDKATNKCKGYGFVDFDSPAAAQKAVSALKAN--GVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRVLRD-SSGASRGVGFAR----MESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQ---KKRQNP 232          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Rbms2 (RNA binding motif, single stranded interacting protein 2 [Source:MGI Symbol;Acc:MGI:1861776])

HSP 1 Score: 94.3597 bits (233), Expect = 2.974e-20
Identity = 56/135 (41.48%), Postives = 78/135 (57.78%), Query Frame = 1
Query: 1270 SKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            SKTNLYI+GL     D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A+T +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L+   + FG + S  I+ + S   + GVGF R 
Sbjct:   28 SKTNLYIRGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSSAQKAVTAL--KASGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELEGMLKPFGQVISTRILRDTS-GASRGVGFARM 156          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Rbms2 (RNA binding motif, single stranded interacting protein 2 [Source:MGI Symbol;Acc:MGI:1861776])

HSP 1 Score: 94.7449 bits (234), Expect = 3.113e-20
Identity = 56/135 (41.48%), Postives = 78/135 (57.78%), Query Frame = 1
Query: 1270 SKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            SKTNLYI+GL     D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A+T +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L+   + FG + S  I+ + S   + GVGF R 
Sbjct:   28 SKTNLYIRGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSSAQKAVTAL--KASGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELEGMLKPFGQVISTRILRDTS-GASRGVGFARM 156          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3ZBP3|RBMS1_BOVIN (RNA-binding motif, single-stranded-interacting protein 1 OS=Bos taurus OX=9913 GN=RBMS1 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.807e-21
Identity = 69/192 (35.94%), Postives = 105/192 (54.69%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE--------KLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            +++ SKTNLYI+GLP N  D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + S+  + GVGF R    + + E  E        K  +    +    +P+  KFAD      +KR+NP
Sbjct:   56 WDQLSKTNLYIRGLPPNTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSAL--KASGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFAR----MESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQ---KKRQNP 234          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5PQP1|RBMS1_RAT (RNA-binding motif, single-stranded-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Rbms1 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 4.202e-21
Identity = 68/192 (35.42%), Postives = 105/192 (54.69%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE--------KLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            +++ SKTNLYI+GLP N  D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  ++ + S+  + GVGF R    + + E  E        K  +    +    +P+  KFAD      +KR+NP
Sbjct:   56 WDQLSKTNLYIRGLPPNTTDQDLVKLCQPYGKIVSTKAILDKATNKCKGYGFVDFDSPAAAQKAVSAL--KASGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRVLRD-SSGTSRGVGFAR----MESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQ---KKRQNP 234          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91W59|RBMS1_MOUSE (RNA-binding motif, single-stranded-interacting protein 1 OS=Mus musculus OX=10090 GN=Rbms1 PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 6.891e-21
Identity = 67/192 (34.90%), Postives = 105/192 (54.69%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE--------KLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            +++ SKTNLYI+GLP N  D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A++ ++    G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  ++ + S+  + GVGF R    + + E  E        K  +    +    +P+  KFAD      +KR+NP
Sbjct:   56 WDQLSKTNLYIRGLPPNTTDQDLVKLCQPYGKIVSTKAILDKATNKCKGYGFVDFDSPAAAQKAVSALKAN--GVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRVLRD-SSGASRGVGFAR----MESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQ---KKRQNP 234          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|P29558|RBMS1_HUMAN (RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens OX=9606 GN=RBMS1 PE=1 SV=3)

