Protein phosphatase 2C

Overview
NameProtein phosphatase 2C
Smed IDSMED30031007
Length (bp)1665
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein phosphatase 2C (SMED30031007) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein phosphatase 2C (SMED30031007) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein phosphatase 2C (SMED30031007) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein phosphatase 2C (SMED30031007) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031007

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30031007SMESG000028448.1 dd_Smed_v4_4958_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031007SMESG000028448.1 dd_Smed_v4_4958_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein phosphatase 2C vs. Ensembl Human
Match: PPM1E (protein phosphatase, Mg2+/Mn2+ dependent 1E [Source:HGNC Symbol;Acc:HGNC:19322])

HSP 1 Score: 90.5077 bits (223), Expect = 2.552e-18
Identity = 81/283 (28.62%), Postives = 125/283 (44.17%), Query Frame = 2
Query:  422 AISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENI---SLLGLFDGHNGPEAAEHCH-HLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
            AI N R K ED++ C+ D                  N   NLE+    +   +FDGH G +AA +   HL   L+ Q +         ++  EAL  AF + + +      +   + GTT  +  I  N ++ +WVGDS   LV K  + V L    H+P +  E   +   GG V   G    RVNG L+V+RA+GD      +      +   LDGTE  L+LA DG +D+      E   +  +   E+N   + V      ++      G+SDNI++++
Sbjct:  236 AIKNMRRKMEDKHVCIPDF-----------------NMLFNLEDQEEQAYFAVFDGHGGVDAAIYASIHLHVNLVRQEMFP-------HDPAEALCRAFRVTDERFVQKAARESLRCGTTGVVTFIRGNMLHVAWVGDSQVMLVRKG-QAVELMKP-HKPDREDEKQRIEALGGCVVWFGA--WRVNGSLSVSRAIGDAEHKPYICGDADSASTVLDGTEDYLILACDGFYDTVNPD--EAVKVVSDHLKENNGDSSMV---AHKLVASARDAGSSDNITVIV 485          
BLAST of Protein phosphatase 2C vs. Ensembl Human
Match: PPM1L (protein phosphatase, Mg2+/Mn2+ dependent 1L [Source:HGNC Symbol;Acc:HGNC:16381])

HSP 1 Score: 81.2629 bits (199), Expect = 6.040e-16
Identity = 82/297 (27.61%), Postives = 127/297 (42.76%), Query Frame = 2
Query:  401 NHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQ-----SSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDD--RKIVGVSALPSISECHLDGTEL-CLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            NH     +I  +R   EDR+  +TD+                     N  + S+ G+FDGH G  AAE+     P  L QHLQ         +     ++E   +   +    L      Y  +AGTT  + L+    +  + VGDS   L  KD   + L+   H+P Q  E   +   GG ++ +G    RV G+LA++R+LGD   + +  V   P I    LD  +   ++LASDGLWD+   S  E     +E   E +          ++I+ +    G  DNI++M+  F
Sbjct:   90 NHNVAVYSIQGRRDHMEDRFEVLTDLA--------------------NKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQ--QILSIDREMLEKLTVSYD-EAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHD-HKPYQLKERKRIKRAGGFISFNGS--WRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDA--FSNEEAVRFIKERLDEPHFG-------AKSIVLQSFYRGCPDNITVMVVKF 351          
BLAST of Protein phosphatase 2C vs. Ensembl Human
Match: PPM1F (protein phosphatase, Mg2+/Mn2+ dependent 1F [Source:HGNC Symbol;Acc:HGNC:19388])

HSP 1 Score: 78.9518 bits (193), Expect = 5.582e-15
Identity = 81/282 (28.72%), Postives = 123/282 (43.62%), Query Frame = 2
Query:  422 AISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWD---SKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
            AI N R K EDR+  +      S N     S+           N +   +FDGH G +AA +        +  H  ++       +   AL EAF   +        + R ++GTT    LI   T++ +W+GDS   LV +   QV      HRP +  E   +   GG V  S  D  RVNG LAV+RA+GD  +   VS     +   L G+E  L+LA DG +D    ++  GL  + L R+        Q     + + ++    + G+ DNI++M+
Sbjct:  161 AIRNTRRKMEDRHVSLP-----SFNQLFGLSDPV---------NRAYFAVFDGHGGVDAARYA------AVHVHTNAARQPELPTDPEGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILVQQG--QVVKLMEPHRPERQDEKARIEALGGFV--SHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTGSEDYLLLACDGFFDVVPHQEVVGLVQSHLTRQ--------QGSGLRVAEELVAAARERGSHDNITVMV 410          
BLAST of Protein phosphatase 2C vs. Ensembl Human
Match: ILKAP (ILK associated serine/threonine phosphatase [Source:HGNC Symbol;Acc:HGNC:15566])

HSP 1 Score: 78.1814 bits (191), Expect = 7.878e-15
Identity = 75/297 (25.25%), Postives = 129/297 (43.43%), Query Frame = 2
Query:  407 RAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLN--FKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLV-YKDRKQVHLT---SILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDR-KIVGVSALPSISECHLDGTELCLVLASDGLWD---SKQCSGLEIADLCREFFSEDNNKQTP---VDTLCQTIIDRGVKGGASDNISLMI 1258
            + Y      +R + +D +  + D+        C+  ++ I         +S   +FDGH G  A++         L +       I+    +   L + F   +  F       K  WK G+T+T  L   N +Y + +GDS A L  Y +  Q H     S  H P+Q  E + +   GG V    RD  RV GVL V+R++GD + K  GV+++P I  C L   +  ++LA DGL+     ++     ++ L  E       K       +  C  + ++ V+ G++DN+++M+
Sbjct:  108 KGYVAERKGEREEMQDAHVILNDI-----TEECRPPSSLITR-------VSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDVISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNV----RD-GRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEAACNRLANKAVQRGSADNVTVMV 387          
BLAST of Protein phosphatase 2C vs. Ensembl Human
Match: PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A [Source:HGNC Symbol;Acc:HGNC:9275])

HSP 1 Score: 75.485 bits (184), Expect = 2.967e-14
Identity = 72/268 (26.87%), Postives = 124/268 (46.27%), Query Frame = 2
Query:  506 QNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEH-CHHLAPYLL-SQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRW--KAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-DRKIVG--------VSALPSISECHL-DGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            ++++T +      LE+ S   ++DGH G + A++ C HL  ++  +Q  + S       N+   +   F  ++  +     K     ++G+T+   LI     Y    GDS   L+ ++RK VH  +  H+PS   E   + N GG V        RVNG LAV+RALGD D K V         VS  P + +    +  +  ++LA DG+WD       E+ D  R      ++    ++ +C  ++D  +  G+ DN+S+++  F
Sbjct:   37 EDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRG-LLCRNRK-VHFFTQDHKPSNPLEKERIQNAGGSVM-----IQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDV--MGNEELCDFVRSRLEVTDD----LEKVCNEVVDTCLYKGSRDNMSVILICF 291          
BLAST of Protein phosphatase 2C vs. Ensembl Celegans
Match: ilkp-1 (ILK associated serine/threonine Phosphatase homolog [Source:UniProtKB/TrEMBL;Acc:G5EDI3])

HSP 1 Score: 92.8189 bits (229), Expect = 2.020e-20
Identity = 74/262 (28.24%), Postives = 123/262 (46.95%), Query Frame = 2
Query:  530 NQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQS-SLCITGRYNLIEALGEAFYLLN--FKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDR----KQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-DRKIVGVSALPSISECHLDGTELCLVLASDGLWDS-----------KQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
             +K  L   S   +FDGH GP AAEHC       + + L   S   T   +L +   E++  ++  F     +NK  WK GTT+T  +I  N IY + +GDS A +  K        V LT + H P  + E + +   G +V K G    R+NGV+ V+R++GD   K +G+ + P + +  L   +L  ++A DGLW S           +Q    +  D+ +E    ++ +   +  + + +    V+    DN+S++I
Sbjct:   60 TEKSFLSRASFFAIFDGHAGPRAAEHCQSQMGKTVKEKLAKFSDFPTLTKSLKQTFTESYKAVDDGFLAIAKQNKPIWKDGTTATTMIILNNVIYVANIGDSRAVVARKKEDGSFAPVCLT-VDHDPMSHDERMRIQKAGAVV-KDG----RINGVIEVSRSIGDLPFKSLGIISTPDLKKLTLTKNDLFAIIACDGLWKSFSNLEAVSFAVEQLEAAKKTDIEQE--PNESREAAELRVVAEKLAAEAVRRKCGDNVSVII 313          
BLAST of Protein phosphatase 2C vs. Ensembl Celegans
Match: fem-2 (Protein phosphatase fem-2 [Source:UniProtKB/Swiss-Prot;Acc:P49594])

HSP 1 Score: 82.8037 bits (203), Expect = 1.327e-16
Identity = 78/285 (27.37%), Postives = 132/285 (46.32%), Query Frame = 2
Query:  425 ISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLID--QNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCR--EFFSEDNNKQTPVD---TLCQTIIDRGVKGGASDNISLMI 1258
            +  +R KQEDR+      L Y +  +               + IS+L +FDGH G E +++    A +L    L+         +L + L ++  LL+ ++     K  WK G+T+  C ID  Q  +  +W+GDS  +++     +    +  H PS   E   V   GG +   G +  RVNGVL +TRALGD      +S  P   +  ++ ++  ++LA DG+ D          DL +  E F+ D     PV+    L + I  + ++ G++DN+S++I
Sbjct:  168 LKGQRHKQEDRF------LAYPNGQYMDRGE----------DPISVLAVFDGHGGHECSQYA---AGHLWETWLEVRKSRDPSDSLEDQLRKSLELLDERMTVRSVKECWKGGSTAVCCAIDMDQKLMALAWLGDSPGYVMSN--IEFRQLTRGHSPSDEREARRVEEAGGQLFVIGGEL-RVNGVLNLTRALGDVPGRPMISNEPETCQVPIESSDYLVLLACDGISDV-----FNERDLYQLVEAFAND----YPVEDYAELSRFICTKAIEAGSADNVSVVI 421          
BLAST of Protein phosphatase 2C vs. Ensembl Celegans
Match: fem-2 (Protein phosphatase fem-2 [Source:UniProtKB/Swiss-Prot;Acc:P49594])

HSP 1 Score: 82.8037 bits (203), Expect = 1.327e-16
Identity = 78/285 (27.37%), Postives = 132/285 (46.32%), Query Frame = 2
Query:  425 ISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLID--QNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCR--EFFSEDNNKQTPVD---TLCQTIIDRGVKGGASDNISLMI 1258
            +  +R KQEDR+      L Y +  +               + IS+L +FDGH G E +++    A +L    L+         +L + L ++  LL+ ++     K  WK G+T+  C ID  Q  +  +W+GDS  +++     +    +  H PS   E   V   GG +   G +  RVNGVL +TRALGD      +S  P   +  ++ ++  ++LA DG+ D          DL +  E F+ D     PV+    L + I  + ++ G++DN+S++I
Sbjct:  168 LKGQRHKQEDRF------LAYPNGQYMDRGE----------DPISVLAVFDGHGGHECSQYA---AGHLWETWLEVRKSRDPSDSLEDQLRKSLELLDERMTVRSVKECWKGGSTAVCCAIDMDQKLMALAWLGDSPGYVMSN--IEFRQLTRGHSPSDEREARRVEEAGGQLFVIGGEL-RVNGVLNLTRALGDVPGRPMISNEPETCQVPIESSDYLVLLACDGISDV-----FNERDLYQLVEAFAND----YPVEDYAELSRFICTKAIEAGSADNVSVVI 421          
BLAST of Protein phosphatase 2C vs. Ensembl Celegans
Match: ppm-2 (Probable protein phosphatase 2C T23F11.1 [Source:UniProtKB/Swiss-Prot;Acc:P49596])

HSP 1 Score: 73.1738 bits (178), Expect = 8.496e-14
Identity = 69/266 (25.94%), Postives = 120/266 (45.11%), Query Frame = 2
Query:  503 CQNSN-----TCIKNQKLNLENI-------------SLLGLFDGHNGPEAAEHCH-HLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD------DRKIVG---VSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDR 1216
            C N N     +C++  ++++E+              +   ++DGH G + +++   +L   +++Q   S        N+ EA+ + F  L+ ++          +GTT+ + LI +  +Y    GDS A  V     +    S  H+PS  +E   +   GG V     +F+RVNG LA++RALGD      D K      V+A P +    L      +VLA DG+WD    +  E+ D  RE  +E  + Q    ++C+ ++ R
Sbjct:   17 CANENYLVGSSCMQGWRVDMEDAHTHLLSLPDDPKCAFFAVYDGHGGSKVSQYSGINLHKKVVAQKEFS------EGNMKEAIEKGFLELDQQMRVDEETKDDVSGTTAVVVLIKEGDVYCGNAGDSRA--VSSVVGEARPLSFDHKPSHETEARRIIAAGGWV-----EFNRVNGNLALSRALGDFAFKNCDTKPAEEQIVTAFPDVITDKLTPDHEFIVLACDGIWDVM--TNQEVVDFVREKLAEKRDPQ----SICEELLTR 263          
BLAST of Protein phosphatase 2C vs. Ensembl Celegans
Match: ppm-2 (Probable protein phosphatase 2C T23F11.1 [Source:UniProtKB/Swiss-Prot;Acc:P49596])

HSP 1 Score: 73.1738 bits (178), Expect = 8.496e-14
Identity = 69/266 (25.94%), Postives = 120/266 (45.11%), Query Frame = 2
Query:  503 CQNSN-----TCIKNQKLNLENI-------------SLLGLFDGHNGPEAAEHCH-HLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD------DRKIVG---VSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDR 1216
            C N N     +C++  ++++E+              +   ++DGH G + +++   +L   +++Q   S        N+ EA+ + F  L+ ++          +GTT+ + LI +  +Y    GDS A  V     +    S  H+PS  +E   +   GG V     +F+RVNG LA++RALGD      D K      V+A P +    L      +VLA DG+WD    +  E+ D  RE  +E  + Q    ++C+ ++ R
Sbjct:   17 CANENYLVGSSCMQGWRVDMEDAHTHLLSLPDDPKCAFFAVYDGHGGSKVSQYSGINLHKKVVAQKEFS------EGNMKEAIEKGFLELDQQMRVDEETKDDVSGTTAVVVLIKEGDVYCGNAGDSRA--VSSVVGEARPLSFDHKPSHETEARRIIAAGGWV-----EFNRVNGNLALSRALGDFAFKNCDTKPAEEQIVTAFPDVITDKLTPDHEFIVLACDGIWDVM--TNQEVVDFVREKLAEKRDPQ----SICEELLTR 263          
BLAST of Protein phosphatase 2C vs. Ensembl Fly
Match: CG10376 (gene:FBgn0032702 transcript:FBtr0081128)