HSP 1 Score: 99.3673 bits (246), Expect = 1.001e-20
Identity = 68/192 (35.42%), Postives = 105/192 (54.69%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE--------KLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            +++ SKTNLYI+GLP +  D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + S+  + GVGF R    + + E  E        K  +    +    +P+  KFAD      +KR+NP
Sbjct:   56 WDQLSKTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSAL--KASGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFAR----MESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQ---KKRQNP 234          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3ZC34|RBMS2_BOVIN (RNA-binding motif, single-stranded-interacting protein 2 OS=Bos taurus OX=9913 GN=RBMS2 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.079e-19
Identity = 56/139 (40.29%), Postives = 82/139 (58.99%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            +++ SKTNLYI+GL  +  D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A+T +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L+   + FG + S  I+ + S   + GVGF R 
Sbjct:   50 HDQLSKTNLYIRGLQPSTTDQDLVKLCQSYGKIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKAVTAL--KASGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELEGMLKPFGQVISTRILRDTS-GTSRGVGFARM 182          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A5K4F1A8 (Putative single-stranded DNA-binding protein mssp-1 OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 3.383e-70
Identity = 120/182 (65.93%), Postives = 146/182 (80.22%), Query Frame = 1
Query: 1261 ERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            E+ S+TNLYIKGLPENF+DE L  L PD+TKIKS+KAA +ED KC+GYGFIDF++E+ A +AL  I+  +P F  K+AKENEKDKTNLYVTN+P+ WT+KDSD+LK+ FE+FG IQSAF+MME+ TNKT GVGFVRFV E  A  ALE L+     L DC  P+EAKFADKHNP+TR+RR P
Sbjct:  157 EKMSRTNLYIKGLPENFDDEQLWQLPPDQTKIKSVKAATDEDTKCRGYGFIDFVSEDAANEALQQIKETHPSFTIKFAKENEKDKTNLYVTNLPRTWTTKDSDQLKAVFERFGHIQSAFVMMERLTNKTTGVGFVRFVNEQDAVNALESLKLHPLTLPDCSVPVEAKFADKHNPDTRRRRYP 338          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A4Z2DT17 (RNA-binding motif, single-stranded-interacting protein OS=Schistosoma japonicum OX=6182 GN=EWB00_006577 PE=4 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 4.703e-70
Identity = 120/182 (65.93%), Postives = 145/182 (79.67%), Query Frame = 1
Query: 1261 ERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNP 1806
            E+ S+TNLYIKGLPENF+D+ L  L PD+TKIKS+KAA +ED KC+GYGFIDF++E+ A +AL  I+   P F  K+AKENEKDKTNLYVTN+P+ WT+KDSD+LK+ FE+FG IQSAF+MME+ TNKT GVGFVRFV E  A  ALE L+     L DC  PIEAKFADKHNP+TR+RR P
Sbjct:  115 EKMSRTNLYIKGLPENFDDDHLWQLPPDQTKIKSVKAATDEDTKCRGYGFIDFVSEDAANEALQQIKETYPSFTIKFAKENEKDKTNLYVTNLPRTWTTKDSDQLKAVFERFGHIQSAFVMMERLTNKTTGVGFVRFVNEQDAMNALESLKLHPLTLPDCSVPIEAKFADKHNPDTRRRRYP 296          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A4E0RJ17 (RNA binding motif single stranded interacting OS=Fasciola hepatica OX=6192 GN=D915_001041 PE=4 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 1.948e-69
Identity = 114/183 (62.30%), Postives = 148/183 (80.87%), Query Frame = 1
Query: 1261 ERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPS 1809
            E+ S+TNLYIKGLP++F+DE L +L PD+T+IKS+KAA ++D KC+GYGFIDF+ E  A DAL +I+   P F  K+AKENEKDKTNLYVT++PK WT+KDS++LKS FE+FGPIQSAF+MME+STN+T GVGFVRF  E  A  AL+ ++     L +C +P+EAKFADKHNP+TR+RR P+
Sbjct:  146 EKVSRTNLYIKGLPDSFSDEKLWNLPPDQTQIKSVKAATDDDGKCRGYGFIDFVNETAAIDALKHIKETYPAFTIKFAKENEKDKTNLYVTHLPKSWTTKDSEQLKSVFERFGPIQSAFVMMERSTNRTTGVGFVRFANERDALAALDSIRTNPIMLPECTEPVEAKFADKHNPDTRRRRYPA 328          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A4S2M5S3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002489 PE=4 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.078e-69
Identity = 116/195 (59.49%), Postives = 152/195 (77.95%), Query Frame = 1
Query: 1261 ERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPSHQVDSLSSVRSL 1845
            E+ S+TNLYIKGLP++FND+ L +L P   +IKS+KAA ++D KC+GYGFIDF+++E A +AL +I+   P F  K+AKENEKDKTNLYVTN+PK WT+KDSD+LK  FE+FGPIQSAF+MME+STN+T GVGFVRF  E  A  AL+ ++     L +C+ P+EAKFADKHNP+TR+RR P   + + S+V SL
Sbjct:  103 EKMSRTNLYIKGLPDSFNDDKLWNLPPQGDQIKSVKAATDDDGKCRGYGFIDFISQEAANEALQHIRDTYPAFTIKFAKENEKDKTNLYVTNLPKSWTTKDSDQLKMVFERFGPIQSAFVMMERSTNRTTGVGFVRFANERDALAALDYIKSNPIILPECNNPVEAKFADKHNPDTRRRRYPMSTLLNNSAVNSL 297          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A074ZGD5 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_14362 PE=4 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.199e-69
Identity = 116/195 (59.49%), Postives = 152/195 (77.95%), Query Frame = 1
Query: 1261 ERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPSHQVDSLSSVRSL 1845
            E+ S+TNLYIKGLP++FND+ L +L P   +IKS+KAA ++D KC+GYGFIDF+++E A +AL +I+   P F  K+AKENEKDKTNLYVTN+PK WT+KDSD+LK  FE+FGPIQSAF+MME+STN+T GVGFVRF  E  A  AL+ ++     L +C+ P+EAKFADKHNP+TR+RR P   + + S+V SL
Sbjct:  103 EKMSRTNLYIKGLPDSFNDDKLWNLPPQSDQIKSVKAATDDDGKCRGYGFIDFISQEAANEALQHIRDTYPAFTIKFAKENEKDKTNLYVTNLPKSWTTKDSDQLKMVFERFGPIQSAFVMMERSTNRTTGVGFVRFANERDALAALDYIKSTPIILPECNNPVEAKFADKHNPDTRRRRYPMSTLLNNSAVNSL 297          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: rbms1a (RNA-binding motif, single-stranded-interacting protein 1 [Source:NCBI gene;Acc:103034850])

HSP 1 Score: 100.523 bits (249), Expect = 4.512e-22
Identity = 64/176 (36.36%), Postives = 95/176 (53.98%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE----KLQRGEDYLLDCDKPIEAKFAD 1770
            +E+ SKTNLYI+GLP +  D  L  L     KI S KA L++   KCKGYGF+DF +   A+ A+  +  KN G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + +   + GVGF R          +     K  +    +L   +P+  KFAD
Sbjct:   50 WEQLSKTNLYIRGLPPSTTDHDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPVSAQKAVAAL--KNNGVQAQMAKQQEQDPTNLYLSNLP---VSMDEQELENLLKPFGQVISTRILRD-AHGVSRGVGFARMESTEKCDAVISHFNGKFIKSASGMLGASEPLLCKFAD 219          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: rbms1a (RNA-binding motif, single-stranded-interacting protein 1 [Source:NCBI gene;Acc:103034850])

HSP 1 Score: 99.3673 bits (246), Expect = 5.033e-22
Identity = 64/176 (36.36%), Postives = 95/176 (53.98%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALE----KLQRGEDYLLDCDKPIEAKFAD 1770
            +E+ SKTNLYI+GLP +  D  L  L     KI S KA L++   KCKGYGF+DF +   A+ A+  +  KN G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + +   + GVGF R          +     K  +    +L   +P+  KFAD
Sbjct:   24 WEQLSKTNLYIRGLPPSTTDHDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPVSAQKAVAAL--KNNGVQAQMAKQQEQDPTNLYLSNLP---VSMDEQELENLLKPFGQVISTRILRD-AHGVSRGVGFARMESTEKCDAVISHFNGKFIKSASGMLGASEPLLCKFAD 193          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:NCBI gene;Acc:103030356])

HSP 1 Score: 97.4413 bits (241), Expect = 3.955e-21
Identity = 56/139 (40.29%), Postives = 81/139 (58.27%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            +E+ SKTNLYI+GLP    D  L  L     KI S KA L++   KCKGYGF+DF +   A+ A+  ++T   G  A+ AK+ E+D TNLY++N+P    + D   L+S  + FG + S  I+ + +   + GVGF R 
Sbjct:   56 WEQLSKTNLYIRGLPPATTDHDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVNALKTN--GVQAQMAKQQEQDPTNLYISNLP---LTMDEQDLESMLKPFGQVVSTRILRD-ANGASRGVGFARM 188          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:NCBI gene;Acc:103030356])

HSP 1 Score: 97.0561 bits (240), Expect = 4.224e-21
Identity = 56/139 (40.29%), Postives = 81/139 (58.27%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            +E+ SKTNLYI+GLP    D  L  L     KI S KA L++   KCKGYGF+DF +   A+ A+  ++T   G  A+ AK+ E+D TNLY++N+P    + D   L+S  + FG + S  I+ + +   + GVGF R 
Sbjct:   24 WEQLSKTNLYIRGLPPATTDHDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVNALKTN--GVQAQMAKQQEQDPTNLYISNLP---LTMDEQDLESMLKPFGQVVSTRILRD-ANGASRGVGFARM 156          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:NCBI gene;Acc:103030356])

HSP 1 Score: 97.4413 bits (241), Expect = 4.432e-21
Identity = 56/139 (40.29%), Postives = 81/139 (58.27%), Query Frame = 1
Query: 1258 YERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            +E+ SKTNLYI+GLP    D  L  L     KI S KA L++   KCKGYGF+DF +   A+ A+  ++T   G  A+ AK+ E+D TNLY++N+P    + D   L+S  + FG + S  I+ + +   + GVGF R 
Sbjct:   50 WEQLSKTNLYIRGLPPATTDHDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVNALKTN--GVQAQMAKQQEQDPTNLYISNLP---LTMDEQDLESMLKPFGQVVSTRILRD-ANGASRGVGFARM 182          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008168.1 (pep scaffold:Pmarinus_7.0:GL476829:41182:80090:-1 gene:ENSPMAG00000007358.1 transcript:ENSPMAT00000008168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 2.479e-21
Identity = 66/182 (36.26%), Postives = 95/182 (52.20%), Query Frame = 1
Query: 1261 ERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEK----LQRGEDYLLDC-------DKPIEAKFAD 1770
            E+ SKTNLYI+GLP    D+ L  L     KI S KA L++   +CKGYGF+DF     A+ A+T +  K  G  A+ AK+ E+D TNLY++N+P    + D  +L+   ++FG + S  I+ +     + GVGF R        E+ EK    +QR     L          +P+  KFAD
Sbjct:   30 EQLSKTNLYIRGLPPGTTDQDLVKLCQPYGKIVSTKAILDKTTNQCKGYGFVDFDGPSAAQKAVTAL--KASGIQAQMAKQQEQDPTNLYISNLP---VTIDEQELEGMLKQFGHVISTRILRDI-VGTSRGVGFARM-------ESTEKCEAVIQRFNGKFLTSPPGVPVPSEPLLCKFAD 198          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: RBMS2 (RNA binding motif single stranded interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:9909])

HSP 1 Score: 92.4337 bits (228), Expect = 5.341e-20
Identity = 54/135 (40.00%), Postives = 79/135 (58.52%), Query Frame = 1
Query: 1270 SKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            SKTNLYI+GLP    D+ L  L     KI S KA L+++  +CKGYGF+ F +   A+ A+T +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L+   + FG + S  I+ + +   + GVGF R 
Sbjct:   56 SKTNLYIRGLPPGTTDQDLTKLCQPYGKIVSTKAILDKNTNQCKGYGFVHFDSPAAAQKAVTAL--KANGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELEGMLKPFGQVISTRILRD-ANGTSRGVGFARM 184          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 63.1586 bits (152), Expect = 1.512e-10
Identity = 58/214 (27.10%), Postives = 93/214 (43.46%), Query Frame = 1
Query: 1276 TNLYIKGLPENFNDESLESLVPDKT-KIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEK-----------------------DKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPSHQVDSLSSVRSL 1845
            TN+YIK   ++ +DE L         K  S+K  ++E  K KG+GF+ F   EDA+ A+  + TK     A Y    +K                          NLYV N+     + + ++L   F  FG I SA +MME+  ++  G GFV F     A +A+ ++    +  +   KP+    A +   E RK    S  +  L+ +R++
Sbjct:   51 TNVYIKNFGDDMDDERLREYFEQYVGKTLSVKVMMDEGGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAERQTELKRKFEMLKQERMSKYQGVNLYVKNLD---DNINDERLWKEFSPFGTITSAKVMMEEGRSR--GFGFVCFSSPEEATKAVTEM----NGRIIGSKPLYVALAQRK--EERKMHLTSQFMQRLAGMRAV 253          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007448.1 (pep scaffold:Pmarinus_7.0:GL479027:131562:138944:-1 gene:ENSPMAG00000006727.1 transcript:ENSPMAT00000007448.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 4.820e-10
Identity = 37/90 (41.11%), Postives = 52/90 (57.78%), Query Frame = 1
Query: 1231 PQTVPPPPIYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAK 1497
            P +   P   +  SKTNLYI+GLP + +D+ L  L     KI S KA L++   +CKGYGF+DF +   A+ A+T +  K  G  A+ AK
Sbjct:   40 PSSSCSPAGNDLLSKTNLYIRGLPPHTSDQDLVKLCHPYGKIVSTKAILDKTTNQCKGYGFVDFDSPTAAQKAVTAL--KATGIQAQMAK 127          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: RBMS2 (RNA binding motif single stranded interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:9909])