HSP 1 Score: 89.3521 bits (220), Expect = 1.106e-18
Identity = 72/233 (30.90%), Postives = 107/233 (45.92%), Query Frame = 2
Query:  422 AISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQS-----SLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWD 1105
            A+ NK  K EDR  C+    R+   +   +  T               G+FDGH+G  +A +     P LL+  L++     +       N  E+   AF L + +      + +  +GTTS   LI ++ +Y +WVGDS A LV K R Q+ L    H+P    E   +   GG V  +   + RVNG+L V R++G D  +  V A P   +  L+     LVL +DGLWD
Sbjct:  164 AVKNKPRKMEDRCVCLD---RFGEMYELLDKTT------------RFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFES---AFLLADERFT----QKKITSGTTSVCALITKDQLYIAWVGDSKALLVGK-RTQLQLVKP-HKPENPDERKRIETAGGTVLHAQGQW-RVNGILNVARSIG-DYSLEAVIAEPDFVDVQLNEAHDFLVLGTDGLWD 370          
BLAST of Protein phosphatase 2C vs. Ensembl Fly
Match: CG17746 (gene:FBgn0035425 transcript:FBtr0073094)

HSP 1 Score: 77.0258 bits (188), Expect = 7.675e-15
Identity = 67/247 (27.13%), Postives = 118/247 (47.77%), Query Frame = 2
Query:  500 FCQNS-----NTCIKNQKLNLEN-------------ISLLGLFDGHNGPEAAEHC-HHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKY--RWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD----------DRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCR 1147
            +CQN+     ++C++  ++N+E+              +   ++DGH G   A++   HL  Y+L +   +        N+ +AL + F  +++ +   RNK      AG+T+ + L+  N +Y +  GDS A        Q+ + S+ H+P+  +E   +   GG V     +F+RVNG LA++RALGD          + +I  V+A P +    +      +VLA DG+WD    S  E+ + CR
Sbjct:   16 YCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGAAFFAVYDGHGGATVAQYAGKHLHKYVLKRPEYND-------NIEQALQQGFLDIDYVM--LRNKTCGDQMAGSTAVVVLVKDNKLYCANAGDSRAIACVN--GQLEVLSLDHKPNNEAESKRIIQGGGWV-----EFNRVNGNLALSRALGDYVFKHENKKPEDQI--VTAFPDVETRKIMDDWEFIVLACDGIWDVM--SNAEVLEFCR 242          
BLAST of Protein phosphatase 2C vs. Ensembl Fly
Match: CG17746 (gene:FBgn0035425 transcript:FBtr0073093)

HSP 1 Score: 77.0258 bits (188), Expect = 7.675e-15
Identity = 67/247 (27.13%), Postives = 118/247 (47.77%), Query Frame = 2
Query:  500 FCQNS-----NTCIKNQKLNLEN-------------ISLLGLFDGHNGPEAAEHC-HHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKY--RWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD----------DRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCR 1147
            +CQN+     ++C++  ++N+E+              +   ++DGH G   A++   HL  Y+L +   +        N+ +AL + F  +++ +   RNK      AG+T+ + L+  N +Y +  GDS A        Q+ + S+ H+P+  +E   +   GG V     +F+RVNG LA++RALGD          + +I  V+A P +    +      +VLA DG+WD    S  E+ + CR
Sbjct:   16 YCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGAAFFAVYDGHGGATVAQYAGKHLHKYVLKRPEYND-------NIEQALQQGFLDIDYVM--LRNKTCGDQMAGSTAVVVLVKDNKLYCANAGDSRAIACVN--GQLEVLSLDHKPNNEAESKRIIQGGGWV-----EFNRVNGNLALSRALGDYVFKHENKKPEDQI--VTAFPDVETRKIMDDWEFIVLACDGIWDVM--SNAEVLEFCR 242          
BLAST of Protein phosphatase 2C vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085442)

HSP 1 Score: 72.0182 bits (175), Expect = 3.322e-13
Identity = 74/255 (29.02%), Postives = 114/255 (44.71%), Query Frame = 2
Query:  545 LENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWK---AGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSIL-HRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-DRKIVG--------VSALPSI-SECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            L + S   +FDGH G + +EHC   A +LL   + +   I G +  ++ +   F  ++  +       R      GTT+    +    +Y +  GDS A L    R+ V + +   H+P    E   ++N GG V        RVNG LAV+RALGD D K V         VS  P I  +   D  E  LVLA DG+WD      +   D+C  F        + + ++   ++D  +  G+ DN+S++I  F
Sbjct:   50 LPDWSFFAVFDGHAGCKVSEHC---AKHLLESIISTEEFIGGDH--VKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLC---RQGVPVFATQDHKPILPEEKERIYNAGGSVM-----IKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEF-LVLACDGIWDV-----MSNEDVC-SFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAF 284          
BLAST of Protein phosphatase 2C vs. Ensembl Fly
Match: alph (gene:FBgn0086361 transcript:FBtr0085445)

HSP 1 Score: 72.0182 bits (175), Expect = 3.322e-13
Identity = 74/255 (29.02%), Postives = 114/255 (44.71%), Query Frame = 2
Query:  545 LENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWK---AGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSIL-HRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-DRKIVG--------VSALPSI-SECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            L + S   +FDGH G + +EHC   A +LL   + +   I G +  ++ +   F  ++  +       R      GTT+    +    +Y +  GDS A L    R+ V + +   H+P    E   ++N GG V        RVNG LAV+RALGD D K V         VS  P I  +   D  E  LVLA DG+WD      +   D+C  F        + + ++   ++D  +  G+ DN+S++I  F
Sbjct:   50 LPDWSFFAVFDGHAGCKVSEHC---AKHLLESIISTEEFIGGDH--VKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLC---RQGVPVFATQDHKPILPEEKERIYNAGGSVM-----IKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEF-LVLACDGIWDV-----MSNEDVC-SFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAF 284          
BLAST of Protein phosphatase 2C vs. Ensembl Zebrafish
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent, 1E [Source:ZFIN;Acc:ZDB-GENE-070326-2])

HSP 1 Score: 88.5817 bits (218), Expect = 5.434e-18
Identity = 81/290 (27.93%), Postives = 129/290 (44.48%), Query Frame = 2
Query:  404 HRAYYK----AISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHC-HHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
            H  YY+    AI N R K ED++  + D             NT    Q  + E  +   +FDGH G +AA +  +HL   L+ Q + S        +  EAL  +F L + +          + GTT  +  +   T+Y +W+GDS   +V K  + V L    H+P +  E   +   GG V   G    RVNG L+V+RA+GD      +      S  +LDG+E  L+LA DG +D+   +  E   +  +   E+N        +   ++      G+SDNI++++
Sbjct:  141 HLPYYETSIHAIKNMRRKMEDKHVVIPDF------------NTLFNLQ--DQEEQAYFAVFDGHGGVDAANYAANHLHVNLVRQEMFSQ-------DAGEALCHSFKLTDERFIKKAKSENLRCGTTGVVTFLRGRTLYVTWLGDSQVMMV-KRGQPVELMKP-HKPDREDEKKRIEALGGCVIWFGTW--RVNGSLSVSRAIGDSEHKPYICGDADCSTFNLDGSEDYLILACDGFYDT--VNPEEAVRVVSDHLQENNGDTA---MVAHKLVASARDAGSSDNITVIV 400          
BLAST of Protein phosphatase 2C vs. Ensembl Zebrafish
Match: ppm1f (protein phosphatase, Mg2+/Mn2+ dependent, 1F [Source:ZFIN;Acc:ZDB-GENE-051128-2])

HSP 1 Score: 85.5001 bits (210), Expect = 2.176e-17
Identity = 95/337 (28.19%), Postives = 146/337 (43.32%), Query Frame = 2
Query:  275 LLQNELVSYPELLTVTKKYLSIYIN-EKLKNNPHDPSGLRNSSNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENI---SLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLN--FKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNIS-LMIFV 1264
            LLQ+E    P L     K  ++ +  +K   NP  PS    S  H     AI N R K EDR+  + +                  NQ L L++        +FDGH G +AA +       +LSQ  Q  L    + +   A    F   +  FK+   R + R  +G+T    L+  + +  SW+GDS A LV +      +    H+P +  E   + + GG +   G    RVNG  AV+RA+GD  +   VS     S  HL G E  ++LA DG +D  + +  ++  L  E   E       V    Q+++ +    G+SDNI+ L++F+
Sbjct:  103 LLQSE----PVLRLFINKLRAVGVAWQKQPPNPDAPS----SRTHSCSVHAIRNTRRKMEDRHVILKEF-----------------NQLLGLQDGVGREYYAVFDGHGGVDAATYSATHLHIVLSQ--QGEL----KTDAATAFKNTFTQTDDMFKIKAKRERLR--SGSTGVAVLLTSDLLTVSWLGDSQALLVRQGEPVTLMDP--HKPEREDEKKRIEDLGGCIAFMG--CWRVNGTYAVSRAIGDFDQKPYVSNEADSSSFHLTGDEDYVLLACDGFFDVIRPA--DVPALVLEALRESGGSGNDV---AQSLVAQAKTAGSSDNITVLLVFL 397          
BLAST of Protein phosphatase 2C vs. Ensembl Zebrafish
Match: ppm1f (protein phosphatase, Mg2+/Mn2+ dependent, 1F [Source:ZFIN;Acc:ZDB-GENE-051128-2])

HSP 1 Score: 85.5001 bits (210), Expect = 2.176e-17
Identity = 95/337 (28.19%), Postives = 146/337 (43.32%), Query Frame = 2
Query:  275 LLQNELVSYPELLTVTKKYLSIYIN-EKLKNNPHDPSGLRNSSNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENI---SLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLN--FKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNIS-LMIFV 1264
            LLQ+E    P L     K  ++ +  +K   NP  PS    S  H     AI N R K EDR+  + +                  NQ L L++        +FDGH G +AA +       +LSQ  Q  L    + +   A    F   +  FK+   R + R  +G+T    L+  + +  SW+GDS A LV +      +    H+P +  E   + + GG +   G    RVNG  AV+RA+GD  +   VS     S  HL G E  ++LA DG +D  + +  ++  L  E   E       V    Q+++ +    G+SDNI+ L++F+
Sbjct:  103 LLQSE----PVLRLFINKLRAVGVAWQKQPPNPDAPS----SRTHSCSVHAIRNTRRKMEDRHVILKEF-----------------NQLLGLQDGVGREYYAVFDGHGGVDAATYSATHLHIVLSQ--QGEL----KTDAATAFKNTFTQTDDMFKIKAKRERLR--SGSTGVAVLLTSDLLTVSWLGDSQALLVRQGEPVTLMDP--HKPEREDEKKRIEDLGGCIAFMG--CWRVNGTYAVSRAIGDFDQKPYVSNEADSSSFHLTGDEDYVLLACDGFFDVIRPA--DVPALVLEALRESGGSGNDV---AQSLVAQAKTAGSSDNITVLLVFL 397          
BLAST of Protein phosphatase 2C vs. Ensembl Zebrafish
Match: ppm1nb (protein phosphatase, Mg2+/Mn2+ dependent, 1Nb (putative) [Source:ZFIN;Acc:ZDB-GENE-071004-34])

HSP 1 Score: 81.2629 bits (199), Expect = 5.231e-16
Identity = 78/271 (28.78%), Postives = 118/271 (43.54%), Query Frame = 2
Query:  506 QNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYN-------LIEALGEAFYLLNFKLNGCRNKYRW-KAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-DRKIVG--------VSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            ++ + C       L + +   +FDGH G   A++C        S++L   +  TG+         + E   E F+L++  L+    +  W + GTT     I  + IY    GDS A L    R  V  ++  H+P    E   + + GG VT       RVNG LAV+RALGD   K V         VS  P +S       +  LVLA DG+WD+     +   +LC  F        T +  +C  +ID  +  G+ DNIS+++  F
Sbjct:   92 EDFHNCFPQLGGELSHWAFFAVFDGHAGSAVAQNC--------SRNLLDHILGTGKIRADEDVERVTEGFKEGFFLMDKHLHAMACREGWERGGTTVVSTAITPHHIYFVNCGDSRAVLCRAGR--VAFSTEDHKPFSPGEKERIESAGGSVT-----LQRVNGSLAVSRALGDFSYKTVEWRSVTEQMVSPEPEVSVVERSPADEFLVLACDGVWDT-----VSNEELC-AFVHSRLRICTDLREVCSQVIDLCLYKGSLDNISIILVCF 341          
BLAST of Protein phosphatase 2C vs. Ensembl Zebrafish
Match: ppm1lb (protein phosphatase, Mg2+/Mn2+ dependent, 1Lb [Source:ZFIN;Acc:ZDB-GENE-060929-136])

HSP 1 Score: 76.6406 bits (187), Expect = 1.079e-14
Identity = 83/299 (27.76%), Postives = 128/299 (42.81%), Query Frame = 2
Query:  398 SNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRW------KAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDD--RKIVGVSALPSISECHLDGTE-LCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            S   A Y +I  +R   EDR+  +TD                      N  + ++  ++DGH G  AAE+     P +L Q LQ       R     A+     L    LN  R           +AGTT  + L+ +  +  + VGDS A L  KD   + L+   H+P Q  E   +   GG ++ SG    RV GVL+++R+LGD   +K+  +   P +    LD  +   ++LASDGLWD+   S  E     +E   E +          ++I+ +    G  DNI++M+  F
Sbjct:   79 SGAAAVY-SIQGRRDHMEDRFDILTDTR--------------------NRSHPAIFSIYDGHGGEAAAEYAKAHLPIMLRQQLQR----YERQKENSAVSRQAILRQQILNMDREILEKLTASYDEAGTTCLVALLSEKELTVANVGDSRAVLCDKDGNAIPLSHD-HKPYQLKERKRIKKAGGFISFSGS--WRVQGVLSMSRSLGDFPLKKLKVLIPDPDLMTFDLDTLQPQFMILASDGLWDT--FSNEEAVHFIKERLDEPHFG-------AKSIVLQSFYRGCPDNITVMVVKF 340          
BLAST of Protein phosphatase 2C vs. Ensembl Xenopus
Match: PPM1F (protein phosphatase, Mg2+/Mn2+ dependent 1F [Source:NCBI gene;Acc:100380003])

HSP 1 Score: 87.4261 bits (215), Expect = 7.087e-18
Identity = 83/283 (29.33%), Postives = 133/283 (47.00%), Query Frame = 2
Query:  422 AISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLN--FKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSIL--HRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
            AI N R K EDR+  + D           N    IK+        S   +FDGH G +AA +        +++H    L      +  +AL E+F   +  F     R   R ++GTT    L++ +  + +W+GDS A LV    +Q +  +++  H+P +  E   + + GG V   G    RVNG LAV+RA+GD  +   VS    ++   L GTE  LVLA DG +D+   S  E+  L  ++  E+      V    + ++    +GG+SDNI++++
Sbjct:  138 AIRNTRRKMEDRHVILQDF----------NMLFGIKDSIPR----SYFAVFDGHGGVDAANYASTYVHVNVARH--EGL----EQDPAQALRESFQRTDAMFLKKAKREIPRLRSGTTGVCILLEGDRFHVAWLGDSQALLV----RQGNYVTLMDPHKPERKDERERIESLGGCVAFMG--CWRVNGTLAVSRAIGDIDQKPFVSGEGDVTSHILSGTEDFLVLACDGFYDT--VSPPEVPRLVFDYLQENGGNWQHV---AERLVTVAKEGGSSDNITVVV 389          
BLAST of Protein phosphatase 2C vs. Ensembl Xenopus
Match: rtp3c (receptor (chemosensory) transporter protein 3 gene C [Source:Xenbase;Acc:XB-GENE-940866])

HSP 1 Score: 85.1149 bits (209), Expect = 1.495e-17
Identity = 72/259 (27.80%), Postives = 123/259 (47.49%), Query Frame = 2
Query:  542 NLENISLLGLFDGHNGPEA----AEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVY---KDRKQVHLT-SILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDR-KIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPV-----------DTLCQTIIDRGVKGGASDNISLMI 1258
            +L  +S   +FDGH G  A    A++ H      + +   SS+    +  +++A  +     +F       K  WK GTT+   L+  N +Y + +GDS A L     +++K V L+ S  H P+Q  E + +   GG V++ G    RV GVL V+R++GD + K  GV + P +  C L  ++  ++LA DGL+  K  S  E         +    K +P            ++ C  + +  V+ GA+DN++++I
Sbjct:   65 DLLRLSYFAVFDGHGGTRASRFAAQNLHQNFVKKIPRGEGSSVDKAMKRCILDAFKQTDE--DFLKQAASQKPAWKDGTTAICVLVADNILYIANLGDSRALLCRINKENQKHVVLSLSREHNPTQYEERMRIQKAGGNVSRDG----RVLGVLEVSRSIGDGQYKRYGVISTPEVKRCPLTDSDRFILLACDGLF--KAFSAEEAVTF---ILTHTQEKSSPAEDGPPDFDSLYESACHRLANEAVRRGAADNVTVLI 312          
BLAST of Protein phosphatase 2C vs. Ensembl Xenopus
Match: PPM1L (protein phosphatase, Mg2+/Mn2+ dependent 1L [Source:NCBI gene;Acc:594892])

HSP 1 Score: 84.3445 bits (207), Expect = 4.498e-17
Identity = 84/303 (27.72%), Postives = 133/303 (43.89%), Query Frame = 2
Query:  398 SNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQS----------SLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDD--RKIVGVSALPSISECHLDGTEL-CLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            SN+ A Y +I  +R   EDR+  +TD++                    N  + S+ G+FDGH G  AAE+     P +L QHLQ           S  I     ++    E    L+   +        +AGTT  + L+    +  + VGDS   L  KD   + L+   H+P Q  E   +   GG ++ +G    RV G+LA++R+LGD   + +  + + P I    LD  +   ++LASDGLWD+   S  E     +E   E +          ++I+ +    G  DNI++M+  F
Sbjct:   75 SNNVAVY-SIQGRRDHMEDRFEIITDLV--------------------NKSHPSIFGIFDGHGGESAAEYVKTHLPEVLKQHLQDFERDKENSVLSYQIILEQQILAIDREMLEKLSVSYD--------EAGTTCLIALLSDKELTVANVGDSRGVLCDKDGNAIPLSHD-HKPYQLKERKRIKRAGGFISFNGS--WRVQGILAMSRSLGDYPLKNLNVIISDPDILSFDLDKLQPEFMILASDGLWDA--FSNEEAVRFIKERLDEPHFG-------AKSIVLQSFYRGCPDNITVMVVKF 336          
BLAST of Protein phosphatase 2C vs. Ensembl Xenopus
Match: PPM1L (protein phosphatase, Mg2+/Mn2+ dependent 1L [Source:NCBI gene;Acc:594892])

HSP 1 Score: 83.5741 bits (205), Expect = 7.579e-17
Identity = 84/303 (27.72%), Postives = 133/303 (43.89%), Query Frame = 2
Query:  398 SNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQS----------SLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDD--RKIVGVSALPSISECHLDGTEL-CLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            SN+ A Y +I  +R   EDR+  +TD++                    N  + S+ G+FDGH G  AAE+     P +L QHLQ           S  I     ++    E    L+   +        +AGTT  + L+    +  + VGDS   L  KD   + L+   H+P Q  E   +   GG ++ +G    RV G+LA++R+LGD   + +  + + P I    LD  +   ++LASDGLWD+   S  E     +E   E +          ++I+ +    G  DNI++M+  F
Sbjct:   90 SNNVAVY-SIQGRRDHMEDRFEIITDLV--------------------NKSHPSIFGIFDGHGGESAAEYVKTHLPEVLKQHLQDFERDKENSVLSYQIILEQQILAIDREMLEKLSVSYD--------EAGTTCLIALLSDKELTVANVGDSRGVLCDKDGNAIPLSHD-HKPYQLKERKRIKRAGGFISFNGS--WRVQGILAMSRSLGDYPLKNLNVIISDPDILSFDLDKLQPEFMILASDGLWDA--FSNEEAVRFIKERLDEPHFG-------AKSIVLQSFYRGCPDNITVMVVKF 351          
BLAST of Protein phosphatase 2C vs. Ensembl Xenopus
Match: PPM1E (protein phosphatase, Mg2+/Mn2+ dependent 1E [Source:NCBI gene;Acc:100496571])

HSP 1 Score: 82.8037 bits (203), Expect = 5.156e-16
Identity = 78/283 (27.56%), Postives = 120/283 (42.40%), Query Frame = 2
Query:  422 AISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENI---SLLGLFDGHNGPEAAEHCH-HLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
            AI N R K ED++ C+ D                  N   NLE+    +   +FDGH G +AA +   HL   L+ Q +          +  EAL  AF + +        +   + GTT  +  I  N ++ +W+GDS   LV   R Q       H+P +  E   +   GG V   G    RVNG L+V+RA+GD      +          LDG+E  L+LA DG +D+      E   +  +   E+N   + V      ++      G+SDNI++++
Sbjct:  142 AIKNMRRKMEDKHVCIPDF-----------------NILFNLEDQEEQAYFAVFDGHGGVDAAIYASIHLHVNLVRQEIFPQ-------DPAEALCRAFRITDESFVQKAARENLRCGTTGVVTFIRGNMLHIAWLGDSQVMLVR--RGQAVELMKPHKPDREDEKHRIEALGGCVVWFGA--WRVNGSLSVSRAIGDAEHKPYICGDADSVSTVLDGSEDYLILACDGFYDTVNPD--EAVKVVSDHLKENNGDSSMV---AHKLVASARDAGSSDNITVIV 391          
BLAST of Protein phosphatase 2C vs. Ensembl Mouse
Match: Ppm1e (protein phosphatase 1E (PP2C domain containing) [Source:MGI Symbol;Acc:MGI:2444096])

HSP 1 Score: 90.8929 bits (224), Expect = 1.302e-18
Identity = 83/290 (28.62%), Postives = 128/290 (44.14%), Query Frame = 2
Query:  413 YYK----AISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENI---SLLGLFDGHNGPEAAEHCH-HLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
            YY+    AI N R K ED++ C+ D                  N   NLE+    +   +FDGH G +AA +   HL   L+ Q +         ++  EAL  AF + + +      +   + GTT  +  I  N ++ +WVGDS   LV K  + V L    H+P +  E   +   GG V   G    RVNG L+V+RA+GD      +      +   LDGTE  L+LA DG +D+      E   +  +   E+N   + V      ++      G+SDNI++++
Sbjct:  226 YYETSIHAIKNMRRKMEDKHVCIPDF-----------------NMLFNLEDQEEQAYFAVFDGHGGVDAAIYASVHLHVNLVRQEMFP-------HDPAEALCRAFRVTDERFVQKAARESLRCGTTGVVTFIRGNMLHVAWVGDSQVMLVRKG-QAVELMKP-HKPDREDEKQRIEALGGCVVWFGA--WRVNGSLSVSRAIGDAEHKPYICGDADSASTVLDGTEDYLILACDGFYDTVNPD--EAVKVVSDHLKENNGDSSMV---AHKLVASARDAGSSDNITVIV 482          
BLAST of Protein phosphatase 2C vs. Ensembl Mouse
Match: Ppm1f (protein phosphatase 1F (PP2C domain containing) [Source:MGI Symbol;Acc:MGI:1918464])

HSP 1 Score: 87.4261 bits (215), Expect = 6.651e-18
Identity = 86/282 (30.50%), Postives = 124/282 (43.97%), Query Frame = 2
Query:  422 AISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWD---SKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
            AI N R K EDR+  +      + NH    S++  +         +   +FDGH G +AA +        +  H  +S     R N   AL EAF L +        + R ++GTT    LI    ++ +W+GDS   LV + R  V L    H+P +  E   +   GG V  S  D  RVNG LAV+RA+GD  +   VS     +   L G+E  L+LA DG +D     + +GL    L R       N     + L     DR    G+ DNI++M+
Sbjct:  158 AIRNTRRKMEDRHVSLP-----AFNHLFGLSDSVHR---------AYFAVFDGHGGVDAARYAS------VHVHTNASHQPELRTNPAAALKEAFRLTDEMFLQKAKRERLQSGTTGVCALIAGAALHVAWLGDSQVILVQQGRV-VKLMEP-HKPERQDEKARIEALGGFV--SLMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRELTGSEDYLLLACDGFFDVVPHHEVTGLVHGHLLR----HKGNGMRIAEELVAVARDR----GSHDNITVMV 407          
BLAST of Protein phosphatase 2C vs. Ensembl Mouse
Match: Ppm1l (protein phosphatase 1 (formerly 2C)-like [Source:MGI Symbol;Acc:MGI:2139740])

HSP 1 Score: 79.337 bits (194), Expect = 1.677e-15
Identity = 82/298 (27.52%), Postives = 130/298 (43.62%), Query Frame = 2
Query:  401 NHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQ------SSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDD--RKIVGVSALPSISECHLDGTEL-CLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            +H     +I  +R   EDR+  +TD+                     N  + S+ G+FDGH G  AAE+     P  L QHLQ       +  +T +  L + +      +  KL    ++    AGTT  + L+    +  + VGDS   L  KD   + L+   H+P Q  E   +   GG ++ +G    RV G+LA++R+LGD   + +  V   P I    LD  +   ++LASDGLWD+   S  E     +E   E +          ++I+ +    G  DNI++M+  F
Sbjct:   90 SHNVAVYSIQGRRDHMEDRFEVLTDLA--------------------NKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLTYQTILEQQILSIDREMLEKLTVSYDE----AGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHD-HKPYQLKERKRIKRAGGFISFNGS--WRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDA--FSNEEAVRFIKERLDEPHFG-------AKSIVLQSFYRGCPDNITVMVVKF 351          
BLAST of Protein phosphatase 2C vs. Ensembl Mouse
Match: Ilkap (integrin-linked kinase-associated serine/threonine phosphatase 2C [Source:MGI Symbol;Acc:MGI:1914694])

HSP 1 Score: 78.1814 bits (191), Expect = 5.170e-15
Identity = 79/300 (26.33%), Postives = 132/300 (44.00%), Query Frame = 2
Query:  407 RAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLN--FKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLV-YKDRKQVHLTSIL---HRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDR-KIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQT----PV-----DTLCQTIIDRGVKGGASDNISLMI 1258
            + Y      +R + +D +  + D+ +      C   ++ I         +S   +FDGH G  A++         L +       I+    +   L + F   +  F       K  WK G+T+T  L   N +Y + +GDS A L  Y +  Q H    L   H P+Q  E + +   GG V    RD  RV GVL V+R++GD + K  GV+++P I  C L   +  ++LA DGL+  K  +  E  +       ED+  QT    P      +  C  + ++ V+ G++DN+++M+
Sbjct:  108 KGYVAERKGEREEMQDAHVILNDITQE-----CNPPSSLITR-------VSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDIISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNV----RD-GRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLF--KVFTPEEAVNFILSCL-EDDKIQTREGKPAVDARYEAACNRLANKAVQRGSADNVTVMV 387          
BLAST of Protein phosphatase 2C vs. Ensembl Mouse
Match: Ppm1a (protein phosphatase 1A, magnesium dependent, alpha isoform [Source:MGI Symbol;Acc:MGI:99878])