HSP 1 Score: 58.9214 bits (141), Expect = 1.679e-9
Identity = 32/91 (35.16%), Postives = 53/91 (58.24%), Query Frame = 1
Query: 1399 GYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            GYGF+DF +   A+ A++ +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L+   + +G + S  I+ + +   + GVGF R 
Sbjct:    1 GYGFVDFDSPAAAQKAVSAL--KANGVQAQMAKQQEQDPTNLYISNLP---MSMDEQELEGMLKPYGQVISTRILRD-ANGTSRGVGFARM 85          
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 58.5362 bits (140), Expect = 3.158e-9
Identity = 52/167 (31.14%), Postives = 79/167 (47.31%), Query Frame = 1
Query: 1252 PIYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQ----TKNPGFNAKYAKENEKDK---------TNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTN-KTVGVGFVRFVYELHAYEALEKL 1710
            P   ++   N++IK L  + ++++L         I S K A +E+ K KG+GF+ F  E  AK+A+  +          + A +    E+D          TNLYV NI  E T    ++ +  F KFGPI SA   +EK  + K  G GFV +     A +A+E L
Sbjct:  118 PSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETT---DEQFQELFAKFGPIVSA--SLEKDADGKLKGFGFVNYEKHEDAVKAVEAL 279          

HSP 2 Score: 50.447 bits (119), Expect = 9.147e-7
Identity = 55/212 (25.94%), Postives = 90/212 (42.45%), Query Frame = 1
Query: 1276 TNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYI---------------QTKNPGFNA--------KYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEAL-EKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPSHQVDSLSSVR 1839
            TNLY+K +     DE  + L      I S     + D K KG+GF+++   EDA  A+  +               Q KN   +         +  K  +    NL+V N+     S D +KL+  F  +G I SA +M  ++  K+ G GFV F     A +A+ EK Q+     +   KP+    A + +    +R   + Q+ + + +R
Sbjct:  219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLD---DSVDDEKLEEEFAPYGTITSAKVMRTEN-GKSKGFGFVCFSTPEEATKAITEKNQQ-----IVAGKPLYVAIAQRKDV---RRSQLAQQIQARNQMR 418          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO49588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGR7])

HSP 1 Score: 98.2117 bits (243), Expect = 2.071e-23
Identity = 70/188 (37.23%), Postives = 101/188 (53.72%), Query Frame = 1
Query: 1246 PPPIYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFK-CKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEAL----EKLQRGEDYLLDCDKPIEAKFADKHNPETRK 1794
            P    E+ SKTNLYI+GL  N  D+ L  L      I S KA L++D   CKGYGF+DF +   A+ A+  +   N G  A+ AK+ E+D TNLY+ N+P+     D   L++ F K+G + S  I+ +K TN + GVGF R        + +    +K+  GE   L C + +  KFAD   P+ R+
Sbjct:    5 PDTGEEKLSKTNLYIRGLKANTTDDDLVRLCHKYGTIISTKAILDKDTNLCKGYGFVDFESPISAQKAVAAL--VNKGIQAQMAKQQEQDPTNLYIQNLPQNC---DEAMLENMFSKYGKVISTRILRDKDTN-SKGVGFARMESAEKCEQVIKDFNKKMLPGE-VSLRCIQELVVKFAD-GGPKKRQ 184          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO33206 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSV8])

HSP 1 Score: 68.1662 bits (165), Expect = 8.771e-12
Identity = 55/211 (26.07%), Postives = 97/211 (45.97%), Query Frame = 1
Query: 1276 TNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYA--------------KENEKDK---------TNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPSHQVDSLSSVR 1839
            TN+Y+K   ++ +DE ++ +  +  KI SLK   + + K KG+GF+ F T E+A++A+  +  K  G    +A               E EK +          NLY+ N+       D ++L+  F  +G I SA +M +   N + G GFV F     A +A+ ++    +  +   KP+    A +   E RK +  +  +  +S +R
Sbjct:  194 TNVYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPEGKSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRLWAGRAKKRAERAAEVKAEIEKKRQERINRFQGVNLYIKNLD---DPIDDERLREEFSPYGTISSAKVMKDDKGN-SKGFGFVCFSSPEEATKAVTEM----NGRILISKPLYVALAQRR--EERKAQLAAQHMHRISGLR 394          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO42673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S105])

HSP 1 Score: 57.3806 bits (137), Expect = 8.182e-9
Identity = 45/183 (24.59%), Postives = 84/183 (45.90%), Query Frame = 1
Query: 1264 RQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCK-GYGFIDFLTEEDAK---DALTYIQTKNPGFNAKYAK---ENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETR 1791
            ++SKT L +  +P++  D++   +      + + K    +      G+GF+D+ T EDA+   D L      N      +++   +N K   NLYV NIPK+    +    +  FE +G I +  ++ +KST    G GFV +  +  A  A+  L     +       ++ ++AD ++ + R
Sbjct:    1 QESKTTLIVNYIPQDMTDQTFRMMFEAVASLNNCKIVRHKPSGWSYGFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKVAFSRPGGDNTKG-ANLYVCNIPKQLPEAE---FRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLYDKKAEAQAAISSLS--GTFFPGSTMGLQIRYADDNSAKVR 177          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO42417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1S3])

HSP 1 Score: 56.6102 bits (135), Expect = 2.346e-8
Identity = 54/194 (27.84%), Postives = 88/194 (45.36%), Query Frame = 1
Query: 1252 PIYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKC-KGYGFIDFLTEEDAKDALTYI-QTKNPGFNAKYAKENEKDK-----TNLYVTNIPKEWTSKDSDKLKSYFEKFGPI-QSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPS 1809
            PI ER     +Y+ GL E  ++  +  L      + ++    +   +  +GYGF++FL EEDA  A+  +   K  G   +  K +  +K      NL++ N+  E    D   L   F  FG I Q+  IM +  T  + G  F+ F     A +A  +   G+ YL  C++PI   +A K   E++  R+ S
Sbjct:    5 PIAERNQDATIYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKASAHNKNLDVGANLFIGNLDTE---VDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFA-SFDASDAAIEAMNGQ-YL--CNRPITVSYAFKK--ESKGERHGS 189          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO47487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLV0])