HSP 1 Score: 75.0998 bits (183), Expect = 3.049e-14
Identity = 72/268 (26.87%), Postives = 123/268 (45.90%), Query Frame = 2
Query:  506 QNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEH-CHHLAPYLL-SQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRW--KAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-DRKIVG--------VSALPSISECHL-DGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            ++++T +      LE  S   ++DGH G + A++ C HL  ++  +Q  + S       N+   +   F  ++  +     K     ++G+T+   LI     Y    GDS   L+ ++RK VH  +  H+PS   E   + N GG V        RVNG LAV+RALGD D K V         VS  P + +    +  +  ++LA DG+WD       E+ D  R      ++    ++ +C  ++D  +  G+ DN+S+++  F
Sbjct:   37 EDAHTAVIGLPSGLETWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFRGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRG-LLCRNRK-VHFFTQDHKPSNPLEKERIQNAGGSVM-----IQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVM--GNEELCDFVRSRLEVTDD----LEKVCNEVVDTCLYKGSRDNMSVILICF 291          
BLAST of Protein phosphatase 2C vs. UniProt/SwissProt
Match: sp|Q8LAY8|P2C69_ARATH (Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana OX=3702 GN=At5g10740 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.192e-19
Identity = 85/302 (28.15%), Postives = 139/302 (46.03%), Query Frame = 2
Query:  368 PHDPSGLRNSSNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRY--NLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            P    GL  +      Y + + KR+  ED +    D                     +N E + L G+FDGH G  AAE+        + +HL S+L    ++  +   A+ +A+   + +L    N +   AG+T++  ++  + +  + VGDS A ++ +  K + + S  H+P Q+ E   + N GG V  +G    RV GVLAV+RA GD      V A P I E  +D T   L+LASDGLWD    S      + +E        + P D+  + ++   +K G++DNI+ ++  F
Sbjct:   20 PASGGGLSQNGKFSYGYASSAGKRSSMEDFFETRID--------------------GINGEIVGLFGVFDGHGGARAAEY--------VKRHLFSNLITHPKFISDTKSAITDAYNHTDSELLKSENSHNRDAGSTASTAILVGDRLVVANVGDSRA-VISRGGKAIAV-SRDHKPDQSDERERIENAGGFVMWAGTW--RVGGVLAVSRAFGDRLLKQYVVADPEIQEEKIDDTLEFLILASDGLWDV--FSNEAAVAMVKEV-------EDPEDS-AKKLVGEAIKRGSADNITCVVVRF 279          
BLAST of Protein phosphatase 2C vs. UniProt/SwissProt
Match: sp|Q0JL75|P2C07_ORYSJ (Probable protein phosphatase 2C 7 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0618200 PE=2 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 6.469e-19
Identity = 76/248 (30.65%), Postives = 118/248 (47.58%), Query Frame = 2
Query:  524 IKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            IK+ K++   I+L G+FDGH G  AAE   HL  +L    L+    IT   +   A+ E +   +            + G+T++  +   N IY + VGDS   ++ K  K + L+S  H+P++  E   + N GG+VT SG    RV GVLA++RA G+      V A P + E  +D     L+LASDGLWD      +   +    F   +   +     L +    R    G++DNI+ ++  F
Sbjct:  134 IKSSKVDDNQINLFGIFDGHGGSHAAE---HLKKHLFENLLKHPSFIT---DTKSAISETYRKTDSDFLDAETNINREDGSTASTAIFVGNHIYVANVGDSRT-VMSKAGKAIALSSD-HKPNRKDERKRIENAGGVVTWSGT--WRVGGVLAMSRAFGNRFLKRFVVAEPEVQEQEIDDDLEFLILASDGLWD------VVSNEHAVAFVKAEEGPEAAARKLAEIAFAR----GSTDNITCIVVKF 361          
BLAST of Protein phosphatase 2C vs. UniProt/SwissProt
Match: sp|Q67UX7|P2C10_ORYSJ (Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0149800 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.939e-18
Identity = 85/303 (28.05%), Postives = 136/303 (44.88%), Query Frame = 2
Query:  365 NPHDPSGLRNSSNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRY--NLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            +P    GL  +      Y +   KR   ED Y    D                     ++ E I L G+FDGH G  AAE+        + QHL S+L    ++  ++  A+ E +   + +     + +   AG+T++  ++  + +  + VGDS A +V +    + + S  H+P Q+ E   + + GG V  +G    RV GVLAV+RA GD      V A P I E  +D +   L+LASDGLWD    S  E  D+ R         Q P +   + ++    + G++DNI+++I  F
Sbjct:   68 SPVSGGGLSENGKFSYGYASAPGKRASMEDFYETRID--------------------GVDGETIGLFGVFDGHGGARAAEY--------VKQHLFSNLIKHPKFISDIKSAIAETYNHTDSEFLKAESSHTRDAGSTASTAILVGDRLLVANVGDSRA-VVCRGGDAIAV-SRDHKPDQSDERQRIEDAGGFVMWAGTW--RVGGVLAVSRAFGDKLLKQYVVADPEIKEEIVDSSLEFLILASDGLWDV--VSNKEAVDMVRPI-------QDP-EQAAKRLLQEAYQRGSADNITVVIVRF 328          
BLAST of Protein phosphatase 2C vs. UniProt/SwissProt
Match: sp|Q4PSE8|P2C71_ARATH (Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana OX=3702 GN=At5g24940 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.236e-18
Identity = 75/245 (30.61%), Postives = 121/245 (49.39%), Query Frame = 2
Query:  539 LNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRY--NLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            ++ E + L G+FDGH G  AAE+        + +HL S+L    ++  +   A+ +A+   + +L    N +   AG+T++  ++  + +  + VGDS A +           S  H+P Q+ E   + N GG V  +G    RV GVLAV+RA GD      V A P I E  +D +   L+LASDGLWD    S  E   + +E   ED  + T      + ++   +K G++DNI+ ++  F
Sbjct:   57 IDGEIVGLFGVFDGHGGSRAAEY--------VKRHLFSNLITHPKFISDTKSAIADAYTHTDSELLKSENSHTRDAGSTASTAILVGDRLLVANVGDSRAVICRG--GNAFAVSRDHKPDQSDERERIENAGGFVMWAGTW--RVGGVLAVSRAFGDRLLKQYVVADPEIQEEKIDDSLEFLILASDGLWDV--FSNEEAVAVVKEV--EDPEEST------KKLVGEAIKRGSADNITCVVVRF 279          
BLAST of Protein phosphatase 2C vs. UniProt/SwissProt
Match: sp|Q652Z7|P2C55_ORYSJ (Probable protein phosphatase 2C 55 OS=Oryza sativa subsp. japonica OX=39947 GN=Os06g0526700 PE=2 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 4.124e-18
Identity = 70/199 (35.18%), Postives = 106/199 (53.27%), Query Frame = 2
Query:  521 CIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRY--NLIEALGEAFYL--LNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWD 1105
             IK+  +N E +SL G+FDGH GP AAE+        L +HL  +L    ++  +   A+ + F     +F  +   ++YR   G+T+   ++  N +Y + VGDS A +  K  K V L+   H+P++  E   + + GGIV     D  RV+G+LAV+RA G+      V A P+I E  +D     LVLA+DGLWD
Sbjct:  140 SIKSTTVNGETVSLFGVFDGHGGPRAAEY--------LKKHLFKNLVKHPKFLKDTKLAINQTFLKTDADFLQSISSDRYR-DDGSTAVAAILIGNRLYVANVGDSRA-VALKAGKAVPLSED-HKPNKKDERKRIEDAGGIVVSD--DIWRVDGILAVSRAFGNRLMKRYVKAEPNIQEKVVDEGLEYLVLATDGLWD 325          
BLAST of Protein phosphatase 2C vs. TrEMBL
Match: A0A4E0S2B4 (Protein phosphatase 2C OS=Fasciola hepatica OX=6192 GN=D915_001691 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 5.693e-31
Identity = 93/290 (32.07%), Postives = 138/290 (47.59%), Query Frame = 2
Query:   86 EKNEVNTPIRLRSVLKNVDSDNVLAYVKSFIMNTCNTLYKSNNIFCERICSDFIN--SDFWKYNSLLQNELVSYPEL-----------LTVTKKYLSIYINEKLKNNPHDPSGLRNSSNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDV 916
            E +  N+ +R R V++ VD    +AY  S     C +++          C  FI+   + WK    L+  L S  +            L   K  + + +   L  N    S   NS        +  N+R +QEDR+F   D+L Y   +   + ++   +      ++S +G+FDGHNGPEAAEHC HLAPY LS  L+  L      ++ E L E  +LLN  +N  R K  W +GTT T+C+   + IYT WVGDS AWLVY D  +V +     + S  ++ +DV
Sbjct:   20 ESSSKNSTVRFRPVVRAVDRKYAVAYALSIAEKYCLSVFSD--------CVSFISYYPEVWKN---LKKRLKSDDQAAFDYNTVHSISLDCAKHAVELCVAAGLPVNCATISPSWNSIGLSLDVSSAVNRRRRQEDRWFASADLLSYFPRNELDDFSSATDH-----PSVSAVGVFDGHNGPEAAEHCSHLAPYFLSIGLKKRL--GASISITELLSEVIFLLNEAVNEGRAKRYWTSGTTGTICVFYGDRIYTGWVGDSQAWLVYADMVKVPVEQPPKKQSFPTQPVDV 291          

HSP 2 Score: 84.3445 bits (207), Expect = 2.230e-13
Identity = 62/232 (26.72%), Postives = 100/232 (43.10%), Query Frame = 2
Query:  848 DRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFD----------------------------------------RVNGVLAVTRALGDDRKIVGVSALPSISECHLDGT-----ELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVFXXXXXXXXXXXYDFSYQDSRAIKWPRDRRMSCFSQNLDQLRLCPEKL 1408
            D   V LT  +HRP    E + V  +GG VT      D                                        RV G+  V+RA+GDD+ ++G++ALPS++             LCL++A+DGLWD+  C G ++A + R++F E++        L Q +I+  +  GASDN++      N  NS      Y      + +++WPR  R    +  +D + L P+ +
Sbjct:  343 DDLAVALTDRIHRPEFAPEFVSVLRSGGSVTTELASDDGNTSFTETFVNVQQNLPYWVKPPKTRLSRPQLDDPNLVDCRVAGMSCVSRAIGDDQSVLGMTALPSMTVLERPPKSASRQPLCLIVATDGLWDTDDCCGQDVAAIARKWFQENSTDGIVKVGLSQHLINLAIDKGASDNVTCCTVWVNRWNSVHEAVDYGIDVPQTSSVQWPRGLRT---ASQVDFVALVPQSV 571          
BLAST of Protein phosphatase 2C vs. TrEMBL
Match: A0A183ANE3 (PPM-type phosphatase domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS8478 PE=4 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 2.834e-29
Identity = 68/143 (47.55%), Postives = 89/143 (62.24%), Query Frame = 2
Query:  422 AISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKD 850
            +I N R +QEDR+F   D+L Y   +   +S+   K+      +IS +G+FDGHNGPEAAEHC HLAPY LS  L+  LC  G  ++ + L E  YLLN  +N  R K  W +GTT T+C+   + IYT WVGDS AWL+Y D
Sbjct:   90 SIVNHRRRQEDRWFASADLLSYLPRNE-SDSSPLPKDHP----SISAIGVFDGHNGPEAAEHCSHLAPYYLSIGLKKRLC--GPISVTDLLSEVIYLLNEAVNEGRAKRYWASGTTGTICVFYGDRIYTGWVGDSQAWLIYAD 225          

HSP 2 Score: 91.2781 bits (225), Expect = 1.400e-15
Identity = 49/151 (32.45%), Postives = 83/151 (54.97%), Query Frame = 2
Query:  962 RVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTE-----LCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVFXXXXXXXXXXXYDFSYQDSRAIKWPRDRR----MSCFSQNLDQL 1387
            RV G+  V+RA+GDD  ++G++ALPS++       +     LCL++ASDGLWD++ C G ++A + R++F E +N  T    L Q ++D  V+ GA DN++      N  N      +Y      + +++WPR  R    M C +  + ++
Sbjct:  378 RVAGMSCVSRAIGDDHAVMGMTALPSMTVWERPSEKSTRQPLCLIVASDGLWDTEDCCGQDVAVIARKWFREHSNGGTVESGLSQQLVDLAVEKGAMDNVTCCTLWLNQWNRTGKPVNYGLDIPKTTSVQWPRGLRTASQMDCVTSQMQRI 528          
BLAST of Protein phosphatase 2C vs. TrEMBL
Match: A0A504YMF8 (PPM-type phosphatase domain-containing protein (Fragment) OS=Fasciola gigantica OX=46835 GN=FGIG_02744 PE=4 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 7.758e-29
Identity = 67/162 (41.36%), Postives = 96/162 (59.26%), Query Frame = 2
Query:  431 NKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDV 916
            N+R +QEDR+F   D+L Y   +   + ++   +      ++S +G+FDGHNGPEAAEHC HLAPY LS  L+  L  +   ++ E L E  +LLN  +N  R K  W +GTT T+C+   + IYT WVGDS AWLVY D  +V +     + S  ++ +DV
Sbjct:   53 NRRRRQEDRWFASADLLSYLPRNELDDFSSFTDH-----PSVSAVGVFDGHNGPEAAEHCSHLAPYFLSIGLKKRLGAS--ISITELLSEVIFLLNEAVNEGRAKRYWTSGTTGTICVFYGDRIYTGWVGDSQAWLVYADMVKVPVGQPPKKQSFPTQPVDV 207          

HSP 2 Score: 84.3445 bits (207), Expect = 2.282e-13
Identity = 62/232 (26.72%), Postives = 100/232 (43.10%), Query Frame = 2
Query:  848 DRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFD----------------------------------------RVNGVLAVTRALGDDRKIVGVSALPSISECHLDGT-----ELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVFXXXXXXXXXXXYDFSYQDSRAIKWPRDRRMSCFSQNLDQLRLCPEKL 1408
            D   V LT  +HRP    E + V  +GG VT      D                                        RV G+  V+RA+GDD+ ++G++ALPS++             LCL++A+DGLWD+  C G ++A + R++F E++        L Q +I+  +  GASDN++      N  NS      Y      + +++WPR  R    +  +D + L P+ +
Sbjct:  259 DDLAVALTDRIHRPEFAPEFVSVLRSGGSVTTELASDDGNTSFTETFVNVQQNLPYWIKPPKTRLSRPQLDDPNLVDCRVAGMSCVSRAIGDDQSVLGMTALPSMTVLERPPKSASRQPLCLIIATDGLWDTDDCCGQDVAAIARKWFQENSTDGIVKIGLSQHLINLAIDKGASDNVTCCTVWVNRWNSVHEAVDYGIDVPQTSSVQWPRGLRT---ASQVDFVALVPQSV 487          
BLAST of Protein phosphatase 2C vs. TrEMBL
Match: G7YG40 (Protein phosphatase 2C (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_107065 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 2.726e-27
Identity = 100/290 (34.48%), Postives = 151/290 (52.07%), Query Frame = 2
Query:   68 LYLDDLEKNEVNTPIRLRSVLKNVDSDNVLAYVKS--------FIMNTCNTLYKSNNIFCE---RICSDFINS-DFWKYNSLLQNELVSYPELLTVTKKYLSIYINEKLKNNPHDPSGLRNSSNHRAYYKAIS--NKRTKQEDRYFCVTDVLRYSSNHFC-QNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHL--QSSLCITGRYNLIEALGEAFYLLNFKLN-GCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRK-QVHLTSIL 880
            L +++ ++ ++ + +R+R VL+ V   +V+ YV S        F  ++ + +     I+ +   R+ +D     DF    SL    L S  EL T             + ++P   S  R  S+      AIS  N+R +QEDR+F  +D+L Y++   C  + N   KN+  +   +S + +FDGHNGPEAAEHC HLAPYLLS  L  QSS       ++ + L   FY LN  +N G RN   W +GTT+T+C I  + I T+WVGDS AWL+   ++ QV   SI+
Sbjct:   14 LSVENTKEAKIRSIVRMRPVLRAVQRKHVIPYVLSIAEKHLFNFAGDSVSAVSLLTPIWVQLMQRLKNDKKEVFDFIAVQSLSMECLRSAVELCT------------DVNSSPTLSSTHRTWSSLGLCVDAISVVNRRRRQEDRWFATSDLLSYAA--VCVADENGPSKNKSASSPPVSAIAVFDGHNGPEAAEHCSHLAPYLLSLGLLKQSS---DQSPSITDLLANLFYELNESVNEGHRNNI-WSSGTTATVCAIHGDCISTAWVGDSQAWLINMPKELQVKAHSII 285          
BLAST of Protein phosphatase 2C vs. TrEMBL
Match: A0A4S2LAZ3 (PPM-type phosphatase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008474 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 3.215e-27
Identity = 98/297 (33.00%), Postives = 152/297 (51.18%), Query Frame = 2
Query:   68 LYLDDLEKNEVNTPIRLRSVLKNVDSDNVLAYVKS--------FIMNTCNTLYKSNNIFCE---RICSDFINS-DFWKYNSLLQNELVSYPELLTVTKKYLSIYINEKLKNNPHDPSGLRNSSNHRAYYKAIS--NKRTKQEDRYFCVTDVLRYSSNHFC-QNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHL--QSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRK-QVHLTSILHRPSQNSE 904
            L +++ ++ ++ + +R+R VL+ V   +V+ YV S        F  ++ + +     I+ +   R+ +D     DF    SL    L S  EL T             + ++P   S  R  S+      A+S  N+R +QEDR+F  +D+L Y++   C  + N   KN+  +   +S + +FDGHNGPEAAEHC HLAPYLLS  L  QSS       ++ + L   FY LN  +N       W +GTT+T+C I  + I T+WVGDS AWL+   ++ QV + SI+    Q +E
Sbjct:   15 LSVENTKEAKIRSIVRMRPVLRAVQRKHVIPYVLSIAEKHLFNFAGDSVSAVSLLTPIWVQLMQRLKNDKKEVFDFIAVQSLSMECLRSAVELCT------------DVNSSPTLSSAHRTWSSLGLCVDAVSVVNRRRRQEDRWFATSDLLSYAA--VCVADENDPSKNKSASSPPVSAIAVFDGHNGPEAAEHCSHLAPYLLSLGLLKQSS---DQSPSITDLLANLFYELNESVNEGHRNNLWSSGTTATVCAIHGDCISTAWVGDSQAWLINMPKELQVKVRSIIGPVCQTTE 294          