HSP 1 Score: 50.447 bits (119), Expect = 3.423e-6
Identity = 50/201 (24.88%), Postives = 87/201 (43.28%), Query Frame = 1
Query: 1204 PKDINDNMNPQTVPPPPIYERQSKTNLYIKGLPENFNDES-LESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALT----YIQTK--------NPGFNAKYAKENEK-------------------DKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKL 1710
            P   +D   PQ  P P   +  +     ++GLP    D+  LE   P   K  +++  + +  +  G  F+DF ++ D + AL     Y+Q +        N  F+     + EK                   +   L++ N+    + +D   ++  FEKFGP+    + ++K TNKT+G+GFV F+   HA +A  +L
Sbjct:  229 PDGSSDVDEPQETPQPDKPKPTTPWTCKMRGLPFKAKDKHILEFFSP--LKPVAIRFVMNKKGQPSGCAFVDFSSKSDLEKALKRNKDYLQGRYIELFKDTNRDFDNNKQGDGEKSWMRKLQEKGDDEEEEPIGESGRLFLRNLAYSCSEED---IQHLFEKFGPLSEVNLPLDKHTNKTIGIGFVTFLMPEHAVKAFNEL 424          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: rbms1a (RNA-binding motif, single-stranded-interacting protein 1 [Source:NCBI gene;Acc:101157928])

HSP 1 Score: 96.6709 bits (239), Expect = 3.754e-21
Identity = 58/138 (42.03%), Postives = 81/138 (58.70%), Query Frame = 1
Query: 1261 ERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            E+ SKTNLYI+GLP    D  L  L     KI+S KA L++   KCKGYGF+DF +   A  A+  ++T   G  A+ AK+ E+D TNLY++N+P    S D  +L+   + FG + S  I+ + S N + GVGF R 
Sbjct:   36 EQLSKTNLYIRGLPPATTDLDLVKLCHQYGKIQSAKAILDKTTNKCKGYGFVDFDSPAAALKAVHALKTS--GIQAQMAKQQEQDPTNLYISNLP---LSVDEKELEKMLQPFGQVVSTRILRDYSGN-SRGVGFARM 167          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: rbms1a (RNA-binding motif, single-stranded-interacting protein 1 [Source:NCBI gene;Acc:101157928])

HSP 1 Score: 97.0561 bits (240), Expect = 3.879e-21
Identity = 58/138 (42.03%), Postives = 81/138 (58.70%), Query Frame = 1
Query: 1261 ERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            E+ SKTNLYI+GLP    D  L  L     KI+S KA L++   KCKGYGF+DF +   A  A+  ++T   G  A+ AK+ E+D TNLY++N+P    S D  +L+   + FG + S  I+ + S N + GVGF R 
Sbjct:   36 EQLSKTNLYIRGLPPATTDLDLVKLCHQYGKIQSAKAILDKTTNKCKGYGFVDFDSPAAALKAVHALKTS--GIQAQMAKQQEQDPTNLYISNLP---LSVDEKELEKMLQPFGQVVSTRILRDYSGN-SRGVGFARM 167          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: rbms2a (RNA-binding motif, single-stranded-interacting protein 2 [Source:NCBI gene;Acc:101164552])

HSP 1 Score: 96.2857 bits (238), Expect = 7.111e-21
Identity = 57/138 (41.30%), Postives = 82/138 (59.42%), Query Frame = 1
Query: 1261 ERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            E+ SKTNLYI+GL     D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A+T +  K+ G  A+ AK+ E+D TNLY++N+P    S D  +L+S  + FG + S  I+ + +   + GVGF R 
Sbjct:   20 EQLSKTNLYIRGLHPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVTAL--KSSGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELESMLKPFGQVISTRILRD-ANGTSRGVGFARM 151          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: rbms2a (RNA-binding motif, single-stranded-interacting protein 2 [Source:NCBI gene;Acc:101164552])

HSP 1 Score: 95.9005 bits (237), Expect = 1.019e-20
Identity = 57/138 (41.30%), Postives = 82/138 (59.42%), Query Frame = 1
Query: 1261 ERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            E+ SKTNLYI+GL     D+ L  L     KI S KA L++   KCKGYGF+DF +   A+ A+T +  K+ G  A+ AK+ E+D TNLY++N+P    S D  +L+S  + FG + S  I+ + +   + GVGF R 
Sbjct:   38 EQLSKTNLYIRGLHPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVTAL--KSSGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELESMLKPFGQVISTRILRD-ANGTSRGVGFARM 169          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: RBMS3 (RNA binding motif single stranded interacting protein 3 [Source:NCBI gene;Acc:101166080])

HSP 1 Score: 93.5893 bits (231), Expect = 8.608e-20
Identity = 55/140 (39.29%), Postives = 83/140 (59.29%), Query Frame = 1
Query: 1255 IYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDF-KCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRF 1671
            + E+ SKTNLYI+GLP    D+ L  L     KI S KA L+++  +CKGYGF+DF +   A+ A+  +  K  G  A+ AK+ E+D TNLY++N+P    S D  +L++  + FG + S  I+ + +   + GVGF R 
Sbjct:   54 LVEQLSKTNLYIRGLPPGTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVASL--KANGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELENMLKPFGHVISTRILRD-ANGLSRGVGFARM 187          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000028681.1 (SMESG000028681.1)

HSP 1 Score: 781.941 bits (2018), Expect = 0.000e+0
Identity = 423/424 (99.76%), Postives = 424/424 (100.00%), Query Frame = 1
Query: 1048 KYPNTLLHANGLPLINLSSKLFPVDYSSLNYPFIVPNSSRGFRESEKLDNTFPKDINDNMNPQTVPPPPIYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPSHQVDSLSSVRSLNVGXXXXXXXXXXXXXXCGSLYNQPLLLRNQNVLASAASQVPLLHPATDSGAYFDLSXXXXXXXXXXXXXXXXXXXXAMQGCVELPSNAINPLILTNGIPNSNFTHSSSNSGNPNLDLLAYSQMSNYPSAVNLNNYSISVPYSKNSNIFFSHTNPTAE 2319
            +YPNTLLHANGLPLINLSSKLFPVDYSSLNYPFIVPNSSRGFRESEKLDNTFPKDINDNMNPQTVPPPPIYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPSHQVDSLSSVRSLNVGNCLLNPTAALANNLCGSLYNQPLLLRNQNVLASAASQVPLLHPATDSGAYFDLSQLYNLPSQNNYLYQLQNQLLAMQGCVELPSNAINPLILTNGIPNSNFTHSSSNSGNPNLDLLAYSQMSNYPSAVNLNNYSISVPYSKNSNIFFSHTNPTAE
Sbjct:    2 QYPNTLLHANGLPLINLSSKLFPVDYSSLNYPFIVPNSSRGFRESEKLDNTFPKDINDNMNPQTVPPPPIYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPSHQVDSLSSVRSLNVGNCLLNPTAALANNLCGSLYNQPLLLRNQNVLASAASQVPLLHPATDSGAYFDLSQLYNLPSQNNYLYQLQNQLLAMQGCVELPSNAINPLILTNGIPNSNFTHSSSNSGNPNLDLLAYSQMSNYPSAVNLNNYSISVPYSKNSNIFFSHTNPTAE 425          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000028681.1 (SMESG000028681.1)