HSP 2 Score: 79.7221 bits (195), Expect = 7.798e-12
Identity = 53/161 (32.92%), Postives = 83/161 (51.55%), Query Frame = 2
Query:  962 RVNGVLAVTRALGDDRKIVGVSALPSISECHLDGT----ELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDT-LCQTIIDRGVKGGASDNISLMIFVFXXXXXXXXXXXYDFSYQDSRAIKWPRDRRMSCFSQ--NLDQLR----LCPEKLT 1411
            RV G+  V+RALGDD  + GVS LPS++    +       LCLV+ASDGLWD++ CS +E+A + + +F E       V+  L + +    +  GASDNI+ ++   N    +      D      R ++WPR  R++      + +QL     +CP  L+
Sbjct:  436 RVGGLSCVSRALGDDHMLNGVSGLPSVTTWKYNKQTGQRPLCLVVASDGLWDTENCSPVEVAHIAQRWFKEHAGISGQVEKGLSRELTQLAISNGASDNITCLVLWLNRWIPDDWSS--DTQPILGRNVRWPRGTRITSLVDFNSPEQLTVRGPMCPSPLS 594          
BLAST of Protein phosphatase 2C vs. Ensembl Cavefish
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent 1E [Source:NCBI gene;Acc:103042334])

HSP 1 Score: 90.5077 bits (223), Expect = 9.853e-19
Identity = 84/289 (29.07%), Postives = 131/289 (45.33%), Query Frame = 2
Query:  407 RAYYK----AISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHC-HHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
            + YY+    AI N R K EDR+  + D           NS   +++Q    E  +   +FDGH G +AA +  +HL   L+ Q + S        +  EAL  AF L + +      +   + GTT  +  +   T+Y +W+GDS   LV K  + V L    H+P +  E   +   GG V   G    RVNG L+V+RA+GD      +          LDGTE  L+LA DG +D+      E A +  +   E++   T    +   ++      G+SDNI++++
Sbjct:  134 QPYYETSIHAIKNMRRKMEDRHVVIPDF----------NSLFNLQDQ----EEQAYFAVFDGHGGVDAATYAANHLHVNLVRQEMFSQ-------DPGEALCRAFKLTDERFVQKAKRENLRCGTTGVVTFLRGRTLYVAWLGDSQVMLVKKG-QPVELMKP-HKPDREDEKQRIEALGGCVIWFGT--WRVNGSLSVSRAIGDSEHKPYICGDADHISFPLDGTEDYLILACDGFYDTMNPE--EAARVVSDHLQENSGDTT---MVAHKLVASARDAGSSDNITVIV 392          
BLAST of Protein phosphatase 2C vs. Ensembl Cavefish
Match: ppm1f (protein phosphatase, Mg2+/Mn2+ dependent 1F [Source:NCBI gene;Acc:103021307])

HSP 1 Score: 85.8853 bits (211), Expect = 1.557e-17
Identity = 81/300 (27.00%), Postives = 130/300 (43.33%), Query Frame = 2
Query:  377 PSGLRNSSNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENI---SLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNIS-LMIFV 1264
            P+  R S +      AI N R K EDR+  +T+                  NQ   L++        +FDGH G +AA +       +LSQ  Q +L    + +   A  E F   +        + R ++G+T    L+  + +  +W+GDS A LV K    + +    H+P +  E   +   GG +   G    RVNG  AV+RA+GD  +   VS     S   L G E  ++LA DG +D  +    E+  L  E   E        +   Q+++++    G+SDNI+ L++F+
Sbjct:  131 PAAPRPSHSRLCSVHAIRNTRRKMEDRHVILTNF-----------------NQLFGLQDGVEREYYAVFDGHGGVDAATYAATHLHVILSQ--QEAL----KGDTATAFKETFIQTDDMFRTKAKRERMRSGSTGVAVLLASDWLTVAWLGDSQAMLVRKGEPVILMDP--HKPEREDEKQRIEELGGCIAFMG--CWRVNGTYAVSRAIGDFDQKPYVSNAADCSSVRLSGDEDYILLACDGFFDVVRPE--EVPGLVLEALREAGGSG---EEAAQSLVNQAKAAGSSDNITVLLVFL 398          
BLAST of Protein phosphatase 2C vs. Ensembl Cavefish
Match: ppm1na (protein phosphatase 1B-like [Source:NCBI gene;Acc:103024196])

HSP 1 Score: 83.1889 bits (204), Expect = 1.135e-16
Identity = 76/270 (28.15%), Postives = 121/270 (44.81%), Query Frame = 2
Query:  506 QNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYN---LIEALGEAFYLLNFKLNGCRNKYRW-KAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD---------DRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTL---CQTIIDRGVKGGASDNISLMIFVF 1267
            ++++TC+        + S   +FDGH G   A++C   + +LL  H+ ++  IT   N   + E + + F  ++  ++       W ++G+T+   +I  N IY    GDS  +L    +   H     H+P    E   + N GG VT       RVNG LAV+RALGD          +    VS  P + E      +  LV+A DG+WD+   S  E+    R       N+    D L   C  +ID  +  G+ DN+S++I  F
Sbjct:   94 EDTHTCMPEMSEGHPDWSYFAVFDGHAGTTVAQYC---STHLLD-HILATGAITAEENVEQVKEGIRDGFLAIDRHMHNLSQSEGWDRSGSTAASVIISPNNIYFINCGDSRTFLCRDSQVVFHTED--HKPCNPREKERIQNAGGSVT-----LQRVNGSLAVSRALGDFAFKEVEWRTQTEQLVSPEPEVYELERSPQDEFLVVACDGVWDA--ISNEELCAFVR-------NRLQVCDDLRDVCTQVIDLCLYKGSLDNMSIIIICF 343          
BLAST of Protein phosphatase 2C vs. Ensembl Cavefish
Match: ppm1na (protein phosphatase 1B-like [Source:NCBI gene;Acc:103024196])

HSP 1 Score: 83.1889 bits (204), Expect = 1.354e-16
Identity = 76/270 (28.15%), Postives = 121/270 (44.81%), Query Frame = 2
Query:  506 QNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYN---LIEALGEAFYLLNFKLNGCRNKYRW-KAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD---------DRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTL---CQTIIDRGVKGGASDNISLMIFVF 1267
            ++++TC+        + S   +FDGH G   A++C   + +LL  H+ ++  IT   N   + E + + F  ++  ++       W ++G+T+   +I  N IY    GDS  +L    +   H     H+P    E   + N GG VT       RVNG LAV+RALGD          +    VS  P + E      +  LV+A DG+WD+   S  E+    R       N+    D L   C  +ID  +  G+ DN+S++I  F
Sbjct:   94 EDTHTCMPEMSEGHPDWSYFAVFDGHAGTTVAQYC---STHLLD-HILATGAITAEENVEQVKEGIRDGFLAIDRHMHNLSQSEGWDRSGSTAASVIISPNNIYFINCGDSRTFLCRDSQVVFHTED--HKPCNPREKERIQNAGGSVT-----LQRVNGSLAVSRALGDFAFKEVEWRTQTEQLVSPEPEVYELERSPQDEFLVVACDGVWDA--ISNEELCAFVR-------NRLQVCDDLRDVCTQVIDLCLYKGSLDNMSIIIICF 343          
BLAST of Protein phosphatase 2C vs. Ensembl Cavefish
Match: ppm1na (protein phosphatase 1B-like [Source:NCBI gene;Acc:103024196])

HSP 1 Score: 82.8037 bits (203), Expect = 1.391e-16
Identity = 76/270 (28.15%), Postives = 121/270 (44.81%), Query Frame = 2
Query:  506 QNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYN---LIEALGEAFYLLNFKLNGCRNKYRW-KAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD---------DRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTL---CQTIIDRGVKGGASDNISLMIFVF 1267
            ++++TC+        + S   +FDGH G   A++C   + +LL  H+ ++  IT   N   + E + + F  ++  ++       W ++G+T+   +I  N IY    GDS  +L    +   H     H+P    E   + N GG VT       RVNG LAV+RALGD          +    VS  P + E      +  LV+A DG+WD+   S  E+    R       N+    D L   C  +ID  +  G+ DN+S++I  F
Sbjct:   80 EDTHTCMPEMSEGHPDWSYFAVFDGHAGTTVAQYC---STHLLD-HILATGAITAEENVEQVKEGIRDGFLAIDRHMHNLSQSEGWDRSGSTAASVIISPNNIYFINCGDSRTFLCRDSQVVFHTED--HKPCNPREKERIQNAGGSVT-----LQRVNGSLAVSRALGDFAFKEVEWRTQTEQLVSPEPEVYELERSPQDEFLVVACDGVWDA--ISNEELCAFVR-------NRLQVCDDLRDVCTQVIDLCLYKGSLDNMSIIIICF 329          
BLAST of Protein phosphatase 2C vs. Ensembl Sea Lamprey
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent, 1E [Source:ZFIN;Acc:ZDB-GENE-070326-2])

HSP 1 Score: 97.4413 bits (241), Expect = 1.780e-22
Identity = 89/301 (29.57%), Postives = 141/301 (46.84%), Query Frame = 2
Query:  386 LRNSSNH-RAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCH-HLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLL--NFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDS---KQCSGLEIADL--CREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIF 1261
            LR S  H +    A+ N R K EDR+  + D+          N+   +++ +   +  + L +FDGH G EAA +   HL   LL Q + +        +   AL EAF L   NF     R   R  +GTT  + L+  + ++ +W+GDS A LV +D   V + +  H+P +  E   +   GG V   G    RVNG L+V+RA+GD      +      +   LDGTE  L+LA DG +D+    +   +  A L  CR+  + ++    P   L Q ++      G+ DNI++++ 
Sbjct:   29 LRTSPRHFQTSLHAVKNSRRKMEDRHVVLPDL----------NALLGLEDAEEQQQQQTYLAVFDGHGGVEAAVYAATHLHVNLLQQEMLAR-------DPARALREAFSLTDRNFVQKAVRENLR--SGTTGVVALVRGDMLHVAWLGDSQALLV-RDGCPVEIMTP-HKPEREDEKKRIEALGGCVVWFG--AWRVNGTLSVSRAIGDADYKPYICGDAESASVRLDGTEDYLLLACDGFFDTVRPDEAVSVAAAHLRKCRDAGTAEDEGCRPA-GLAQRLVTAARDAGSGDNITVIVL 305          
BLAST of Protein phosphatase 2C vs. Ensembl Sea Lamprey
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent, 1E [Source:ZFIN;Acc:ZDB-GENE-070326-2])

HSP 1 Score: 96.6709 bits (239), Expect = 3.731e-22
Identity = 86/296 (29.05%), Postives = 134/296 (45.27%), Query Frame = 2
Query:  377 PSGLRNSSNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITG--RYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
            P+  R   + +    AI N R K EDR+    D+            N    +++   ++ +   +FDGH G +AA +         + HL  SL   G  R + +EAL  AF   + +      +  W+ G+T  + LI  N ++ +W+GDS   LV K    V L S  H+P +  E   +   GG V   G    RVNG L+V+RA+GD      VS     +   LDG+E  L+LA DG +D+ Q    E A +  E   E++        L   ++      G+SDNI++++
Sbjct:   70 PALSRQRRSFQISLHAIKNTRRKMEDRHVIFQDL------------NALFTSEEEE-DDQAYFAIFDGHGGVDAAIYA--------ATHLHVSLAREGSFRRDPLEALRRAFCQTDQRFVLKARQENWRCGSTGVVTLIRGNELHVAWLGDSQVILVRKG-SPVELMSP-HKPDREDEKKRIEALGGCVIWFGAW--RVNGTLSVSRAIGDMEHKPYVSCDADCATFPLDGSEDYLLLACDGFYDTVQPD--EAARIVGEHLRENDGDPA---MLAHRLVASARDAGSSDNITVLV 335          
BLAST of Protein phosphatase 2C vs. Ensembl Sea Lamprey
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent, 1E [Source:ZFIN;Acc:ZDB-GENE-070326-2])

HSP 1 Score: 90.5077 bits (223), Expect = 6.397e-21
Identity = 76/238 (31.93%), Postives = 114/238 (47.90%), Query Frame = 2
Query:  557 SLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITG--RYNLIEALGEAFYLLN--FKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
            +   +FDGH G +AA +         + HL  SL   G  R + +EAL  AF   +  F L   + +  W+ G+T  + LI  N ++ +W+GDS   LV K    V L S  H+P +  E   +   GG V   G    RVNG L+V+RA+GD      VS     +   LDG+E  L+LA DG +D+ Q    E A +  E   E++        L   ++      G+SDNI++++
Sbjct:    1 AYFAIFDGHGGVDAAIYA--------ATHLHVSLAREGSFRRDPLEALRRAFCQTDQRFVLKARQEQKNWRCGSTGVVTLIRGNELHVAWLGDSQVILVRKG-SPVELMSP-HKPDREDEKKRIEALGGCVIWFGAW--RVNGTLSVSRAIGDMEHKPYVSCDADCATFPLDGSEDYLLLACDGFYDTVQPD--EAARIVGEHLRENDGDPA---MLAHRLVASARDAGSSDNITVLV 221          
BLAST of Protein phosphatase 2C vs. Ensembl Sea Lamprey
Match: ppm1aa (protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Source:ZFIN;Acc:ZDB-GENE-991102-15])