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 366/366 (100.00%), Postives = 366/366 (100.00%), Query Frame = 1
Query: 1222 NMNPQTVPPPPIYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPSHQVDSLSSVRSLNVGXXXXXXXXXXXXXXCGSLYNQPLLLRNQNVLASAASQVPLLHPATDSGAYFDLSXXXXXXXXXXXXXXXXXXXXAMQGCVELPSNAINPLILTNGIPNSNFTHSSSNSGNPNLDLLAYSQMSNYPSAVNLNNYSISVPYSKNSNIFFSHTNPTAE 2319
            NMNPQTVPPPPIYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPSHQVDSLSSVRSLNVGNCLLNPTAALANNLCGSLYNQPLLLRNQNVLASAASQVPLLHPATDSGAYFDLSQLYNLPSQNNYLYQLQNQLLAMQGCVELPSNAINPLILTNGIPNSNFTHSSSNSGNPNLDLLAYSQMSNYPSAVNLNNYSISVPYSKNSNIFFSHTNPTAE
Sbjct:   37 NMNPQTVPPPPIYERQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPSHQVDSLSSVRSLNVGNCLLNPTAALANNLCGSLYNQPLLLRNQNVLASAASQVPLLHPATDSGAYFDLSQLYNLPSQNNYLYQLQNQLLAMQGCVELPSNAINPLILTNGIPNSNFTHSSSNSGNPNLDLLAYSQMSNYPSAVNLNNYSISVPYSKNSNIFFSHTNPTAE 402          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000005941.1 (SMESG000005941.1)

HSP 1 Score: 225.713 bits (574), Expect = 5.298e-66
Identity = 109/180 (60.56%), Postives = 136/180 (75.56%), Query Frame = 1
Query: 1264 RQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLL-DCDKPIEAKFADKHNPETRKRR 1800
            + S+TNLYIKGL  NF DE +  L PD++ +KS+KAA+E+D KCKGYGFIDFLT EDA   L YIQ ++P F  K+AKENEKDKTNLY+TN+PK WTSKDS+KLKS FEK+G IQSAFIM+EK  NK +GVGFVRF +E  A  A+  L+     L  D   P+EAK+ADKHN ++R++ 
Sbjct:   28 KTSRTNLYIKGLHSNFTDEDILQLAPDQSLVKSVKAAIEDDKKCKGYGFIDFLTPEDAIIGLEYIQERHPNFTIKFAKENEKDKTNLYITNLPKSWTSKDSEKLKSIFEKYGEIQSAFIMLEKYANKPLGVGFVRFFHEESAQLAINDLESNHQILSEDSTGPLEAKYADKHNTDSRRKH 207          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000005941.1 (SMESG000005941.1)

HSP 1 Score: 225.328 bits (573), Expect = 6.131e-66
Identity = 109/180 (60.56%), Postives = 136/180 (75.56%), Query Frame = 1
Query: 1264 RQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLL-DCDKPIEAKFADKHNPETRKRR 1800
            + S+TNLYIKGL  NF DE +  L PD++ +KS+KAA+E+D KCKGYGFIDFLT EDA   L YIQ ++P F  K+AKENEKDKTNLY+TN+PK WTSKDS+KLKS FEK+G IQSAFIM+EK  NK +GVGFVRF +E  A  A+  L+     L  D   P+EAK+ADKHN ++R++ 
Sbjct:   21 KTSRTNLYIKGLHSNFTDEDILQLAPDQSLVKSVKAAIEDDKKCKGYGFIDFLTPEDAIIGLEYIQERHPNFTIKFAKENEKDKTNLYITNLPKSWTSKDSEKLKSIFEKYGEIQSAFIMLEKYANKPLGVGFVRFFHEESAQLAINDLESNHQILSEDSTGPLEAKYADKHNTDSRRKH 200          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000005941.1 (SMESG000005941.1)