HSP 1 Score: 68.5514 bits (166), Expect = 1.179e-12
Identity = 67/269 (24.91%), Postives = 121/269 (44.98%), Query Frame = 2
Query:  506 QNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHC-HHLAPYLLS-QHLQSSLCITGRYNLIEALGEAFYLL----NFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-DRKIVG--------VSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            ++++T +      L+  S   ++DGH G   A  C  HL  ++++ +H +           +E   +A +L        ++  +N    ++G+T+   ++    +Y    GDS A L Y++   VH  +  H+P   +E   + N G ++ +      RVNG LAV+RALGD D K V         VS  P +        +  +VLA DG+WD      L      R   ++D      ++ +C  ++D  +  G+ DN+S+++  F
Sbjct:   37 EDAHTAVVGIPRGLKTWSFFAVYDGHAGSRVATFCSEHLLEHIITNEHFECKAGTEPSSEAVEKGIQAGFLQIDEHMRTISDIKNGLD-RSGSTAVAVMLSPKHLYFINCGDSRAVL-YRN-GSVHFCTEDHKPCNPAEKERIQNGGSVMIQ------RVNGSLAVSRALGDFDYKCVDGKGPTEQLVSPEPEVRAIERSDGDEFVVLACDGIWDVMSNEELGQFVHSRLLLTDD------LEKICNQVLDTCLYKGSRDNMSIVLVCF 290          
BLAST of Protein phosphatase 2C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006941.1 (pep scaffold:Pmarinus_7.0:GL476378:621905:629923:1 gene:ENSPMAG00000006271.1 transcript:ENSPMAT00000006941.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 3.174e-12
Identity = 61/190 (32.11%), Postives = 91/190 (47.89%), Query Frame = 2
Query:  551 NISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNF----KLNGCRNKYRWKAGTTSTMCLI-DQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-DRKIVGVSALPSISECHLDGT-ELCLVLASDGL 1099
            N+  L +FDGH GP AA  C       L ++LQ         NL   L ++F  ++     ++   +     ++G+T+T+ L+ D   +    VGDS A L  +  K + LT   H   +  E   V   GG VT S     R+NG LA+TR++GD   K  GV A P I +  L+   +  LVL +DG+
Sbjct:  106 NVLCLAVFDGHGGPAAANFCSKYMAKHLRKYLQKE------ENLELVLSKSFLAVDREFTRRVTLSQEAELLRSGSTATVALLRDGQELAVGSVGDSRAVLCRRG-KAMGLTKD-HTAQRKDERTRVKACGGFVTWSTTGHSRINGTLAMTRSIGDIALKPYGVIADPEIQQLQLNHEDDSFLVLTTDGI 287          
BLAST of Protein phosphatase 2C vs. Ensembl Yeast
Match: PTC1 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p, inactivating osmosensing MAPK cascade; involved in Fus3p activation during pheromone response; deletion affects precursor tRNA splicing, mitochondrial inheritance, and sporulation [Source:SGD;Acc:S000002164])

HSP 1 Score: 70.4774 bits (171), Expect = 5.592e-14
Identity = 65/252 (25.79%), Postives = 118/252 (46.83%), Query Frame = 2
Query:  563 LGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLI-----------------DQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD---DRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
              +FDGH G +A++ C      ++ Q++ +      R    + L ++F  ++ ++N    K    +G T+ +C++                  Q  +YT+ VGDS   +++++   + LT   H+ S   E+  V   GG++ KS     RVNG+LAVTR+LGD   D  +VG    P  +   +   +  L+LA DGLWD      ++  D C     E     T  +   + ++   ++ G +DN+++M+
Sbjct:   54 FAVFDGHAGIQASKWCGKHLHTIIEQNILADETRDVR----DVLNDSFLAIDEEIN---TKLVGNSGCTAAVCVLRWELPDSVSDDSMDLAQHQRKLYTANVGDSRI-VLFRNGNSIRLTYD-HKASDTLEMQRVEQAGGLIMKS-----RVNGMLAVTRSLGDKFFDSLVVGS---PFTTSVEITSEDKFLILACDGLWDV-----IDDQDAC-----ELIKDITEPNEAAKVLVRYALENGTTDNVTVMV 278          
BLAST of Protein phosphatase 2C vs. Ensembl Yeast
Match: PTC2 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p to limit maximal osmostress induced kinase activity; dephosphorylates Ire1p to downregulate the unfolded protein response; dephosphorylates Cdc28p; inactivates the DNA damage checkpoint; PTC2 has a paralog, PTC3, that arose from the whole genome duplication [Source:SGD;Acc:S000000891])

HSP 1 Score: 62.003 bits (149), Expect = 1.071e-10
Identity = 74/261 (28.35%), Postives = 115/261 (44.06%), Query Frame = 2
Query:  536 KLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLI--DQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-----------DRKIVGVSALPSISECHLD-GTELCLVLASDGLWD---SKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            K + ++I+  G+FDGH G + AE+C +    +L +  Q S       NL  AL + F   + KL          +G T+T  L+   QN +     GDS   L      +    S  H+P+  SE   +    G V     + DRVNG LA++RA+GD           + +I  V+ +P I E  LD   +  ++LA DG+WD   S+ C  L    L RE  + +      +D  C    +    G   DN+S+++   
Sbjct:   49 KSDKDHIAFYGIFDGHGGAKVAEYCGNKIVEILQE--QKSF---HEGNLPRALIDTFINTDVKLLQDPVMKEDHSGCTATSILVSKSQNLLVCGNAGDSRTVLATDGNAKA--LSYDHKPTLASEKSRIVAADGFV-----EMDRVNGNLALSRAIGDFEFKSNPKLGPEEQI--VTCVPDILEHSLDYDRDEFVILACDGIWDCLTSQDCVDLVHLGL-REGKTLNEISSRIIDVCCAPTTEG--TGIGCDNMSIVVVAL 292          
BLAST of Protein phosphatase 2C vs. Ensembl Yeast
Match: PTC3 (Type 2C protein phosphatase (PP2C); dephosphorylates Hog1p (see also Ptc2p) to limit maximal kinase activity induced by osmotic stress; dephosphorylates T169 phosphorylated Cdc28p (see also Ptc2p); role in DNA damage checkpoint inactivation; PTC3 has a paralog, PTC2, that arose from the whole genome duplication [Source:SGD;Acc:S000000152])

HSP 1 Score: 51.9878 bits (123), Expect = 1.563e-7
Identity = 61/211 (28.91%), Postives = 95/211 (45.02%), Query Frame = 2
Query:  548 ENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEA-LGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQ--NTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD----DRKIVG-----VSALPSISECH---LDGTELCLVLASDGLWD---SKQCSGL 1126
            E+++  G+FDGH G   AE C      +L +  Q S     +  ++E  L + F   + +L          +G T+T+ L+ Q    +  +  GDS   L      +    S  H+P+  SE   +    G V     + DRVNG LA++RA+GD        +G     V+ +P I  CH    D  E  ++LA DG+WD   S++C  L
Sbjct:   53 EHLAFYGIFDGHGGSSVAEFCGSKMISILKK--QESF----KSGMLEQCLIDTFLATDVELLKDEKLKDDHSGCTATVILVSQLKKLLICANSGDSRTVLSTGGNSKA--MSFDHKPTLLSEKSRIVAADGFV-----EMDRVNGNLALSRAIGDFEFKSNTKLGPHEQVVTCVPDII-CHNLNYDEDEF-VILACDGIWDCLTSQECVDL 248          
BLAST of Protein phosphatase 2C vs. Ensembl Nematostella
Match: EDO44137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWJ9])

HSP 1 Score: 95.9005 bits (237), Expect = 5.872e-22
Identity = 87/305 (28.52%), Postives = 141/305 (46.23%), Query Frame = 2
Query:  350 EKLKNNPHDPSGLRNSSNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCH-HLAPYLL-SQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
            +K K  P  P+  ++S  +     AI N R K ED++  +         HF    N+     K +  N +   +FDGH G +AA     HL  +L  ++HL     +        AL E F   +            ++G T+   LI    +Y +W+GDS A L  KD + + L    H+P +  E   +   GG V   G    RVNG L+V+RA+GD      +S  P ++E  LDG +  ++LA DGLWD+ +    +   L +E  +  N++      + + ++D   + G+SDNIS+++
Sbjct:   23 QKWKEEP--PTFYKSSYTYETSVYAIKNTRRKMEDKHVIMP--------HF----NSLFGLPK-DSPNYAYFAVFDGHGGIDAATFAATHLHCFLAQNEHLIKDPGL--------ALHETFQNTDCSFGARAISEGLRSGCTAVSILITNEALYLAWLGDSQAILC-KDGEFIELMQP-HKPERQDEKDRIEGLGGCVVWFGAW--RVNGSLSVSRAIGDAEHKPFISGEPDVAEYALDGEQEFVILACDGLWDTVKPE--QAIKLVKEHIASGNDRC----DVAKVLVDEAKQEGSSDNISVLV 294          
BLAST of Protein phosphatase 2C vs. Ensembl Nematostella
Match: EDO39603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9M4])

HSP 1 Score: 85.1149 bits (209), Expect = 2.366e-18
Identity = 80/263 (30.42%), Postives = 126/263 (47.91%), Query Frame = 2
Query:  542 NLENISLLGLFDGHNGPEA----AEHCHHLAPYLLSQHLQSSL---CITGRYNLIEA-LGEAFYLLN--FKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKD---RKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDR-KIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGL-----EIADLCREF-FSEDNNKQTPVDTLCQTIIDR----GVKGGASDNISLMI 1258
            +++ ++   +FDGH GP A    AEH H        ++++S +    ITG+   I+  L +A+ L +  F     +    WK G+T+   L+  NT+Y + +GDS A +   D   +  V   S  H P+   E + +   GG V K G    RV GVL V+R++GD R K  GV + P I  C L   +  L+LA DGLW             +I D+   +  + +     PV+   Q   DR     V+ G+SDN+++M+
Sbjct:   37 DVQRMAYYAVFDGHAGPRASLFAAEHLH--------ENIKSRMPKGSITGKDKEIKKCLVDAYTLTDEQFLHEASKGTPVWKDGSTAVSVLVINNTLYVANLGDSKALVCRCDSAGKISVVRLSKDHSPTGYDERMRIQKAGGYV-KDG----RVLGVLEVSRSIGDGRFKRCGVISTPDIMRCTLTDNDRFLLLACDGLWKGFSVDEAVKYISKILDVRYTYILTNEEPGLDPVEARFQLACDRIASDAVRNGSSDNVTVML 286          
BLAST of Protein phosphatase 2C vs. Ensembl Nematostella
Match: EDO40449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S778])

HSP 1 Score: 78.5666 bits (192), Expect = 5.329e-16
Identity = 81/290 (27.93%), Postives = 134/290 (46.21%), Query Frame = 2
Query:  491 SNHFCQNSNTCIKNQKLNLE-------------NISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCIT---GRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD------DRKIVG---VSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDR------GVKGGASDNISLMIFVF 1267
            SN   + +++C++  ++N+E             N + LG++DGH G   A++        + Q+LQ  +       + N+IEAL + F   +  +          AGTT+ + +I  N +Y + VGDS A    K    V   S  H+PS   E   +   GG V     +F+RVNG LA++RALGD      D+K      V+A+P +    L      LVLA DG+WD    S  E+ D  R   ++    +  ++ +C+ ++ R       + G   DN++++I  F
Sbjct:   18 SNKSYKLASSCMQGWRINMEDAHTEILSLKEDKNTAFLGVYDGHGGARVAQY--------VGQNLQKKIASQPAWAKGNVIEALKKGFLSCDTDMLKDEQMKDEVAGTTAVVVVIKNNKLYCANVGDSRAIACKKGL--VEQLSFDHKPSNEEETRRIIAAGGWV-----EFNRVNGNLALSRALGDFCFKKNDKKPPEEQIVTAMPDVIVKDLTPDHEFLVLACDGIWDV--LSNQEVVDFIRSRLAQ----RMELEQICEELLTRCLAPDCQMGGLGCDNMTVIILTF 286          
BLAST of Protein phosphatase 2C vs. Ensembl Nematostella
Match: EDO31490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXS4])

HSP 1 Score: 63.929 bits (154), Expect = 4.066e-11
Identity = 54/192 (28.12%), Postives = 93/192 (48.44%), Query Frame = 2
Query:  740 NKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHL-TSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD----DRKIVG-----VSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVK------GGASDNISLMIFVF 1267
            ++  + +GTT+ + L+  N +  + VGDS   L    R  + L  SI H+P    E+  +   GG VT  GR    VNG L ++RALGD     +  +G     ++A+P I +  L   +  +V+A DG+W+ K     E+ D  ++   E  N +  + ++C+ + D  +       G   DN++ +I  F
Sbjct:  155 DEAGYDSGTTAIVALVKDNNLTVANVGDSRCVLC---RNGIALDMSIDHKPEDEKELNRIHKAGGKVTCEGR----VNGGLNLSRALGDHSYKGQSELGAHEQQITAMPDIRQTTLTEADEFMVIACDGIWNVKNSQ--EVVDFVKQ---EMKNGEENLSSICEKLFDACLAPDTSGDGAGCDNMTCVIVSF 334          
BLAST of Protein phosphatase 2C vs. Ensembl Nematostella
Match: EDO49071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI17])

HSP 1 Score: 61.6178 bits (148), Expect = 4.913e-10
Identity = 62/212 (29.25%), Postives = 94/212 (44.34%), Query Frame = 2
Query:  560 LLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKL-----NGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQ---NSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRAL---GDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSE 1162
             +G++DG+ G   A  C      L+S+ L S   +T + +   A   ++      L     +  R++ RW +G ++  C++  +T Y S VGD  A L+ +D     +T IL R        E   V  + G++ K+ +    VNG L VTR L   GD      V   P      L   +  LV AS GLW  K  S  E+A+L   FF +
Sbjct:  339 FIGIYDGYCGGTTARKCASQLHQLVSEQLASHTDLT-KTDFKTAFRRSYARFQELLRTRTEDEERSRNRW-SGCSALTCVVTPSTCYLSHVGDVGAILIRED----GVTKILTRKHDLYNKKERDRVRKSSGVIVKTEK-CALVNGALGVTRGLGNIGDGELNQSVIIAPKFRCTCLTNRDQVLVFASSGLW--KVFSAEEVANLVLGFFRQ 541          
BLAST of Protein phosphatase 2C vs. Ensembl Medaka
Match: ppm1e (protein phosphatase, Mg2+/Mn2+ dependent 1E [Source:NCBI gene;Acc:101162311])

HSP 1 Score: 94.3597 bits (233), Expect = 5.475e-20
Identity = 85/287 (29.62%), Postives = 133/287 (46.34%), Query Frame = 2
Query:  413 YYK----AISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHC-HHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMI 1258
            YY+    AI N R K ED++  + D           N+   I++Q    E  +   +FDGH G +AA +  +HL   L+ Q   S        + IEAL +AF + + +     ++ + + GTT  +  +   T+Y +W+GDS   LV   R QV      H+P +  E   +   GG V   G    RVNG L+V+RA+GD      +      S   LDG+E  L+LA DG WD+   S  E   +  +   E++   T V      ++      G+SDNI++++
Sbjct:  137 YYETSIHAIKNMRRKMEDKHVIIPDF----------NTLFNIQDQ----EEQAFFAVFDGHGGVDAAIYAANHLHVNLVHQESFSQ-------DPIEALCKAFKVTDERFVKKASREKLRCGTTGVVTFLRGQTLYVAWLGDSQVILVR--RGQVVELMKPHKPDREDEKKRIEALGGCVIWFGT--WRVNGSLSVSRAIGDSEHKPYICGDADHSVFPLDGSEDYLILACDGFWDT--VSPEEAVRVVSDHLQENSGDTTMV---AHKLVASARDAGSSDNITVIV 393          
BLAST of Protein phosphatase 2C vs. Ensembl Medaka
Match: ppm1f (protein phosphatase, Mg2+/Mn2+ dependent 1F [Source:NCBI gene;Acc:101168221])

HSP 1 Score: 87.4261 bits (215), Expect = 5.454e-18
Identity = 82/298 (27.52%), Postives = 133/298 (44.63%), Query Frame = 2
Query:  422 AISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENI---SLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITG--RYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCS-----------GLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNIS-LMIFV 1264
            AI N R K ED++  +++                  NQ   +E+    +   +FDGH G +AA           + HL  +L   G  + +   AL  AF   +        + R ++G+T  + LI    +  +W+GDS A LV + ++ V +    H+P +  E   + + GG VT  G    RVNG  AV+RA+GD  +   VS+    S   L G E  ++LA DG +D+ Q S           GL + +   E   +    Q    T+ Q ++    + G+SDNI+ L++F+
Sbjct:  136 AIKNGRRKMEDKHVLLSEF-----------------NQLFGVEDGVQRAFYAVFDGHGGVDAA--------TFAATHLHVNLSRQGALQSSPGPALKAAFKRTDDMFRSKAQRERLRSGSTGVVVLIHDQELTVAWLGDSQALLVREGQEVVLMEP--HKPEREDEKQRIEDLGGCVTYMG--CWRVNGTYAVSRAIGDFDQKPYVSSDADSSTVRLQGNEDYVLLACDGFFDAVQPSEVPQLVMGALQGLPLPEEASEAQPDGGTGQ----TVAQKLVAHAKEAGSSDNITVLLVFL 400          
BLAST of Protein phosphatase 2C vs. Ensembl Medaka
Match: ppm1na (protein phosphatase 1A [Source:NCBI gene;Acc:101159369])

HSP 1 Score: 81.2629 bits (199), Expect = 4.632e-16
Identity = 78/274 (28.47%), Postives = 122/274 (44.53%), Query Frame = 2
Query:  506 QNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRY-------NLIEALGEAFYLLNFKLNGCRNKYRW-KAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-DRKIVG--------VSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTL---CQTIIDRGVKGGASDNISLMIFVF 1267
            ++++TC+   + +LE+ +   +FDGH G   A++C        S++L   +  TG          + E + E F  ++  ++    +  W ++GTT+   LI    IY    GDS   L +    QV   +  H+P    E   + N GG VT       R+NG LAV+RALGD D K           VS  P + +      +  L+LA DG+WD+      E+    R       N+    D L   C  +ID  +  G+ DNIS++I  F
Sbjct:   90 EDAHTCMSQLRGDLEDWAYFAVFDGHAGITVAQYC--------SKNLLDHILATGGIKANEDPEQVKEGIREGFLKIDSHMHKLSREDSWERSGTTAAGVLISPRHIYFINCGDSRTLLCHD--GQVVFYTEDHKPFNPREKERIQNAGGSVT-----LQRINGSLAVSRALGDFDFKEADWRPQTEQLVSPEPEVYKLERTPEDEFLILACDGVWDA--IGNEELCAFVR-------NRMQVCDDLRDICAQVIDLCLYKGSLDNISIIIVCF 339          
BLAST of Protein phosphatase 2C vs. Ensembl Medaka
Match: ppm1na (protein phosphatase 1A [Source:NCBI gene;Acc:101159369])

HSP 1 Score: 80.8777 bits (198), Expect = 6.654e-16
Identity = 78/274 (28.47%), Postives = 122/274 (44.53%), Query Frame = 2
Query:  506 QNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRY-------NLIEALGEAFYLLNFKLNGCRNKYRW-KAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-DRKIVG--------VSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTL---CQTIIDRGVKGGASDNISLMIFVF 1267
            ++++TC+   + +LE+ +   +FDGH G   A++C        S++L   +  TG          + E + E F  ++  ++    +  W ++GTT+   LI    IY    GDS   L +    QV   +  H+P    E   + N GG VT       R+NG LAV+RALGD D K           VS  P + +      +  L+LA DG+WD+      E+    R       N+    D L   C  +ID  +  G+ DNIS++I  F
Sbjct:   90 EDAHTCMSQLRGDLEDWAYFAVFDGHAGITVAQYC--------SKNLLDHILATGGIKANEDPEQVKEGIREGFLKIDSHMHKLSREDSWERSGTTAAGVLISPRHIYFINCGDSRTLLCHD--GQVVFYTEDHKPFNPREKERIQNAGGSVT-----LQRINGSLAVSRALGDFDFKEADWRPQTEQLVSPEPEVYKLERTPEDEFLILACDGVWDA--IGNEELCAFVR-------NRMQVCDDLRDICAQVIDLCLYKGSLDNISIIIVCF 339          
BLAST of Protein phosphatase 2C vs. Ensembl Medaka
Match: ppm1lb (protein phosphatase, Mg2+/Mn2+ dependent 1L [Source:NCBI gene;Acc:101158218])

HSP 1 Score: 77.0258 bits (188), Expect = 6.521e-15
Identity = 79/294 (26.87%), Postives = 134/294 (45.58%), Query Frame = 2
Query:  398 SNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGR-YNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDD--RKIVGVSALPSISECHLDGTE-LCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            SN+ A Y +I  +R   EDR+  +TD++                    N  + S+ G+FDGH G  AA+      P  L Q L +     G+ ++    L +    L+ ++    +    +AGTT  + L+    +  + VGDS   L  K+ K + L+   H+P Q  E   +   GG ++ +G    RV G+LA++R+LGD   + +  V + P +    LD  +   ++LASDGLWD+   S  E     ++   E +          ++I+ +    G  DNI++M+  F
Sbjct:   90 SNNVAVY-SIQGRRDHMEDRFEVLTDIV--------------------NKSHPSIFGIFDGHGGEAAADFAKAHLPEALRQQLLT--YERGKDFSYPTILEQQILTLDREMLEKLSATYNEAGTTCLVALLSDKELTVANVGDSRGVLCDKNGKAIPLSHD-HKPYQLKERKRIKKAGGFISFNGS--WRVQGILAMSRSLGDYPLKNLNVVVSDPDVMSFDLDKLQPQFMILASDGLWDT--FSNEEAVRFIKDRLDEPHFG-------AKSIVLQSFYRGCPDNITVMVVKF 348          
BLAST of Protein phosphatase 2C vs. Planmine SMEST
Match: SMESG000028448.1 (SMESG000028448.1)

HSP 1 Score: 1059.28 bits (2738), Expect = 0.000e+0
Identity = 522/525 (99.43%), Postives = 525/525 (100.00%), Query Frame = 2
Query:   41 MINTLKEIGLYLDDLEKNEVNTPIRLRSVLKNVDSDNVLAYVKSFIMNTCNTLYKSNNIFCERICSDFINSDFWKYNSLLQNELVSYPELLTVTKKYLSIYINEKLKNNPHDPSGLRNSSNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVFXXXXXXXXXXXYDFSYQDSRAIKWPRDRRMSCFSQNLDQLRLCPEKLTDYLEVHFNHDAKMHSVVGEARILNHSKTRICRSQSLPQEIHKRFSSPIRPIKVYDTSSEIASNSKNSF 1615
            MINTLKEIGLYLDDLEKNEVNTPIRLRSVLKNVDSDNVLAYVKSFIMNTCNTLYKSNNIFCERICSDFINSDFWKYNSL+QNELVSYPELLTVTKKYLSIYINEKLKNNPHDPSGLRNSSNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVFNPNNSNSSVKSYDFSYQDSRAIKWPRDRRMSCFSQ+LDQLRLCPEKLTDYLEVHFNHDAKMHSVVGEARILNHSKTRICRSQSLPQEIHKRFSSPIRPIKV+DTSSEIASNSKNSF
Sbjct:    1 MINTLKEIGLYLDDLEKNEVNTPIRLRSVLKNVDSDNVLAYVKSFIMNTCNTLYKSNNIFCERICSDFINSDFWKYNSLIQNELVSYPELLTVTKKYLSIYINEKLKNNPHDPSGLRNSSNHRAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVFNPNNSNSSVKSYDFSYQDSRAIKWPRDRRMSCFSQDLDQLRLCPEKLTDYLEVHFNHDAKMHSVVGEARILNHSKTRICRSQSLPQEIHKRFSSPIRPIKVHDTSSEIASNSKNSF 525          
BLAST of Protein phosphatase 2C vs. Planmine SMEST
Match: SMESG000018373.1 (SMESG000018373.1)

HSP 1 Score: 75.485 bits (184), Expect = 1.306e-14
Identity = 74/306 (24.18%), Postives = 133/306 (43.46%), Query Frame = 2
Query:  407 RAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQN-SNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYR--WKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSIL----HRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-DRKIVGVSALPSISECHLDGTELCLVLASDGLWDS----------KQCSGLEIAD-LCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            +++  +   +R + +D +  + D   Y   +F  + S+  I N           G++DGHNG +A+          L+Q      C +   N+     + +  ++ +     +K R   + G+T+   LI   T+Y + +GDS A L  +  K+ +LT+I     H      E + +  +G IV    RD  R+NG L ++R+ GD   K  GV  +P + +C L  T+  L++A DGLW +           +  G+E  D L + F           +  C  +    V   + DN++++I  F
Sbjct:   49 KSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHN--------GFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLA-RQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIV----RD-GRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVAKIIGIESTDSLAKRF-----------ELACSKLCSEAVLKMSGDNVTVVIVAF 329          
BLAST of Protein phosphatase 2C vs. Planmine SMEST
Match: SMESG000018373.1 (SMESG000018373.1)