HSP 1 Score: 225.713 bits (574), Expect = 7.138e-66
Identity = 109/181 (60.22%), Postives = 137/181 (75.69%), Query Frame = 1
Query: 1264 RQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLL-DCDKPIEAKFADKHNPETRKRRN 1803
            + S+TNLYIKGL  NF DE +  L PD++ +KS+KAA+E+D KCKGYGFIDFLT EDA   L YIQ ++P F  K+AKENEKDKTNLY+TN+PK WTSKDS+KLKS FEK+G IQSAFIM+EK  NK +GVGFVRF +E  A  A+  L+     L  D   P+EAK+ADKHN ++R++ +
Sbjct:   35 KTSRTNLYIKGLHSNFTDEDILQLAPDQSLVKSVKAAIEDDKKCKGYGFIDFLTPEDAIIGLEYIQERHPNFTIKFAKENEKDKTNLYITNLPKSWTSKDSEKLKSIFEKYGEIQSAFIMLEKYANKPLGVGFVRFFHEESAQLAINDLESNHQILSEDSTGPLEAKYADKHNTDSRRKHS 215          
The following BLAST results are available for this feature:
BLAST of RRM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBMS11.065e-2135.42RNA binding motif single stranded interacting prot... [more]
RBMS11.065e-2135.42RNA binding motif single stranded interacting prot... [more]
RBMS11.065e-2135.42RNA binding motif single stranded interacting prot... [more]
RBMS11.188e-2135.42RNA binding motif single stranded interacting prot... [more]
RBMS12.084e-2135.42RNA binding motif single stranded interacting prot... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sup-261.596e-1735.90SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
sup-261.596e-1735.90SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
sup-262.975e-1735.90SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
sup-262.975e-1735.90SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
sup-263.172e-1735.90SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shep5.628e-1935.29gene:FBgn0052423 transcript:FBtr0077172[more]
shep7.032e-1935.29gene:FBgn0052423 transcript:FBtr0308859[more]
shep2.080e-1633.15gene:FBgn0052423 transcript:FBtr0301599[more]
shep2.080e-1633.15gene:FBgn0052423 transcript:FBtr0333287[more]
shep3.887e-1633.52gene:FBgn0052423 transcript:FBtr0333289[more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbms1a3.501e-2235.80RNA binding motif, single stranded interacting pro... [more]
rbms1b1.188e-2038.85RNA binding motif, single stranded interacting pro... [more]
rbms2a1.576e-2040.58RNA binding motif, single stranded interacting pro... [more]
rbms2a1.767e-2040.58RNA binding motif, single stranded interacting pro... [more]
rbms31.872e-2039.86RNA binding motif, single stranded interacting pro... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naa407.402e-2237.06N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
naa407.695e-2237.06N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
naa401.380e-2137.06N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
naa401.678e-2137.06N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
naa401.740e-2137.06N(alpha)-acetyltransferase 40, NatD catalytic subu... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbms19.451e-2234.90RNA binding motif, single stranded interacting pro... [more]
Rbms19.852e-2234.90RNA binding motif, single stranded interacting pro... [more]
Rbms19.970e-2234.90RNA binding motif, single stranded interacting pro... [more]
Rbms22.974e-2041.48RNA binding motif, single stranded interacting pro... [more]
Rbms23.113e-2041.48RNA binding motif, single stranded interacting pro... [more]
back to top
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3ZBP3|RBMS1_BOVIN2.807e-2135.94RNA-binding motif, single-stranded-interacting pro... [more]
sp|Q5PQP1|RBMS1_RAT4.202e-2135.42RNA-binding motif, single-stranded-interacting pro... [more]
sp|Q91W59|RBMS1_MOUSE6.891e-2134.90RNA-binding motif, single-stranded-interacting pro... [more]
sp|P29558|RBMS1_HUMAN1.001e-2035.42RNA-binding motif, single-stranded-interacting pro... [more]
sp|Q3ZC34|RBMS2_BOVIN2.079e-1940.29RNA-binding motif, single-stranded-interacting pro... [more]
back to top
BLAST of RRM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F1A83.383e-7065.93Putative single-stranded DNA-binding protein mssp-... [more]
A0A4Z2DT174.703e-7065.93RNA-binding motif, single-stranded-interacting pro... [more]
A0A4E0RJ171.948e-6962.30RNA binding motif single stranded interacting OS=F... [more]
A0A4S2M5S32.078e-6959.49Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZGD52.199e-6959.49Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbms1a4.512e-2236.36RNA-binding motif, single-stranded-interacting pro... [more]
rbms1a5.033e-2236.36RNA-binding motif, single-stranded-interacting pro... [more]
RBMS13.955e-2140.29RNA binding motif single stranded interacting prot... [more]
RBMS14.224e-2140.29RNA binding motif single stranded interacting prot... [more]
RBMS14.432e-2140.29RNA binding motif single stranded interacting prot... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008168.12.479e-2136.26pep scaffold:Pmarinus_7.0:GL476829:41182:80090:-1 ... [more]
RBMS25.341e-2040.00RNA binding motif single stranded interacting prot... [more]
pabpc41.512e-1027.10poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
ENSPMAT00000007448.14.820e-1041.11pep scaffold:Pmarinus_7.0:GL479027:131562:138944:-... [more]
RBMS21.679e-935.16RNA binding motif single stranded interacting prot... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PAB13.158e-931.14Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495882.071e-2337.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332068.771e-1226.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426738.182e-924.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424172.346e-827.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474873.423e-624.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbms1a3.754e-2142.03RNA-binding motif, single-stranded-interacting pro... [more]
rbms1a3.879e-2142.03RNA-binding motif, single-stranded-interacting pro... [more]
rbms2a7.111e-2141.30RNA-binding motif, single-stranded-interacting pro... [more]
rbms2a1.019e-2041.30RNA-binding motif, single-stranded-interacting pro... [more]
RBMS38.608e-2039.29RNA binding motif single stranded interacting prot... [more]
back to top
BLAST of RRM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028681.10.000e+099.76SMESG000028681.1[more]
SMESG000028681.10.000e+0100.00SMESG000028681.1[more]
SMESG000005941.15.298e-6660.56SMESG000005941.1[more]
SMESG000005941.16.131e-6660.56SMESG000005941.1[more]
SMESG000005941.17.138e-6660.22SMESG000005941.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031010 ID=SMED30031010|Name=RRM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2641bp
CTCAATTAACAATTGTTTTTGTTTGTTTTTTTATTCAGTTTGTTGTTTAT
TTGAAATGAGGAAAATTATTAGACTCATAAAATACAAAAACGATCAAAAA
TTAATAGTGAAATAATCATATTAATAATCCAGAACAACTCTGGGGAAATA
ATTACAGTTTAGTTTTGTTAATTTATTAGTAAACTTGTCTGTTTACCCAA
ACTATCCACCAATTATTGAGAATAAAAGGCTCAACAGTTACTACTGGAAA
TGCCATATCATGTGCATATTTTATTTGCCACAAAACAAACTCAAAATCCT
TCCTAATAGTGAATGCACGAGCAACAAAGGAAATATCAAATTCCCCATCT
CTTTGACAATATGTTTTTGATTCCACGAAATGGGAAATGACAAAATTTGT
TTCGATCTGATTGGTCAGAGATTCTACTTGTCAGACACAACCGCAAATTT
ATTATCGACCCGGGAACAAAAATTAGCCCAACACAATAACAGAATTGGTT
GATTTGGAATATTTTTAGGGAGCGCATATATCAGCAACCGTCAGACAATA
CAGTCCTCAACTAAATTAGGATGCCAGATGTGCGTTAAACCGGGTTTTGT
TTTTTTCAGTCTGGTTAGAAAATTATGTTCAATTCGAATTGGAGTTTTTT
TTTCCTTCTGACTTGATATTCGTCAGTTTTGCAAATTGAAATTTTTTCGA
GTTTCTCTTCCACAAATCAACAATCAGATTCGAATTTTCTGGGGCTTATA
TTTTGATAACCCAATTTGATAAATTTTGATTTTATTGATTGCGGGAAATC
GATTTTTATGTGCAAAATATTTATCTAATTTATTTCCAGAATGTCTTGTT
AACACAATTCTAGTTGACAAATATTTTTATATTCCAAAATTTGTGGTGCC
CACAAAACGAAAAATAAAGGGCCGTTTATCAAACTCCTATAACTTTGAAG
AAATCCCCAGTAGCACATACGGAAATATTTTTAAAGTTTCAAGAAAAATC
GTCTATAAAGTTTACTAAGTCGTATTCATTGGTCTATGACACGCAGTAAG
TATCCTAACACTCTTTTGCACGCAAACGGATTACCGCTGATAAATTTATC
TTCAAAACTTTTCCCAGTTGATTACAGTTCCCTCAACTATCCATTCATCG
TGCCGAATTCCAGTCGAGGATTCCGGGAATCGGAAAAATTGGATAATACT
TTTCCAAAGGATATCAATGACAATATGAATCCACAAACTGTACCTCCTCC
TCCCATTTATGAAAGGCAATCAAAAACCAATCTCTATATCAAAGGGTTAC
CTGAAAATTTTAATGATGAAAGTTTGGAATCTTTAGTACCTGATAAAACG
AAAATAAAATCTTTAAAAGCTGCTTTGGAAGAAGATTTCAAATGTAAAGG
ATATGGGTTCATTGATTTCCTAACTGAAGAGGATGCCAAAGATGCACTTA
CTTATATCCAAACAAAAAATCCTGGTTTCAATGCAAAATATGCCAAGGAA
AATGAAAAGGACAAAACTAATCTTTATGTTACAAATATCCCTAAAGAATG
GACAAGCAAAGATAGTGATAAATTGAAATCTTATTTTGAAAAGTTTGGAC
CAATTCAATCGGCTTTTATCATGATGGAAAAGTCAACTAATAAAACTGTT
GGAGTTGGTTTTGTTAGATTTGTATATGAATTGCATGCTTATGAAGCCTT
AGAAAAACTCCAGAGAGGGGAAGATTACTTATTAGACTGTGATAAACCTA
TTGAAGCCAAATTTGCTGATAAACACAACCCTGAAACTAGGAAACGTAGG
AATCCGAGTCATCAAGTAGATTCTTTGTCTTCGGTGAGATCCCTTAATGT
TGGAAATTGTTTGCTAAATCCCACAGCAGCTCTTGCAAACAATTTATGTG
GATCATTATACAATCAACCTTTACTGCTTCGAAATCAAAATGTCCTGGCT
TCGGCAGCTTCACAAGTGCCTCTACTCCATCCAGCAACCGATTCTGGAGC
CTATTTTGATTTATCTCAGTTATATAACCTACCCAGTCAGAACAATTATT
TGTATCAATTACAGAACCAACTTCTCGCAATGCAAGGATGTGTTGAACTT
CCCAGCAATGCAATAAATCCCTTAATTCTTACTAATGGTATTCCGAATTC
CAACTTTACTCACAGCTCAAGTAACTCTGGAAATCCCAATTTGGATCTTC
TTGCATATTCGCAAATGAGTAATTATCCCTCAGCGGTCAACCTAAACAAC
TATTCCATTTCGGTTCCATATTCAAAGAATTCCAATATTTTCTTTTCTCA
CACCAATCCGACGGCGGAATAAACGCTTACTGAGGATGACAGCTTTAAGA
GTATTTATGTCTATTATAATTTGATTGTTTTTCATTCTTCCATTCTGAAT
TTATGTGGCCTCATCACAGAGTTGCCTTTTCTTGTGCAGCCTGATTTGGA
GAGAAATAACGCGATATTTACTTTAAAATTCTAACAGTCTCCGATGTTAT
TGTCGATATTATTTGAATTATTTTCCAACTTGTTCGTTTGATTTTAAAAG
TTTTAAATAAATTTTTTAATAAAAAAATTGATTAAAATAATTTTCTAATG
AATTTGAGATATTTGTAGCTTTTGTTTAAATTTCATAATTG
back to top