HSP 1 Score: 75.485 bits (184), Expect = 1.331e-14
Identity = 74/306 (24.18%), Postives = 133/306 (43.46%), Query Frame = 2
Query:  407 RAYYKAISNKRTKQEDRYFCVTDVLRYSSNHFCQN-SNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYR--WKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSIL----HRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-DRKIVGVSALPSISECHLDGTELCLVLASDGLWDS----------KQCSGLEIAD-LCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            +++  +   +R + +D +  + D   Y   +F  + S+  I N           G++DGHNG +A+          L+Q      C +   N+     + +  ++ +     +K R   + G+T+   LI   T+Y + +GDS A L  +  K+ +LT+I     H      E + +  +G IV    RD  R+NG L ++R+ GD   K  GV  +P + +C L  T+  L++A DGLW +           +  G+E  D L + F           +  C  +    V   + DN++++I  F
Sbjct:   50 KSFVSSRKGERDEMQDAHILIDDFTEYIKKNFKLDLSDDVIHN--------GFYGVYDGHNGCKASIFAAENLHKYLAQMFPKGDCESFELNVKRIFTDVYKKIDEEFLKIASKQRPFLRDGSTAVNVLIINTTLYIANIGDSKAVLA-RQSKENNLTAISLTKDHTAIDYEERLRLQKHGSIV----RD-GRLNGTLEISRSFGDYQYKKQGVICIPDVKKCRLIDTDRFLIIACDGLWKAFTPQQAVEFVAKIIGIESTDSLAKRF-----------ELACSKLCSEAVLKMSGDNVTVVIVAF 330          
BLAST of Protein phosphatase 2C vs. Planmine SMEST
Match: SMESG000027796.1 (SMESG000027796.1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.139e-12
Identity = 69/254 (27.17%), Postives = 114/254 (44.88%), Query Frame = 2
Query:  545 LENISLLGLFDGHNGPEAAEHC--HHLAPYLLSQHLQS-SLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGDD--RKIVGVSALPSISECHLD--------GTELCLVLASDGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
             E+ +   +FDGH G   +E C    L   L ++  ++ +L    +  +I  + +AF  L+ K++       +  GTT +   I  N +     GDS + L+ +    +  +SI H+P+   E   +   GG +T      DR+NG ++V+RALGD   +K   +SA   +     D          +  +VLA DG+WD    S  E+  L  + F   ++     D L    ID  +  G+ DNIS +I  F
Sbjct:   50 FEDWAYFAIFDGHGGYRVSELCSIELLNIILETEEFKNINLLNLDKSQIINGIKKAFISLDDKIS------HFSEGTTVSAVFITPNYLIFMNCGDSRSVLIRE--SDIFFSSIDHKPTNPLEKERILKAGGQIT-----MDRLNGNMSVSRALGDSYYKKDYNLSAFEQLMSAEPDVYIISRNSENDQIIVLACDGVWDV--FSNTELKQLLLQRFKCTDDLVKISDEL----IDAALYKGSKDNISAIIVAF 284          
BLAST of Protein phosphatase 2C vs. Planmine SMEST
Match: SMESG000008048.1 (SMESG000008048.1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.360e-12
Identity = 70/252 (27.78%), Postives = 116/252 (46.03%), Query Frame = 2
Query:  548 ENISLLGLFDGHNGPEAAEHCHH-----LAPYLLSQHLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLIDQNT-IYTSWVGDSSAWLVYKDRKQVHLT-SILHRPSQNSEIIDVWNNGGIVTKSGRDFDRVNGVLAVTRALGD-DRKIVGVSALPSISECHLD-GTELCLVLASDGLWDSKQCSGLEIAD---LCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASDNISLMIFVF 1267
            +NI LL LFDGH  P AA+   H     +  +LL +H      +T  ++    L    ++    +         ++GTT+T+ L+  N  +    VGDS A L    R    ++ S    P   SE   ++  GG++T +      VNG L +TR+LGD + K  GV A P + +  +    +  ++L SDG+  S   S  E+ D   +CR+          P +   + + D+ ++ G+ DN+S +I  F
Sbjct:   86 KNILLLALFDGHGAPSAADFAQHYIEDCVKFWLLKKHKDLKTVLTNSFHDCNNLMAHHFVFYGSVQS------RQSGTTATVALLRNNIELVVGSVGDSRAILC---RSGTAMSLSTDDDPGNESEQNRIYKCGGVITTNSLGVPVVNGRLGMTRSLGDFELKKYGVIANPHLYDIKISHAKDAFVILISDGI--SYVMSNSEVVDSVSVCRD----------PREA-AKFVTDQALQYGSEDNVSAIILPF 315          
The following BLAST results are available for this feature:
BLAST of Protein phosphatase 2C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPM1E2.552e-1828.62protein phosphatase, Mg2+/Mn2+ dependent 1E [Sourc... [more]
PPM1L6.040e-1627.61protein phosphatase, Mg2+/Mn2+ dependent 1L [Sourc... [more]
PPM1F5.582e-1528.72protein phosphatase, Mg2+/Mn2+ dependent 1F [Sourc... [more]
ILKAP7.878e-1525.25ILK associated serine/threonine phosphatase [Sourc... [more]
PPM1A2.967e-1426.87protein phosphatase, Mg2+/Mn2+ dependent 1A [Sourc... [more]
back to top
BLAST of Protein phosphatase 2C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ilkp-12.020e-2028.24ILK associated serine/threonine Phosphatase homolo... [more]
fem-21.327e-1627.37Protein phosphatase fem-2 [Source:UniProtKB/Swiss... [more]
fem-21.327e-1627.37Protein phosphatase fem-2 [Source:UniProtKB/Swiss... [more]
ppm-28.496e-1425.94Probable protein phosphatase 2C T23F11.1 [Source:... [more]
ppm-28.496e-1425.94Probable protein phosphatase 2C T23F11.1 [Source:... [more]
back to top
BLAST of Protein phosphatase 2C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG103761.106e-1830.90gene:FBgn0032702 transcript:FBtr0081128[more]
CG177467.675e-1527.13gene:FBgn0035425 transcript:FBtr0073094[more]
CG177467.675e-1527.13gene:FBgn0035425 transcript:FBtr0073093[more]
alph3.322e-1329.02gene:FBgn0086361 transcript:FBtr0085442[more]
alph3.322e-1329.02gene:FBgn0086361 transcript:FBtr0085445[more]
back to top
BLAST of Protein phosphatase 2C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1e5.434e-1827.93protein phosphatase, Mg2+/Mn2+ dependent, 1E [Sour... [more]
ppm1f2.176e-1728.19protein phosphatase, Mg2+/Mn2+ dependent, 1F [Sour... [more]
ppm1f2.176e-1728.19protein phosphatase, Mg2+/Mn2+ dependent, 1F [Sour... [more]
ppm1nb5.231e-1628.78protein phosphatase, Mg2+/Mn2+ dependent, 1Nb (put... [more]
ppm1lb1.079e-1427.76protein phosphatase, Mg2+/Mn2+ dependent, 1Lb [Sou... [more]
back to top
BLAST of Protein phosphatase 2C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPM1F7.087e-1829.33protein phosphatase, Mg2+/Mn2+ dependent 1F [Sourc... [more]
rtp3c1.495e-1727.80receptor (chemosensory) transporter protein 3 gene... [more]
PPM1L4.498e-1727.72protein phosphatase, Mg2+/Mn2+ dependent 1L [Sourc... [more]
PPM1L7.579e-1727.72protein phosphatase, Mg2+/Mn2+ dependent 1L [Sourc... [more]
PPM1E5.156e-1627.56protein phosphatase, Mg2+/Mn2+ dependent 1E [Sourc... [more]
back to top
BLAST of Protein phosphatase 2C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppm1e1.302e-1828.62protein phosphatase 1E (PP2C domain containing) [S... [more]
Ppm1f6.651e-1830.50protein phosphatase 1F (PP2C domain containing) [S... [more]
Ppm1l1.677e-1527.52protein phosphatase 1 (formerly 2C)-like [Source:M... [more]
Ilkap5.170e-1526.33integrin-linked kinase-associated serine/threonine... [more]
Ppm1a3.049e-1426.87protein phosphatase 1A, magnesium dependent, alpha... [more]
back to top
BLAST of Protein phosphatase 2C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8LAY8|P2C69_ARATH1.192e-1928.15Probable protein phosphatase 2C 69 OS=Arabidopsis ... [more]
sp|Q0JL75|P2C07_ORYSJ6.469e-1930.65Probable protein phosphatase 2C 7 OS=Oryza sativa ... [more]
sp|Q67UX7|P2C10_ORYSJ1.939e-1828.05Probable protein phosphatase 2C 10 OS=Oryza sativa... [more]
sp|Q4PSE8|P2C71_ARATH2.236e-1830.61Probable protein phosphatase 2C 71 OS=Arabidopsis ... [more]
sp|Q652Z7|P2C55_ORYSJ4.124e-1835.18Probable protein phosphatase 2C 55 OS=Oryza sativa... [more]
back to top
BLAST of Protein phosphatase 2C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0S2B45.693e-3132.07Protein phosphatase 2C OS=Fasciola hepatica OX=619... [more]
A0A183ANE32.834e-2947.55PPM-type phosphatase domain-containing protein OS=... [more]
A0A504YMF87.758e-2941.36PPM-type phosphatase domain-containing protein (Fr... [more]
G7YG402.726e-2734.48Protein phosphatase 2C (Fragment) OS=Clonorchis si... [more]
A0A4S2LAZ33.215e-2733.00PPM-type phosphatase domain-containing protein OS=... [more]
back to top
BLAST of Protein phosphatase 2C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1e9.853e-1929.07protein phosphatase, Mg2+/Mn2+ dependent 1E [Sourc... [more]
ppm1f1.557e-1727.00protein phosphatase, Mg2+/Mn2+ dependent 1F [Sourc... [more]
ppm1na1.135e-1628.15protein phosphatase 1B-like [Source:NCBI gene;Acc:... [more]
ppm1na1.354e-1628.15protein phosphatase 1B-like [Source:NCBI gene;Acc:... [more]
ppm1na1.391e-1628.15protein phosphatase 1B-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein phosphatase 2C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1e1.780e-2229.57protein phosphatase, Mg2+/Mn2+ dependent, 1E [Sour... [more]
ppm1e3.731e-2229.05protein phosphatase, Mg2+/Mn2+ dependent, 1E [Sour... [more]
ppm1e6.397e-2131.93protein phosphatase, Mg2+/Mn2+ dependent, 1E [Sour... [more]
ppm1aa1.179e-1224.91protein phosphatase, Mg2+/Mn2+ dependent, 1Aa [Sou... [more]
ENSPMAT00000006941.13.174e-1232.11pep scaffold:Pmarinus_7.0:GL476378:621905:629923:1... [more]
back to top
BLAST of Protein phosphatase 2C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PTC15.592e-1425.79Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC21.071e-1028.35Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
PTC31.563e-728.91Type 2C protein phosphatase (PP2C); dephosphorylat... [more]
back to top
BLAST of Protein phosphatase 2C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO441375.872e-2228.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396032.366e-1830.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404495.329e-1627.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314904.066e-1128.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490714.913e-1029.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein phosphatase 2C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppm1e5.475e-2029.62protein phosphatase, Mg2+/Mn2+ dependent 1E [Sourc... [more]
ppm1f5.454e-1827.52protein phosphatase, Mg2+/Mn2+ dependent 1F [Sourc... [more]
ppm1na4.632e-1628.47protein phosphatase 1A [Source:NCBI gene;Acc:10115... [more]
ppm1na6.654e-1628.47protein phosphatase 1A [Source:NCBI gene;Acc:10115... [more]
ppm1lb6.521e-1526.87protein phosphatase, Mg2+/Mn2+ dependent 1L [Sourc... [more]
back to top
BLAST of Protein phosphatase 2C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028448.10.000e+099.43SMESG000028448.1[more]
SMESG000018373.11.306e-1424.18SMESG000018373.1[more]
SMESG000018373.11.331e-1424.18SMESG000018373.1[more]
SMESG000027796.11.139e-1227.17SMESG000027796.1[more]
SMESG000008048.11.360e-1227.78SMESG000008048.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031007 ID=SMED30031007|Name=Protein phosphatase 2C|organism=Schmidtea mediterranea sexual|type=transcript|length=1665bp
ATAAACTCTCAGAATTTGATTAATTTCTTAAATTTTTTAAATGATTAATA
CTCTAAAAGAAATTGGGCTTTATTTAGATGATTTGGAGAAAAATGAGGTT
AATACCCCAATAAGATTGCGCTCTGTACTTAAAAATGTTGATTCGGATAA
TGTTTTAGCTTATGTAAAATCTTTTATTATGAACACATGCAATACGTTAT
ATAAATCTAATAATATCTTTTGTGAAAGAATTTGCTCAGATTTTATCAAT
AGTGACTTTTGGAAGTACAATTCTTTATTACAAAACGAACTAGTTAGTTA
TCCCGAATTATTGACTGTTACTAAAAAGTATTTGTCAATTTACATTAATG
AGAAACTCAAAAATAACCCTCATGATCCATCAGGATTAAGGAATTCATCA
AATCATCGTGCATATTATAAGGCAATTTCTAACAAACGTACTAAACAAGA
GGATCGTTATTTTTGTGTAACAGATGTTTTGCGTTATTCATCAAATCATT
TTTGTCAAAACAGTAATACTTGCATTAAAAATCAAAAGTTGAATTTGGAA
AATATATCCTTGCTTGGGCTTTTTGACGGCCACAATGGTCCGGAAGCAGC
TGAGCATTGTCATCATTTAGCTCCTTATCTTCTTAGTCAACACTTGCAAT
CATCTTTATGTATAACAGGTCGTTATAATCTCATTGAAGCTTTGGGAGAA
GCATTTTACTTGCTCAATTTTAAATTGAATGGTTGTCGAAATAAATATCG
TTGGAAAGCAGGAACGACTTCAACAATGTGTTTAATTGATCAAAACACGA
TTTATACTAGTTGGGTTGGGGACAGTTCCGCCTGGCTAGTATACAAAGAT
AGAAAACAAGTGCACTTAACAAGTATTCTTCACAGACCGTCACAAAATAG
TGAAATAATTGATGTGTGGAATAATGGGGGCATAGTTACAAAATCTGGCA
GAGATTTCGATAGAGTAAATGGTGTTTTAGCTGTCACAAGAGCATTGGGT
GATGATAGGAAAATTGTTGGAGTTTCTGCATTGCCTAGTATATCAGAGTG
TCACCTCGATGGAACTGAGCTGTGCTTAGTTCTAGCCTCAGATGGACTGT
GGGATTCTAAACAGTGTTCTGGTCTGGAAATTGCGGATTTATGCCGAGAA
TTTTTCTCGGAAGATAACAACAAACAAACTCCTGTCGACACTCTTTGTCA
AACTATTATAGATCGAGGCGTAAAAGGCGGCGCTTCTGATAACATTAGTT
TAATGATTTTTGTTTTTAATCCAAATAACTCAAATAGCTCAGTGAAATCC
TATGATTTCTCTTATCAAGATTCTCGAGCGATTAAGTGGCCTAGAGATCG
CCGGATGAGCTGTTTTTCTCAAAATTTAGATCAATTACGATTATGTCCAG
AGAAGCTCACTGATTATTTGGAAGTCCATTTCAATCACGATGCAAAAATG
CATTCTGTCGTTGGTGAAGCGCGAATTTTGAATCACTCGAAAACTCGAAT
TTGTCGGTCACAATCTCTTCCTCAGGAAATCCACAAACGTTTCTCCAGTC
CCATAAGACCAATCAAAGTCTATGATACCTCATCTGAAATCGCTAGTAAT
TCAAAGAATTCATTTTGATTATTGATTAAGAACAATATAACGAGAAGCTT
TTTTTATGTTTTGCT
back to top

protein sequence of SMED30031007-orf-1

>SMED30031007-orf-1 ID=SMED30031007-orf-1|Name=SMED30031007-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=526bp
MINTLKEIGLYLDDLEKNEVNTPIRLRSVLKNVDSDNVLAYVKSFIMNTC
NTLYKSNNIFCERICSDFINSDFWKYNSLLQNELVSYPELLTVTKKYLSI
YINEKLKNNPHDPSGLRNSSNHRAYYKAISNKRTKQEDRYFCVTDVLRYS
SNHFCQNSNTCIKNQKLNLENISLLGLFDGHNGPEAAEHCHHLAPYLLSQ
HLQSSLCITGRYNLIEALGEAFYLLNFKLNGCRNKYRWKAGTTSTMCLID
QNTIYTSWVGDSSAWLVYKDRKQVHLTSILHRPSQNSEIIDVWNNGGIVT
KSGRDFDRVNGVLAVTRALGDDRKIVGVSALPSISECHLDGTELCLVLAS
DGLWDSKQCSGLEIADLCREFFSEDNNKQTPVDTLCQTIIDRGVKGGASD
NISLMIFVFNPNNSNSSVKSYDFSYQDSRAIKWPRDRRMSCFSQNLDQLR
LCPEKLTDYLEVHFNHDAKMHSVVGEARILNHSKTRICRSQSLPQEIHKR
FSSPIRPIKVYDTSSEIASNSKNSF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036457PPM-type_dom_sf
IPR015655PP2C
IPR001932PPM-type_phosphatase_dom
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004722protein serine/threonine phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001932PPM-type phosphatase domainSMARTSM00332PP2C_4coord: 107..407
e-value: 8.0E-34
score: 128.4
IPR001932PPM-type phosphatase domainPFAMPF00481PP2Ccoord: 155..402
e-value: 7.9E-35
score: 120.7
IPR001932PPM-type phosphatase domainPROSITEPS51746PPM_2coord: 123..409
score: 27.739
IPR001932PPM-type phosphatase domainCDDcd00143PP2Cccoord: 123..409
e-value: 6.64458E-49
score: 167.503
IPR036457PPM-type phosphatase domain superfamilyGENE3DG3DSA:3.60.40.10coord: 117..417
e-value: 1.4E-53
score: 184.2
IPR036457PPM-type phosphatase domain superfamilySUPERFAMILYSSF81606PP2C-likecoord: 120..411
IPR015655Protein phosphatase 2C familyPANTHERPTHR13832PROTEIN PHOSPHATASE 2Ccoord: 132..409
NoneNo IPR availablePANTHERPTHR13832:SF549PROTEIN PHOSPHATASE 1Dcoord: 132..409