protein sequence of SMED30031010-orf-1

>SMED30031010-orf-1 ID=SMED30031010-orf-1|Name=SMED30031010-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=429bp
MTRSKYPNTLLHANGLPLINLSSKLFPVDYSSLNYPFIVPNSSRGFRESE
KLDNTFPKDINDNMNPQTVPPPPIYERQSKTNLYIKGLPENFNDESLESL
VPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNA
KYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKS
TNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPE
TRKRRNPSHQVDSLSSVRSLNVGNCLLNPTAALANNLCGSLYNQPLLLRN
QNVLASAASQVPLLHPATDSGAYFDLSQLYNLPSQNNYLYQLQNQLLAMQ
GCVELPSNAINPLILTNGIPNSNFTHSSSNSGNPNLDLLAYSQMSNYPSA
VNLNNYSISVPYSKNSNIFFSHTNPTAE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0000478pharynx musculature
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 82..156
e-value: 5.0E-6
score: 36.0
coord: 162..242
e-value: 3.0E-11
score: 53.4
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 83..139
e-value: 1.8E-7
score: 30.9
coord: 163..227
e-value: 7.7E-11
score: 41.7
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 81..155
score: 11.963
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 161..246
score: 14.334
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 152..254
e-value: 4.4E-19
score: 70.5
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 75..151
e-value: 3.7E-11
score: 44.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 244..265
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 244..259
NoneNo IPR availablePANTHERPTHR24012RNA BINDING PROTEINcoord: 73..372
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 144..255
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 71..141